F427655

General Info

Members Datasets Scaffolds Average Seq Length
377 223 754 62

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10393382|Ga0075433_103933822
Length 69
Sequence VRIILNIVGVLMMLMGSIWFLQGINILPGSFMTGQIRWAVYGGGTAFVGLGLVVAANRRRHGVSPGSRP

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 1.06
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 27.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10393382 3300006852 Unclassified 1223
2 Ga0065715_10135975 3300005293 Unclassified 1927
3 Ga0065707_10491933 3300005295 Unclassified 764
4 Ga0070676_10006221 3300005328 Bacteria 6377
5 Ga0070683_100073505 3300005329 Unclassified 3192
6 Ga0070670_100379226 3300005331 Bacteria 1246
7 Ga0070677_10140220 3300005333 Bacteria 1114
8 Ga0068869_100024589 3300005334 Unclassified 4172
9 Ga0068868_100089947 3300005338 Unclassified 2472
10 Ga0068868_100363529 3300005338 Bacteria 1242
11 Ga0068868_101275532 3300005338 Bacteria 682
12 Ga0070660_100125819 3300005339 Unclassified 2048
13 Ga0070689_100053511 3300005340 Plasmid 3124
14 Ga0070689_100173391 3300005340 Bacteria 1748
15 Ga0070687_100247026 3300005343 Unclassified 1106
16 Ga0070687_100512344 3300005343 Bacteria 810
17 Ga0070661_100016249 3300005344 Bacteria 5259
18 Ga0070692_10006797 3300005345 Unclassified 4992
19 Ga0070668_100001837 3300005347 Bacteria 15454
20 Ga0070669_100009736 3300005353 Bacteria 6846
21 Ga0070669_100101829 3300005353 Bacteria 2168
22 Ga0070669_100214797 3300005353 Bacteria 1519
23 Ga0070669_100780737 3300005353 Unclassified 811
24 Ga0070675_100000997 3300005354 Bacteria 20294
25 Ga0070675_100004603 3300005354 Bacteria 10534
26 Ga0070675_100533275 3300005354 Bacteria 1060
27 Ga0070675_100893450 3300005354 Bacteria 814
28 Ga0070671_100485185 3300005355 Bacteria 1062
29 Ga0070674_100115621 3300005356 Bacteria 1978
30 Ga0070673_100041248 3300005364 Bacteria 3548
31 Ga0070673_100067953 3300005364 Bacteria 2852
32 Ga0070673_100262224 3300005364 Bacteria 1510
33 Ga0070673_100526264 3300005364 Bacteria 1072
34 Ga0070688_100245339 3300005365 Bacteria 1273
35 Ga0070659_100128622 3300005366 Bacteria 2055
36 Ga0070667_100011514 3300005367 Bacteria 7316
37 Ga0070667_100899745 3300005367 Bacteria 824
38 Ga0070667_102139306 3300005367 Unclassified 527
39 Ga0070701_10003298 3300005438 Bacteria 6361
40 Ga0070701_10875939 3300005438 Bacteria 618
41 Ga0070705_100811027 3300005440 Unclassified 745
42 Ga0070700_100004441 3300005441 Bacteria 7328
43 Ga0070700_101007166 3300005441 Unclassified 685
44 Ga0070694_100031966 3300005444 Plasmid 3453
45 Ga0070708_100861737 3300005445 Unclassified 851
46 Ga0070663_100085165 3300005455 Unclassified 2332
47 Ga0070662_100020629 3300005457 Unclassified 4492
48 Ga0068867_100451817 3300005459 Unclassified 1095
49 Ga0070685_10003180 3300005466 Bacteria 8354
50 Ga0070685_10085739 3300005466 Bacteria 1897
51 Ga0070685_10366466 3300005466 Bacteria 989
52 Ga0070706_100602671 3300005467 Unclassified 1021
53 Ga0070706_100806142 3300005467 Bacteria 869
54 Ga0070707_102196109 3300005468 Unclassified 519
55 Ga0070698_100183587 3300005471 Bacteria 2030
