F427688

General Info

Members Datasets Scaffolds Average Seq Length
377 250 754 253

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10722420|Ga0157369_107224202
Length 278
Sequence MNWTLTLRRALASIATTTGDGEEPSVDDLLTVGDVAHLSGVTVRTLHHYDRIGLVTPSGRTPAGYRLYGEGDLDRLHAVLGYRELGFALEQIADLLDGTAEPLAHLRRQHGLVSARIEQLQRLLRGLEKEMEAHMSGTRLTPEEKFEVFGDHDPDEYADEARDRWGDTDAYRQSAQRTASYSKDDWLRIKAEGDAVTQRFADLFTAGAPADGPEAAAAVRDHREHITRWFYDCSPQMQRGLAEMYVADDRFRRTYDDRAPGLAQWVHDAVLAETDTQG

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 2501939600 Micromonospora sp. L5 Isolate Unclassified
185 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
186 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
187 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
188 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
189 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
190 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
191 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
192 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
193 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
194 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
195 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
196 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
197 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
198 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
199 2808606448 Streptomyces sp. 193411 Isolate Unclassified
200 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
201 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
202 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
203 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
204 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
205 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
206 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
207 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
208 2855683550 Micromonospora sp. RP3T Isolate Unclassified
209 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
210 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
211 2858868258 Micromonospora sp. MH33 Isolate Unclassified
212 2858882152 Micromonospora noduli MED15 Isolate Nodule
213 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
214 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
215 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
216 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
217 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
218 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
219 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
220 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
221 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
222 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
223 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
224 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
225 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
226 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
227 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
228 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
229 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
230 2902582711 Micromonospora sp. AP08 Isolate Unclassified
231 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
232 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
233 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
234 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
235 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
236 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
237 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
238 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
239 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
240 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
241 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
242 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
243 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
244 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
245 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
246 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
247 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
248 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
249 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
250 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.9
Metatranscriptomes 1.33
Isolates 17.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.59
Rhizoplane 2.65
Rhizosphere 83.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10722420 3300013105 Bacteria 1025
2 JGI25406J46586_10001999 3300003203 Bacteria 9627
3 rootH1_10116429 3300003316 Bacteria 2203
4 rootH2_10026854 3300003320 Bacteria 1490
5 rootH1_10076967 3300003323 Bacteria 2186
6 Ga0006562J51391_1187511 3300003578 Bacteria 1140
7 Ga0006562J51391_1197901 3300003578 Bacteria 3070
8 Ga0070658_10017106 3300005327 Bacteria 5803
9 Ga0070683_100006177 3300005329 Bacteria 10047
10 Ga0070670_100749111 3300005331 Bacteria 880
11 Ga0070680_100093780 3300005336 Bacteria 2487
12 Ga0070680_100306504 3300005336 Bacteria 1347
13 Ga0070682_100060270 3300005337 Bacteria 2400
14 Ga0070661_100233432 3300005344 Bacteria 1414
15 Ga0070659_100160433 3300005366 Bacteria 1838
16 Ga0070659_100439864 3300005366 Bacteria 1105
17 Ga0070713_100515786 3300005436 Bacteria 1129
18 Ga0070663_100133786 3300005455 Bacteria 1886
19 Ga0070681_10017508 3300005458 Bacteria 7161
20 Ga0070681_10054334 3300005458 Bacteria 3991
21 Ga0070679_100412677 3300005530 Bacteria 1296
22 Ga0070684_100265243 3300005535 Bacteria 1571
23 Ga0070665_100030367 3300005548 Bacteria 5439
24 Ga0070664_100074030 3300005564 Bacteria 2923
25 Ga0070664_100465159 3300005564 Bacteria 1162
26 Ga0068857_100140043 3300005577 Bacteria 2186
27 Ga0068857_100212631 3300005577 Bacteria 1765
28 Ga0068857_100554883 3300005577 Bacteria 1082
29 Ga0068856_100189084 3300005614 Bacteria 2073
30 Ga0068852_100104783 3300005616 Bacteria 2561
31 Ga0068859_100093064 3300005617 Bacteria 3066
32 Ga0068864_100019915 3300005618 Bacteria 5609
33 Ga0068864_100054468 3300005618 Bacteria 3452
34 Ga0068864_100077735 3300005618 Bacteria 2903
35 Ga0068863_100027105 3300005841 Bacteria 5465
36 Ga0068858_100138260 3300005842 Bacteria 2286
37 Ga0068862_100123494 3300005844 Bacteria 2284
38 Ga0081540_1013651 3300005983 Bacteria 5267
39 Ga0081539_10000662 3300005985 Bacteria 69140
40 Ga0081539_10001018 3300005985 Bacteria 51625
41 Ga0070712_100146077 3300006175 Bacteria 1810
42 Ga0075428_100000024 3300006844 Bacteria 126990
43 Ga0075428_100128229 3300006844 Bacteria 2760
44 Ga0075431_100026653 3300006847 Bacteria 5929
45 Ga0097620_100093064 3300006931 Bacteria 3066
46 Ga0114129_10000790 3300009147 Bacteria 40604
47 Ga0105248_10029673 3300009177 Bacteria 6102
48 Ga0105239_10635167 3300010375 Bacteria 1219
49 Ga0157370_10204706 3300013104 Bacteria 1830
50 Ga0157369_10026104 3300013105 Bacteria 6481
51 Ga0163163_10046045 3300014325 Bacteria 4283
52 Ga0163163_10101211 3300014325 Bacteria 2904
53 Ga0206356_10776282 3300020070 Bacteria 2759
54 Ga0206354_11324607 3300020081 Bacteria 1193
55 Ga0206353_11377812 3300020082 Bacteria 3999
56 Ga0207705_10036556 3300025909 Bacteria 3514
57 Ga0207705_10348452 3300025909 Bacteria 1140
58 Ga0207707_10279157 3300025912 Bacteria 1447
59 Ga0207657_10218991 3300025919 Bacteria 1526
60 Ga0207649_10057108 3300025920 Bacteria 2439
61 Ga0207652_10120646 3300025921 Bacteria 2332
62 Ga0207659_10518965 3300025926 Bacteria 1010
63 Ga0207700_10373418 3300025928 Bacteria 1246