56 Ga0070698_100406013 3300005471 Bacteria 1296
57 Ga0070698_100750097 3300005471 Unclassified 919
58 Ga0070684_100026560 3300005535 Unclassified 4880
59 Ga0070684_100077533 3300005535 Bacteria 2935
60 Ga0070684_100106171 3300005535 Bacteria 2514
61 Ga0070684_101151940 3300005535 Bacteria 729
62 Ga0070697_100812743 3300005536 Bacteria 827
63 Ga0068853_100165950 3300005539 Bacteria 1995
64 Ga0068853_100239347 3300005539 Bacteria 1663
65 Ga0070672_100247582 3300005543 Bacteria 1500
66 Ga0070672_101863021 3300005543 Unclassified 541
67 Ga0070686_100310446 3300005544 Bacteria 1172
68 Ga0070696_100036142 3300005546 Bacteria 3404
69 Ga0070665_100315537 3300005548 Bacteria 1567
70 Ga0070665_101059127 3300005548 Bacteria 823
71 Ga0070665_101973954 3300005548 Bacteria 589
72 Ga0070704_100095003 3300005549 Unclassified 2232
73 Ga0068855_100081759 3300005563 Bacteria 3744
74 Ga0068855_101352967 3300005563 Unclassified 735
75 Ga0068857_100018300 3300005577 Bacteria 6146
76 Ga0068857_101492181 3300005577 Unclassified 659
77 Ga0068854_100108547 3300005578 Bacteria 2090
78 Ga0068856_100068015 3300005614 Bacteria 3521
79 Ga0068856_100231822 3300005614 Unclassified 1861
80 Ga0070702_101260426 3300005615 Bacteria 598
81 Ga0068852_100036117 3300005616 Plasmid 4131
82 Ga0068852_100086779 3300005616 Bacteria 2790
83 Ga0068852_101651544 3300005616 Unclassified 663
84 Ga0068852_101942974 3300005616 Bacteria 611
85 Ga0068859_100403507 3300005617 Bacteria 1463
86 Ga0068859_100981083 3300005617 Bacteria 927
87 Ga0068864_100111076 3300005618 Bacteria 2442
88 Ga0068864_101151116 3300005618 Bacteria 773
89 Ga0068864_101766157 3300005618 Bacteria 624
90 Ga0068866_10372702 3300005718 Bacteria 913
91 Ga0068861_100001264 3300005719 Bacteria 15777
92 Ga0068851_10061577 3300005834 Bacteria 1924
93 Ga0068851_10120076 3300005834 Bacteria 1412
94 Ga0068870_10070481 3300005840 Bacteria 1905
95 Ga0068870_10162733 3300005840 Bacteria 1325
96 Ga0068870_10300238 3300005840 Bacteria 1013
97 Ga0068863_100087835 3300005841 Bacteria 2946
98 Ga0068863_100465354 3300005841 Bacteria 1242
99 Ga0068863_100814598 3300005841 Bacteria 932
100 Ga0068858_100073593 3300005842 Bacteria 3171
101 Ga0068858_100242458 3300005842 Bacteria 1711
102 Ga0068858_100832491 3300005842 Bacteria 901
103 Ga0068860_100080262 3300005843 Bacteria 3102
104 Ga0068860_100755437 3300005843 Bacteria 984
105 Ga0068862_100016198 3300005844 Bacteria 6201
106 Ga0068862_100161883 3300005844 Bacteria 1998
107 Ga0068862_101240380 3300005844 Unclassified 745
108 Ga0070717_10163458 3300006028 Bacteria 1932
109 Ga0097621_100448541 3300006237 Bacteria 1162
110 Ga0097621_100669004 3300006237 Bacteria 954
111 Ga0097621_101119521 3300006237 Bacteria 740
112 Ga0068871_100141373 3300006358 Bacteria 2047
113 Ga0068871_100203021 3300006358 Bacteria 1712
114 Ga0068871_100371151 3300006358 Unclassified 1269
115 Ga0068871_101322923 3300006358 Unclassified 678
116 Ga0075430_100055787 3300006846 Bacteria 3322
117 Ga0075430_100538328 3300006846 Unclassified 963
118 Ga0075431_100014387 3300006847 Bacteria 8002
119 Ga0075431_100352382 3300006847 Bacteria 1480
120 Ga0075431_102191196 3300006847 Unclassified 507
121 Ga0075433_10727925 3300006852 Bacteria 868
122 Ga0075434_100190793 3300006871 Bacteria 2070
123 Ga0068865_100114070 3300006881 Unclassified 1998
124 Ga0068865_100194661 3300006881 Bacteria 1570
125 Ga0097620_100403527 3300006931 Bacteria 1463
126 Ga0097620_100721350 3300006931 Bacteria 1087
127 Ga0097620_100981142 3300006931 Bacteria 927
128 Ga0105240_10002486 3300009093 Bacteria 29613
129 Ga0111539_10109041 3300009094 Bacteria 3249
130 Ga0105245_10148021 3300009098 Bacteria 2217
131 Ga0105245_11450832 3300009098 Bacteria 737
132 Ga0105245_13264234 3300009098 Unclassified 502
133 Ga0105247_10071510 3300009101 Bacteria 2170
134 Ga0105247_11120532 3300009101 Bacteria 622
135 Ga0114129_10113879 3300009147 Bacteria 3729
136 Ga0114129_12114497 3300009147 Bacteria 679
137 Ga0105243_10265253 3300009148 Unclassified 1539
138 Ga0105243_10981725 3300009148 Bacteria 846
139 Ga0105243_12662174 3300009148 Bacteria 540
140 Ga0105241_10025384 3300009174 Bacteria 4403
141 Ga0105242_10056900 3300009176 Bacteria 3201
142 Ga0105248_10526606 3300009177 Bacteria 1333
143 Ga0105248_10589261 3300009177 Bacteria 1255
144 Ga0105248_11371918 3300009177 Unclassified 800
145 Ga0105248_11672021 3300009177 Unclassified 722
146 Ga0105237_10581003 3300009545 Unclassified 1127
147 Ga0105238_10069762 3300009551 Bacteria 3515
148 Ga0105238_10406236 3300009551 Bacteria 1356
149 Ga0105238_10859978 3300009551 Bacteria 924
150 Ga0105238_10868515 3300009551 Unclassified 920
151 Ga0105249_10036047 3300009553 Unclassified 4487
152 Ga0105239_10012114 3300010375 Bacteria 9615
153 Ga0105239_10015155 3300010375 Bacteria 8542
154 Ga0105246_10122426 3300011119 Bacteria 1930
155 Ga0157373_10173674 3300013100 Bacteria 1516
156 Ga0157371_10012827 3300013102 Bacteria 6387
157 Ga0157370_10002582 3300013104 Bacteria 21756
158 Ga0157369_10006098 3300013105 Bacteria 13994
159 Ga0157374_10065435 3300013296 Bacteria 3414
160 Ga0157378_12968020 3300013297 Unclassified 526
161 Ga0163162_10091662 3300013306 Unclassified 3122
162 Ga0163162_13291321 3300013306 Unclassified 517
163 Ga0157372_10014730 3300013307 Bacteria 8368
164 Ga0157372_12648359 3300013307 Bacteria 575
165 Ga0157375_10006004 3300013308 Bacteria 10587
166 Ga0163163_11669560 3300014325 Bacteria 698
167 Ga0163163_13009928 3300014325 Unclassified 526
168 Ga0157380_10015720 3300014326 Bacteria 5564
169 Ga0157380_10269954 3300014326 Bacteria 1550
170 Ga0157380_10509744 3300014326 Bacteria 1171
171 Ga0157380_12900576 3300014326 Unclassified 546
172 Ga0157377_10010038 3300014745 Unclassified 4672
173 Ga0157379_10013971 3300014968 Bacteria 7036
174 Ga0157376_11023787 3300014969 Unclassified 849
175 Ga0157376_11089775 3300014969 Unclassified 824
176 Ga0157376_12271264 3300014969 Bacteria 582
177 Ga0163161_10012531 3300017792 Bacteria 5887
178 Ga0207697_10002268 3300025315 Bacteria 10055
179 Ga0207653_10270257 3300025885 Bacteria 655
180 Ga0207682_10216038 3300025893 Bacteria 886
181 Ga0207642_10008785 3300025899 Bacteria 3487
182 Ga0207642_11015543 3300025899 Bacteria 534
183 Ga0207710_10083997 3300025900 Bacteria 1481