64 Ga0207664_10248223 3300025929 Bacteria 1552
65 Ga0207706_10561281 3300025933 Bacteria 982
66 Ga0207665_10048592 3300025939 Bacteria 2849
67 Ga0207711_10075796 3300025941 Bacteria 2928
68 Ga0207661_10008186 3300025944 Bacteria 7462
69 Ga0207679_10386421 3300025945 Bacteria 1228
70 Ga0207679_10618853 3300025945 Bacteria 977
71 Ga0207703_10167726 3300026035 Bacteria 1928
72 Ga0207678_10150687 3300026067 Bacteria 1986
73 Ga0207678_10266131 3300026067 Bacteria 1470
74 Ga0207702_10074347 3300026078 Bacteria 2933
75 Ga0207641_10039306 3300026088 Bacteria 3956
76 Ga0207676_10017344 3300026095 Bacteria 5218
77 Ga0207676_10082847 3300026095 Bacteria 2611
78 Ga0207676_10495706 3300026095 Bacteria 1159
79 Ga0207674_10096518 3300026116 Bacteria 2941
80 Ga0207674_10159767 3300026116 Bacteria 2208
81 Ga0207674_10264598 3300026116 Bacteria 1667
82 Ga0207698_10099095 3300026142 Bacteria 2410
83 Ga0209371_1012503 3300027312 Bacteria 2450
84 Ga0268256_1024193 3300030500 Bacteria 1562
85 Ga0307408_100016623 3300031548 Bacteria 4915
86 Ga0307408_100106648 3300031548 Bacteria 2144
87 Ga0307408_100207452 3300031548 Bacteria 1590
88 Ga0307405_10064153 3300031731 Bacteria 2333
89 Ga0307405_10196311 3300031731 Bacteria 1462
90 Ga0307405_10337471 3300031731 Bacteria 1157
91 Ga0307413_10316066 3300031824 Bacteria 1191
92 Ga0307410_10010689 3300031852 Bacteria 5215
93 Ga0307410_10386243 3300031852 Bacteria 1128
94 Ga0307406_10036094 3300031901 Bacteria 3043
95 Ga0307406_10179899 3300031901 Bacteria 1538
96 Ga0307407_10237083 3300031903 Bacteria 1242
97 Ga0307409_100029128 3300031995 Bacteria 3947
98 Ga0307409_100102351 3300031995 Bacteria 2379
99 Ga0307409_100114118 3300031995 Bacteria 2272
100 Ga0307409_100176654 3300031995 Bacteria 1885
101 Ga0307409_100296660 3300031995 Bacteria 1501
102 Ga0307409_100403665 3300031995 Bacteria 1306
103 Ga0307409_100903392 3300031995 Bacteria 897
104 Ga0307416_100340916 3300032002 Bacteria 1511
105 Ga0307414_10289285 3300032004 Bacteria 1381
106 Ga0307415_100039255 3300032126 Bacteria 3127
107 Ga0307415_100615748 3300032126 Bacteria 968
108 Ga0307415_100711065 3300032126 Bacteria 908
109 Ga0307507_10143265 3300033179 Bacteria 1825
110 Ga0373925_0353813 3300037068 Bacteria 1193
111 Ga0395900_0190695 3300037418 Bacteria 2079
112 Ga0395898_0006911 3300037466 Bacteria 12065
113 Ga0395898_0022180 3300037466 Bacteria 6434
114 Ga0395901_0005614 3300038443 Bacteria 12697
115 Ga0395901_0353496 3300038443 Bacteria 1516
116 Ga0395901_0980129 3300038443 Bacteria 822
117 Ga0436363_0085541 3300039450 Bacteria 1346
118 Ga0436363_1097840 3300039450 Bacteria 2345
119 Ga0439433_0003500 3300041999 Bacteria 3372
120 Ga0439449_0043465 3300042007 Bacteria 1668
121 Ga0439458_0021351 3300042157 Bacteria 1498
122 Ga0466969_0084690 3300044656 Bacteria 1508
123 Ga0466972_0023103 3300044658 Bacteria 3094
124 Ga0466965_0003569 3300044683 Bacteria 6841
125 Ga0466965_0170092 3300044683 Bacteria 1146
126 Ga0466965_0222627 3300044683 Bacteria 1006
127 Ga0466966_0000816 3300044684 Bacteria 19872
128 Ga0466961_0001735 3300044693 Bacteria 13550
129 Ga0466961_0103880 3300044693 Bacteria 1789
130 Ga0466963_0001602 3300044694 Bacteria 12306
131 Ga0466963_0038912 3300044694 Bacteria 3112
132 Ga0466963_0118549 3300044694 Bacteria 1820
133 Ga0466963_0168645 3300044694 Bacteria 1525
134 Ga0466964_0002245 3300044706 Bacteria 6850
135 Ga0466964_0089418 3300044706 Bacteria 1338
136 Ga0466971_0000667 3300044719 Bacteria 13666
137 Ga0466971_0024270 3300044719 Bacteria 2706
138 Ga0466968_0063381 3300044735 Bacteria 1598
139 Ga0466970_0000340 3300044765 Bacteria 22884
140 Ga0466970_0102249 3300044765 Bacteria 1561
141 Ga0466970_0189139 3300044765 Bacteria 1144
142 Ga0466957_0000092 3300044842 Bacteria 36059
143 Ga0466957_0071213 3300044842 Bacteria 2150
144 Ga0466960_0093850 3300044901 Bacteria 1534