184 Ga0207710_10357862 3300025900 Bacteria 744
185 Ga0207688_10251439 3300025901 Unclassified 1071
186 Ga0207680_10107335 3300025903 Bacteria 1804
187 Ga0207647_10247186 3300025904 Bacteria 1024
188 Ga0207645_10006775 3300025907 Bacteria 8181
189 Ga0207643_10077457 3300025908 Bacteria 1922
190 Ga0207643_10220232 3300025908 Bacteria 1161
191 Ga0207643_10545819 3300025908 Bacteria 743
192 Ga0207654_10284029 3300025911 Unclassified 1120
193 Ga0207695_10021768 3300025913 Bacteria 7303
194 Ga0207671_11384422 3300025914 Unclassified 546
195 Ga0207693_10143567 3300025915 Unclassified 1877
196 Ga0207693_10710981 3300025915 Unclassified 778
197 Ga0207663_10176026 3300025916 Bacteria 1524
198 Ga0207662_10001923 3300025918 Bacteria 10243
199 Ga0207657_10053886 3300025919 Plasmid 3482
200 Ga0207649_10182106 3300025920 Bacteria 1471
201 Ga0207681_10131511 3300025923 Bacteria 1851
202 Ga0207681_10449227 3300025923 Bacteria 1048
203 Ga0207681_10631598 3300025923 Unclassified 887
204 Ga0207681_11537991 3300025923 Unclassified 557
205 Ga0207694_10426039 3300025924 Bacteria 1106
206 Ga0207694_11408074 3300025924 Unclassified 589
207 Ga0207650_10023901 3300025925 Bacteria 4339
208 Ga0207650_10024242 3300025925 Unclassified 4311
209 Ga0207650_11892684 3300025925 Bacteria 504
210 Ga0207659_10002126 3300025926 Bacteria 11741
211 Ga0207659_10332205 3300025926 Bacteria 1257
212 Ga0207659_10357176 3300025926 Unclassified 1213
213 Ga0207659_10923607 3300025926 Bacteria 750
214 Ga0207687_11628903 3300025927 Unclassified 554
215 Ga0207644_10037394 3300025931 Bacteria 3415
216 Ga0207644_11261221 3300025931 Bacteria 621
217 Ga0207690_10537087 3300025932 Bacteria 949
218 Ga0207706_10000748 3300025933 Bacteria 33862
219 Ga0207686_10028490 3300025934 Bacteria 3284
220 Ga0207686_10193668 3300025934 Bacteria 1451
221 Ga0207686_10961410 3300025934 Unclassified 692
222 Ga0207709_10076430 3300025935 Bacteria 2143
223 Ga0207709_10423319 3300025935 Bacteria 1023
224 Ga0207670_10160633 3300025936 Bacteria 1677
225 Ga0207670_10517303 3300025936 Bacteria 971
226 Ga0207670_10935170 3300025936 Unclassified 727
227 Ga0207669_10044105 3300025937 Bacteria 2617
228 Ga0207669_10244194 3300025937 Bacteria 1333
229 Ga0207669_11683130 3300025937 Unclassified 542
230 Ga0207704_10327194 3300025938 Bacteria 1185
231 Ga0207704_10959907 3300025938 Unclassified 721
232 Ga0207691_10003256 3300025940 Bacteria 15811
233 Ga0207691_11369471 3300025940 Unclassified 582
234 Ga0207711_10276320 3300025941 Bacteria 1546
235 Ga0207711_11486885 3300025941 Unclassified 620
236 Ga0207689_10008595 3300025942 Bacteria 8892
237 Ga0207689_10158372 3300025942 Unclassified 1866
238 Ga0207661_10012250 3300025944 Bacteria 6229
239 Ga0207661_10452643 3300025944 Bacteria 1169
240 Ga0207679_10002393 3300025945 Bacteria 11547
241 Ga0207679_11739835 3300025945 Unclassified 570
242 Ga0207667_10341886 3300025949 Bacteria 1527
243 Ga0207667_11792009 3300025949 Unclassified 578
244 Ga0207651_10102650 3300025960 Bacteria 2126
245 Ga0207651_10418167 3300025960 Unclassified 1144
246 Ga0207651_10481256 3300025960 Bacteria 1070
247 Ga0207651_10657798 3300025960 Bacteria 920