145 Ga0466960_0115766 3300044901 Bacteria 1398
146 Ga0466959_0001644 3300045049 Bacteria 13818
147 Ga0466959_0168285 3300045049 Bacteria 1538
148 Ga0466959_0317442 3300045049 Bacteria 1065
149 Ga0466959_0368510 3300045049 Bacteria 978
150 Ga0466958_0000347 3300045836 Bacteria 18582
151 Ga0466958_0039462 3300045836 Bacteria 2837
152 Ga0466967_0002930 3300045976 Bacteria 10894
153 Ga0466967_0007261 3300045976 Bacteria 7971
154 Ga0466967_0024910 3300045976 Bacteria 4926
155 Ga0466967_0144627 3300045976 Bacteria 2217
156 Ga0495592_0009661 3300046454 Bacteria 7260
157 Ga0495603_0016660 3300046455 Bacteria 4446
158 Ga0495629_0025955 3300046459 Bacteria 4163
159 Ga0495629_0072786 3300046459 Bacteria 2400
160 Ga0495605_0003483 3300046474 Bacteria 9363
161 Ga0495639_0029141 3300046475 Bacteria 2450
162 Ga0495662_0215293 3300046476 Bacteria 947
163 Ga0495664_0048904 3300046477 Bacteria 2510
164 Ga0495585_0066816 3300046492 Bacteria 1968
165 Ga0495583_0014553 3300046506 Bacteria 4334
166 Ga0495606_0025741 3300046507 Bacteria 4205
167 Ga0495616_0006480 3300046513 Bacteria 7081
168 Ga0495628_0029081 3300046516 Bacteria 4485
169 Ga0495628_0093720 3300046516 Bacteria 2322
170 Ga0495631_0013869 3300046518 Bacteria 3900
171 Ga0495643_0017268 3300046522 Bacteria 4220
172 Ga0495666_0018415 3300046526 Bacteria 3475
173 Ga0495652_0049878 3300046529 Bacteria 3581
174 Ga0495640_0039853 3300046533 Bacteria 3293
175 Ga0495597_0012142 3300046542 Bacteria 4163
176 Ga0495634_0224637 3300046642 Bacteria 1157
177 Ga0495611_0010242 3300046648 Bacteria 3967
178 Ga0495611_0053615 3300046648 Bacteria 1820
179 Ga0495611_0170163 3300046648 Bacteria 1018
180 Ga0495625_0082942 3300046660 Bacteria 2228
181 Ga0495625_0150665 3300046660 Bacteria 1564
182 Ga0495635_0054793 3300046663 Bacteria 2746
183 Ga0495661_0158043 3300046665 Bacteria 1219
184 Ga0495657_0036328 3300046675 Bacteria 3405
185 Ga0495623_0064556 3300046679 Bacteria 2291
186 Ga0495613_0151485 3300046689 Bacteria 1654
187 Ga0495613_0410537 3300046689 Bacteria 923
188 Ga0495624_0036256 3300046690 Bacteria 3181
189 Ga0495670_0032977 3300046691 Bacteria 2576
190 Ga0495589_0010629 3300046794 Bacteria 4786
191 Ga0495589_0087116 3300046794 Bacteria 1516
192 Ga0495581_0083969 3300047315 Bacteria 1845
193 Ga0495604_0002208 3300047317 Bacteria 15579
194 Ga0495604_0020182 3300047317 Bacteria 5325
195 Ga0495604_0304591 3300047317 Bacteria 1069
196 Ga0495636_0100781 3300047318 Bacteria 1262
197 Ga0495676_0052290 3300047321 Bacteria 3261
198 Ga0495676_0167882 3300047321 Bacteria 1546
199 Ga0495680_0009376 3300047322 Bacteria 8806
200 Ga0495683_0057503 3300047323 Bacteria 1933
201 Ga0495675_0019898 3300047444 Bacteria 4266
202 Ga0495677_0156757 3300047445 Bacteria 878
203 Ga0495685_005889 3300047447 Bacteria 4005
204 Ga0495685_006748 3300047447 Bacteria 3771
205 Ga0495685_033195 3300047447 Bacteria 1773
206 Ga0495593_0013456 3300047673 Bacteria 4666
207 Ga0495593_0037410 3300047673 Bacteria 2625
208 Ga0495626_0070788 3300048091 Bacteria 1568
209 Ga0496100_0219124 3300048903 Bacteria 1396
210 Ga0496104_0060862 3300048907 Bacteria 3577
211 Ga0496108_0027864 3300048911 Bacteria 4670
212 Ga0496109_0022890 3300048912 Bacteria 5538
213 Ga0496110_0004312 3300048913 Bacteria 11007
214 Ga0496111_0032437 3300048914 Bacteria 3724
215 Ga0496112_0077532 3300048915 Bacteria 3286
216 Ga0496112_0125782 3300048915 Bacteria 2534
217 Ga0496112_0195993 3300048915 Bacteria 1980
218 Ga0496113_0024217 3300048916 Bacteria 4311
219 Ga0501031_0003732 3300049568 Bacteria 9801
220 Ga0501031_0036425 3300049568 Bacteria 3209
221 Ga0501031_0075582 3300049568 Bacteria 2193
222 Ga0501032_0056468 3300049569 Bacteria 2639
223 Ga0501032_0135629 3300049569 Bacteria 1622
224 Ga0501033_0079682 3300049570 Bacteria 2403
225 Ga0501034_0467034 3300049571 Bacteria 1178
226 Ga0501036_0012550 3300049572 Bacteria 7028
227 Ga0501036_0026478 3300049572 Bacteria 4895
228 Ga0501036_0116242 3300049572 Bacteria 2259
229 Ga0501037_0018004 3300049573 Bacteria 5201
230 Ga0501037_0320121 3300049573 Bacteria 1074
231 Ga0501038_0016124 3300049574 Bacteria 6782
232 Ga0501038_0147297 3300049574 Bacteria 1921
233 Ga0501039_0002652 3300049575 Bacteria 13359
234 Ga0501039_0016057 3300049575 Bacteria 5735
235 Ga0501039_0052795 3300049575 Bacteria 3144
236 Ga0501040_0001071 3300049576 Bacteria 17307
237 Ga0501040_0007298 3300049576 Bacteria 7162
238 Ga0501040_0023390 3300049576 Bacteria 4143
239 Ga0501040_0154473 3300049576 Bacteria 1620
240 Ga0501041_0001582 3300049577 Bacteria 12679
241 Ga0501042_0007259 3300049578 Bacteria 7247
242 Ga0501042_0012008 3300049578 Bacteria 5857
243 Ga0501042_0080857 3300049578 Bacteria 2328
244 Ga0501046_0035941 3300049580 Bacteria 3989
245 Ga0501046_0064617 3300049580 Bacteria 2856
246 Ga0501048_0016059 3300049582 Bacteria 5521
247 Ga0501048_0019419 3300049582 Bacteria 4987
248 Ga0501048_0044743 3300049582 Bacteria 3163
249 Ga0501068_0004119 3300049584 Bacteria 7883
250 Ga0501069_0011442 3300049585 Bacteria 4700
251 Ga0501069_0063434 3300049585 Bacteria 2064
252 Ga0501069_0074958 3300049585 Bacteria 1899
253 Ga0501070_0026176 3300049586 Bacteria 4896
254 Ga0501070_0073443 3300049586 Bacteria 2830
255 Ga0501071_0000994 3300049587 Bacteria 15542
256 Ga0501071_0004044 3300049587 Bacteria 9266
257 Ga0501071_0004956 3300049587 Bacteria 8504
258 Ga0501071_0104107 3300049587 Bacteria 2094
259 Ga0501072_0007311 3300049588 Bacteria 8375
260 Ga0501072_0011968 3300049588 Bacteria 6628
261 Ga0501072_0023775 3300049588 Bacteria 4760
262 Ga0501072_0389004 3300049588 Bacteria 1106
263 Ga0501073_0084817 3300049589 Bacteria 2204
264 Ga0501073_0471715 3300049589 Bacteria 868
265 Ga0501074_0002885 3300049590 Bacteria 12055
266 Ga0501074_0062072 3300049590 Bacteria 2692
267 Ga0501074_0133910 3300049590 Bacteria 1773
268 Ga0501075_0058366 3300049591 Bacteria 2906
269 Ga0501075_0214394 3300049591 Bacteria 1468
270 Ga0501075_0293058 3300049591 Bacteria 1240
271 Ga0501076_0001271 3300049592 Bacteria 16815
272 Ga0501076_0025799 3300049592 Bacteria 4550
273 Ga0501076_0099530 3300049592 Bacteria 2342
274 Ga0501076_0120510 3300049592 Bacteria 2124
275 Ga0501077_0016051 3300049593 Bacteria 4718
276 Ga0501077_0046116 3300049593 Bacteria 2769
277 Ga0501079_0009957 3300049741 Bacteria 7217
278 Ga0501079_0020640 3300049741 Bacteria 5036
279 Ga0501079_0026515 3300049741 Bacteria 4441
280 Ga0501079_0054569 3300049741 Bacteria 3082
281 Ga0501079_0178776 3300049741 Bacteria 1655
282 Ga0501080_0002442 3300049742 Bacteria 16251
283 Ga0501080_0055630 3300049742 Bacteria 3685
284 Ga0501080_0060100 3300049742 Bacteria 3537
285 Ga0501080_0112183 3300049742 Bacteria 2527
286 Ga0501080_0263809 3300049742 Bacteria 1568
287 Ga0501081_0027952 3300049743 Bacteria 3803
288 Ga0501081_0045201 3300049743 Bacteria 3023
289 Ga0501081_0175550 3300049743 Bacteria 1548
290 Ga0501083_0113848 3300049744 Bacteria 1777
291 Ga0501083_0183437 3300049744 Bacteria 1366
292 Ga0501035_0034038 3300049822 Bacteria 4631
293 Ga0501035_0043838 3300049822 Bacteria 4030
294 Ga0501044_0076563 3300049823 Bacteria 3395
295 Ga0501045_0011617 3300049824 Bacteria 6185
296 Ga0501045_0082923 3300049824 Bacteria 2365
297 Ga0501045_0098912 3300049824 Bacteria 2158
298 nmdc:mga05p37_12730_c1 3300050507 Bacteria 10057
299 nmdc:mga06r32_21308_c1 3300050510 Bacteria 5983
300 nmdc:mga08y16_204340_c1 3300050511 Bacteria 2047
301 nmdc:mga08y16_367303_c1 3300050511 Bacteria 1476
302 Ga0501084_0006776 3300054114 Bacteria 9413
303 Ga0501084_0042870 3300054114 Bacteria 3785
304 Ga0501084_0150113 3300054114 Bacteria 1964
305 Ga0501082_0007612 3300060353 Bacteria 9340