248 Ga0207712_10002773 3300025961 Bacteria 11202
249 Ga0207668_10138073 3300025972 Bacteria 1870
250 Ga0207640_10314369 3300025981 Bacteria 1244
251 Ga0207658_10907910 3300025986 Bacteria 802
252 Ga0207677_10470698 3300026023 Bacteria 1081
253 Ga0207703_10434905 3300026035 Bacteria 1223
254 Ga0207639_10192536 3300026041 Bacteria 1743
255 Ga0207639_10221512 3300026041 Bacteria 1634
256 Ga0207678_10062251 3300026067 Plasmid 3208
257 Ga0207708_10005360 3300026075 Bacteria 9450
258 Ga0207708_10352311 3300026075 Bacteria 1208
259 Ga0207702_10049540 3300026078 Bacteria 3545
260 Ga0207702_10236293 3300026078 Unclassified 1710
261 Ga0207641_11215765 3300026088 Bacteria 753
262 Ga0207641_11838438 3300026088 Unclassified 607
263 Ga0207648_10017145 3300026089 Bacteria 6600
264 Ga0207648_10436237 3300026089 Unclassified 1191
265 Ga0207648_11409836 3300026089 Bacteria 655
266 Ga0207676_10056184 3300026095 Bacteria 3094
267 Ga0207676_10611758 3300026095 Bacteria 1048
268 Ga0207674_10003628 3300026116 Bacteria 18823
269 Ga0207675_100000638 3300026118 Bacteria 34400
270 Ga0207683_10062089 3300026121 Bacteria 3290
271 Ga0207683_10799571 3300026121 Bacteria 875
272 Ga0207698_10157859 3300026142 Bacteria 1979
273 Ga0207698_10223332 3300026142 Bacteria 1704
274 Ga0207698_11290080 3300026142 Unclassified 745
275 Ga0207428_10129494 3300027907 Bacteria 1932
276 Ga0207428_10929058 3300027907 Unclassified 614
277 Ga0268266_10218451 3300028379 Bacteria 1751
278 Ga0268266_10823157 3300028379 Bacteria 897
279 Ga0268265_10023648 3300028380 Bacteria 4334
280 Ga0268264_10107323 3300028381 Bacteria 2439
281 Ga0268264_10958870 3300028381 Bacteria 861
282 Ga0265318_10137911 3300028577 Unclassified 896
283 Ga0307408_102505575 3300031548 Unclassified 502
284 Ga0307405_11011019 3300031731 Bacteria 710
285 Ga0307407_10891433 3300031903 Unclassified 682
286 Ga0307411_11991960 3300032005 Unclassified 542
287 Ga0373934_0133699 3300035086 Unclassified 1012
288 Ga0373953_0290498 3300035117 Bacteria 713
289 Ga0373956_0003950 3300035119 Bacteria 5955
290 Ga0373960_0157058 3300035121 Bacteria 780
291 Ga0373943_0155400 3300035170 Bacteria 1242
292 Ga0373955_0184178 3300035172 Unclassified 1240
293 Ga0373955_0299460 3300035172 Bacteria 969
294 Ga0373931_0200770 3300035691 Bacteria 1191
295 Ga0373933_0000937 3300035724 Bacteria 17809
296 Ga0373937_0000025 3300036401 Bacteria 125685
297 Ga0373937_0114907 3300036401 Unclassified 2506
298 Ga0373937_1470010 3300036401 Unclassified 629
299 Ga0373925_0063350 3300037068 Bacteria 2782
300 Ga0395905_0121589 3300037471 Bacteria 2454
301 Ga0395905_1298995 3300037471 Unclassified 631
302 Ga0453683_0541692 3300044673 Bacteria 757
303 Ga0453684_0054121 3300044712 Bacteria 5231
304 Ga0451576_0067528 3300045051 Bacteria 3722
305 Ga0495592_0062272 3300046454 Plasmid 2740
306 Ga0495629_0087087 3300046459 Bacteria 2179
307 Ga0495653_0002806 3300046463 Bacteria 13908
308 Ga0495653_0077432 3300046463 Bacteria 2469
309 Ga0495582_0359644 3300046473 Unclassified 838
310 Ga0495608_0004033 3300046511 Bacteria 10542
311 Ga0495608_0086139 3300046511 Bacteria 2036
312 Ga0495618_0013371 3300046514 Unclassified 4994