306 Ga0501082_0015609 3300060353 Bacteria 6538
307 Ga0501082_0068575 3300060353 Bacteria 3053
308 Ga0466962_0000562 3300061719 Bacteria 16321
309 Ga0530510_0008012 3300061734 Bacteria 7368
310 Ga0530510_0010492 3300061734 Bacteria 6496
311 2501943979 2501939600 Bacteria 6907073
312 2515493596 2515154088 Bacteria 5526283
313 2515758526 2515154137 Bacteria 5711575
314 2516087866 2515154203 Bacteria 5458536
315 2547411627 2547132111 Bacteria 8013147
316 2554257048 2554235005 Bacteria 6457341
317 2585305156 2582581313 Bacteria 10042643
318 2616701492 2616644814 Bacteria 11555299
319 2623586852 2622736626 Bacteria 7181580
320 2644437577 2643221678 Bacteria 9540101
321 2676487132 2675903059 Bacteria 8644972
322 2676494081 2675903060 Bacteria 10051191
323 2772646261 2772190715 Bacteria 6959372
324 2784589392 2784132148 Bacteria 8627943
325 2808843032 2808606359 Bacteria 9866990
326 2809233054 2808606448 Bacteria 8656184
327 2812357091 2811994879 Bacteria 9313447
328 2812479749 2811994917 Bacteria 7761064
329 2819741742 2818991472 Bacteria 10089953
330 2831938338 2831935698 Bacteria 5963223
331 2832006464 2832004796 Bacteria 6538017
332 2852640046 2852635781 Bacteria 8251373
333 2855671389 2855670206 Bacteria 7120389
334 2855678474 2855676851 Bacteria 7063653
335 2855685827 2855683550 Bacteria 7134265
336 2857292085 2857288857 Bacteria 7189066
337 2858850872 2858848962 Bacteria 6963058
338 2858872364 2858868258 Bacteria 7683772
339 2858883758 2858882152 Bacteria 7230291
340 2858894154 2858888857 Bacteria 7060307
341 2858901026 2858895516 Bacteria 7378898
342 2862510251 2862507626 Bacteria 9425308
343 2862709579 2862705112 Bacteria 6563286
344 2866066877 2866065130 Bacteria 6518152
345 2867306506 2867302475 Bacteria 7087181
346 2867312986 2867312974 Bacteria 7058875
347 2867325011 2867319477 Bacteria 7069771
348 2867510269 2867507094 Bacteria 6506033
349 2869049853 2869048445 Bacteria 6875584
350 2869062460 2869061728 Bacteria 7112407
351 2869070831 2869068681 Bacteria 7205615
352 2880493373 2880489317 Bacteria 7096270
353 2880498922 2880495981 Bacteria 7340502
354 2891398571 2891395885 Bacteria 9251614
355 2891560704 2891554331 Bacteria 8812224
356 2895438532 2895427314 Bacteria 13147766
357 2902586539 2902582711 Bacteria 6187705
358 2912718739 2912715099 Bacteria 9460473
359 2929220932 2929219909 Bacteria 6984360
360 2929227513 2929226422 Bacteria 7248583
361 2946068787 2946064051 Bacteria 8957905
362 2996222581 2996221748 Bacteria 6799777
363 3006489125 3006486233 Bacteria 8157040
364 8003831271 8003830390 Bacteria 6541657
365 8003858453 8003856774 Bacteria 7675274
366 8003871402 8003870546 Bacteria 7396674
367 8008485869 8008485437 Bacteria 7198341
368 8023629562 8023623736 Bacteria 8593882
369 8025484496 8025478263 Bacteria 8209203
370 8025524953 8025524527 Bacteria 7197316
371 8054161366 8054160619 Bacteria 7783213
372 8054710837 8054704163 Bacteria 7247792
373 8054727488 8054727385 Bacteria 7558670
374 8054734934 8054734606 Bacteria 6947278
375 8055413496 8055412473 Bacteria 6257500
376 8056669197 8056667051 Bacteria 6953971
377 8056833216 8056829672 Bacteria 9045328
378 Ga0157369_10722420
379 JGI25406J46586_10001999
380 rootH1_10116429
381 rootH2_10026854
382 rootH1_10076967
383 Ga0006562J51391_1187511
384 Ga0006562J51391_1197901
385 Ga0070658_10017106
386 Ga0070683_100006177
387 Ga0070670_100749111
388 Ga0070680_100093780
389 Ga0070680_100306504
390 Ga0070682_100060270
391 Ga0070661_100233432
392 Ga0070659_100160433
393 Ga0070659_100439864
394 Ga0070713_100515786
395 Ga0070663_100133786
396 Ga0070681_10017508
397 Ga0070681_10054334
398 Ga0070679_100412677
399 Ga0070684_100265243
400 Ga0070665_100030367
401 Ga0070664_100074030
402 Ga0070664_100465159
403 Ga0068857_100140043
404 Ga0068857_100212631
405 Ga0068857_100554883
406 Ga0068856_100189084
407 Ga0068852_100104783
408 Ga0068859_100093064
409 Ga0068864_100019915
410 Ga0068864_100054468
411 Ga0068864_100077735
412 Ga0068863_100027105
413 Ga0068858_100138260
414 Ga0068862_100123494
415 Ga0081540_1013651
416 Ga0081539_10000662
417 Ga0081539_10001018
418 Ga0070712_100146077
419 Ga0075428_100000024
420 Ga0075428_100128229
421 Ga0075431_100026653
422 Ga0097620_100093064
423 Ga0114129_10000790
424 Ga0105248_10029673
425 Ga0105239_10635167
426 Ga0157370_10204706
427 Ga0157369_10026104
428 Ga0163163_10046045
429 Ga0163163_10101211
430 Ga0206356_10776282
431 Ga0206354_11324607
432 Ga0206353_11377812
433 Ga0207705_10036556
434 Ga0207705_10348452
435 Ga0207707_10279157
436 Ga0207657_10218991
437 Ga0207649_10057108
438 Ga0207652_10120646
439 Ga0207659_10518965
440 Ga0207700_10373418
441 Ga0207664_10248223
442 Ga0207706_10561281
443 Ga0207665_10048592
444 Ga0207711_10075796
445 Ga0207661_10008186
446 Ga0207679_10386421
447 Ga0207679_10618853
448 Ga0207703_10167726
449 Ga0207678_10150687
450 Ga0207678_10266131
451 Ga0207702_10074347
452 Ga0207641_10039306
453 Ga0207676_10017344
454 Ga0207676_10082847
455 Ga0207676_10495706
456 Ga0207674_10096518
457 Ga0207674_10159767
458 Ga0207674_10264598
459 Ga0207698_10099095
460 Ga0209371_1012503
461 Ga0268256_1024193
462 Ga0307408_100016623
463 Ga0307408_100106648
464 Ga0307408_100207452
465 Ga0307405_10064153
466 Ga0307405_10196311
467 Ga0307405_10337471
468 Ga0307413_10316066
469 Ga0307410_10010689
470 Ga0307410_10386243
471 Ga0307406_10036094
472 Ga0307406_10179899
473 Ga0307407_10237083
474 Ga0307409_100029128
475 Ga0307409_100102351
476 Ga0307409_100114118
477 Ga0307409_100176654
478 Ga0307409_100296660
479 Ga0307409_100403665
480 Ga0307409_100903392
481 Ga0307416_100340916
482 Ga0307414_10289285
483 Ga0307415_100039255
484 Ga0307415_100615748
485 Ga0307415_100711065
486 Ga0307507_10143265
487 Ga0373925_0353813
488 Ga0395900_0190695
489 Ga0395898_0006911
490 Ga0395898_0022180
491 Ga0395901_0005614
492 Ga0395901_0353496
493 Ga0395901_0980129
494 Ga0436363_0085541
495 Ga0436363_1097840
496 Ga0439433_0003500
497 Ga0439449_0043465
498 Ga0439458_0021351
499 Ga0466969_0084690
500 Ga0466972_0023103
501 Ga0466965_0003569
502 Ga0466965_0170092
503 Ga0466965_0222627
504 Ga0466966_0000816
505 Ga0466961_0001735
506 Ga0466961_0103880
507 Ga0466963_0001602
508 Ga0466963_0038912
509 Ga0466963_0118549
510 Ga0466963_0168645
511 Ga0466964_0002245
512 Ga0466964_0089418
513 Ga0466971_0000667
514 Ga0466971_0024270
515 Ga0466968_0063381
516 Ga0466970_0000340
517 Ga0466970_0102249
518 Ga0466970_0189139
519 Ga0466957_0000092
520 Ga0466957_0071213
521 Ga0466960_0093850
522 Ga0466960_0115766
523 Ga0466959_0001644
524 Ga0466959_0168285
525 Ga0466959_0317442
526 Ga0466959_0368510
527 Ga0466958_0000347
528 Ga0466958_0039462
529 Ga0466967_0002930
530 Ga0466967_0007261
531 Ga0466967_0024910
532 Ga0466967_0144627
533 Ga0495592_0009661
534 Ga0495603_0016660
535 Ga0495629_0025955
536 Ga0495629_0072786
537 Ga0495605_0003483
538 Ga0495639_0029141
539 Ga0495662_0215293
540 Ga0495664_0048904
541 Ga0495585_0066816
542 Ga0495583_0014553
543 Ga0495606_0025741
544 Ga0495616_0006480
545 Ga0495628_0029081
546 Ga0495628_0093720
547 Ga0495631_0013869
548 Ga0495643_0017268
549 Ga0495666_0018415
550 Ga0495652_0049878
551 Ga0495640_0039853
552 Ga0495597_0012142
553 Ga0495634_0224637
554 Ga0495611_0010242
555 Ga0495611_0053615
556 Ga0495611_0170163
557 Ga0495625_0082942
558 Ga0495625_0150665
559 Ga0495635_0054793
560 Ga0495661_0158043
561 Ga0495657_0036328
562 Ga0495623_0064556
563 Ga0495613_0151485
564 Ga0495613_0410537
565 Ga0495624_0036256
566 Ga0495670_0032977
567 Ga0495589_0010629
568 Ga0495589_0087116
569 Ga0495581_0083969
570 Ga0495604_0002208
571 Ga0495604_0020182
572 Ga0495604_0304591
573 Ga0495636_0100781
574 Ga0495676_0052290
575 Ga0495676_0167882
576 Ga0495680_0009376
577 Ga0495683_0057503
578 Ga0495675_0019898
579 Ga0495677_0156757
580 Ga0495685_005889
581 Ga0495685_006748
582 Ga0495685_033195
583 Ga0495593_0013456
584 Ga0495593_0037410
585 Ga0495626_0070788
586 Ga0496100_0219124
587 Ga0496104_0060862
588 Ga0496108_0027864
589 Ga0496109_0022890
590 Ga0496110_0004312
591 Ga0496111_0032437
592 Ga0496112_0077532
593 Ga0496112_0125782
594 Ga0496112_0195993
595 Ga0496113_0024217
596 Ga0501031_0003732
597 Ga0501031_0036425
598 Ga0501031_0075582
599 Ga0501032_0056468
600 Ga0501032_0135629
601 Ga0501033_0079682
602 Ga0501034_0467034
603 Ga0501036_0012550
604 Ga0501036_0026478
605 Ga0501036_0116242
606 Ga0501037_0018004
607 Ga0501037_0320121
608 Ga0501038_0016124
609 Ga0501038_0147297
610 Ga0501039_0002652
611 Ga0501039_0016057
612 Ga0501039_0052795
613 Ga0501040_0001071
614 Ga0501040_0007298
615 Ga0501040_0023390
616 Ga0501040_0154473
617 Ga0501041_0001582
618 Ga0501042_0007259
619 Ga0501042_0012008
620 Ga0501042_0080857
621 Ga0501046_0035941
622 Ga0501046_0064617
623 Ga0501048_0016059
624 Ga0501048_0019419
625 Ga0501048_0044743
626 Ga0501068_0004119
627 Ga0501069_0011442
628 Ga0501069_0063434
629 Ga0501069_0074958
630 Ga0501070_0026176
631 Ga0501070_0073443
632 Ga0501071_0000994
633 Ga0501071_0004044
634 Ga0501071_0004956
635 Ga0501071_0104107
636 Ga0501072_0007311
637 Ga0501072_0011968
638 Ga0501072_0023775
639 Ga0501072_0389004
640 Ga0501073_0084817
641 Ga0501073_0471715
642 Ga0501074_0002885
643 Ga0501074_0062072
644 Ga0501074_0133910
645 Ga0501075_0058366
646 Ga0501075_0214394
647 Ga0501075_0293058
648 Ga0501076_0001271
649 Ga0501076_0025799
650 Ga0501076_0099530
651 Ga0501076_0120510
652 Ga0501077_0016051
653 Ga0501077_0046116
654 Ga0501079_0009957
655 Ga0501079_0020640
656 Ga0501079_0026515
657 Ga0501079_0054569
658 Ga0501079_0178776
659 Ga0501080_0002442
660 Ga0501080_0055630
661 Ga0501080_0060100
662 Ga0501080_0112183
663 Ga0501080_0263809
664 Ga0501081_0027952
665 Ga0501081_0045201
666 Ga0501081_0175550
667 Ga0501083_0113848
668 Ga0501083_0183437
669 Ga0501035_0034038
670 Ga0501035_0043838
671 Ga0501044_0076563
672 Ga0501045_0011617
673 Ga0501045_0082923
674 Ga0501045_0098912
675 nmdc:mga05p37_12730_c1
676 nmdc:mga06r32_21308_c1
677 nmdc:mga08y16_204340_c1
678 nmdc:mga08y16_367303_c1
679 Ga0501084_0006776
680 Ga0501084_0042870
681 Ga0501084_0150113
682 Ga0501082_0007612
683 Ga0501082_0015609
684 Ga0501082_0068575
685 Ga0466962_0000562
686 Ga0530510_0008012
687 Ga0530510_0010492
688 2501943979
689 2515493596
690 2515758526
691 2516087866
692 2547411627
693 2554257048
694 2585305156
695 2616701492
696 2623586852
697 2644437577
698 2676487132
699 2676494081
700 2772646261
701 2784589392
702 2808843032
703 2809233054
704 2812357091
705 2812479749
706 2819741742
707 2831938338
708 2832006464
709 2852640046
710 2855671389
711 2855678474
712 2855685827
713 2857292085
714 2858850872
715 2858872364
716 2858883758
717 2858894154
718 2858901026
719 2862510251
720 2862709579
721 2866066877
722 2867306506
723 2867312986
724 2867325011
725 2867510269
726 2869049853
727 2869062460
728 2869070831
729 2880493373
730 2880498922
731 2891398571
732 2891560704
733 2895438532
734 2902586539
735 2912718739
736 2929220932
737 2929227513
738 2946068787
739 2996222581
740 3006489125
741 8003831271
742 8003858453
743 8003871402
744 8008485869
745 8023629562
746 8025484496
747 8025524953
748 8054161366
749 8054710837
750 8054727488
751 8054734934
752 8055413496
753 8056669197
754 8056833216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

31

68

0.99

PF07739

TipAS

TipAS antibiotic-recognition domain

157

272

0.99

PF13411

MerR_1

MerR HTH family regulatory protein

30

99

0.95

PF09278

MerR-DNA-bind

MerR, DNA binding

73

129

0.9

Map