313 Ga0495628_0000283 3300046516 Bacteria 45481
314 Ga0495630_1512765 3300046517 Unclassified 503
315 Ga0495652_0000557 3300046529 Bacteria 43557
316 Ga0495652_0293071 3300046529 Bacteria 1186
317 Ga0495640_0091196 3300046533 Bacteria 2011
318 Ga0495586_0211800 3300046535 Bacteria 1100
319 Ga0495586_0253022 3300046535 Bacteria 1005
320 Ga0495587_0000445 3300046536 Bacteria 28914
321 Ga0495587_0001122 3300046536 Bacteria 17516
322 Ga0495587_0377520 3300046536 Unclassified 789
323 Ga0495621_0097713 3300046539 Bacteria 1114
324 Ga0495621_0336146 3300046539 Bacteria 631
325 Ga0495621_0499661 3300046539 Bacteria 525
326 Ga0495645_0008146 3300046543 Bacteria 7309
327 Ga0495667_0000684 3300046559 Bacteria 21707
328 Ga0495667_0414611 3300046559 Bacteria 848
329 Ga0495635_0051431 3300046663 Unclassified 2839
330 Ga0495635_0740222 3300046663 Bacteria 636
331 Ga0495659_0116988 3300046664 Unclassified 1046
332 Ga0495599_0004091 3300046678 Bacteria 8598
333 Ga0495599_0204880 3300046678 Bacteria 1211
334 Ga0495599_0323027 3300046678 Unclassified 929
335 Ga0495623_0084257 3300046679 Bacteria 1962
336 Ga0495646_0390289 3300046680 Unclassified 725
337 Ga0495647_0139953 3300046681 Bacteria 1031
338 Ga0495647_0464437 3300046681 Bacteria 587
339 Ga0495658_0086713 3300046683 Bacteria 1848
340 Ga0495658_0087425 3300046683 Bacteria 1841
341 Ga0495600_0007848 3300046809 Bacteria 6536
342 Ga0495600_0783218 3300046809 Bacteria 569
343 Ga0495600_0880492 3300046809 Unclassified 529
344 Ga0495581_0628014 3300047315 Unclassified 621
345 Ga0495604_0002494 3300047317 Bacteria 14699
346 Ga0495680_0003805 3300047322 Bacteria 14650
347 Ga0495680_0255848 3300047322 Unclassified 1240
348 Ga0495675_0000494 3300047444 Bacteria 25626
349 Ga0495675_0004788 3300047444 Bacteria 8225
350 Ga0495684_0001505 3300047471 Bacteria 18649
351 Ga0495602_0000089 3300048088 Bacteria 89567
352 Ga0495602_0005361 3300048088 Bacteria 13460
353 Ga0496102_1898970 3300048905 Unclassified 512
354 Ga0496106_0557705 3300048909 Bacteria 919
355 Ga0496107_1160849 3300048910 Unclassified 556
356 Ga0496114_0120262 3300048917 Bacteria 2258
357 Ga0496121_0005083 3300048924 Bacteria 17156
358 Ga0501067_0353671 3300049583 Unclassified 819
359 Ga0501068_0789378 3300049584 Bacteria 623
360 Ga0501243_092628 3300049675 Unclassified 601
361 Ga0501225_0101480 3300049705 Unclassified 841
362 nmdc:mga05p37_81977_c1 3300050507 Bacteria 3974
363 nmdc:mga09592_874938_c1 3300050508 Bacteria 756
364 nmdc:mga0qj67_6183_c1 3300050509 Bacteria 8783
365 nmdc:mga06r32_25328_c1 3300050510 Bacteria 5519
366 nmdc:mga06r32_349422_c1 3300050510 Bacteria 1463
367 nmdc:mga06r32_5771_c1 3300050510 Bacteria 11154
368 nmdc:mga08y16_25253_c1 3300050511 Bacteria 6265
369 nmdc:mga08y16_430766_c1 3300050511 Unclassified 1347
370 nmdc:mga0n895_115440_c1 3300050512 Bacteria 2703
371 nmdc:mga0rr50_313038_c1 3300050513 Bacteria 1315
372 nmdc:mga0a205_377784_c1 3300050515 Unclassified 1282
373 nmdc:mga0a205_448824_c1 3300050515 Bacteria 1150
374 Ga0495601_0504066 3300053077 Bacteria 781
375 Ga0495619_0332021 3300053085 Unclassified 1052
376 Ga0495619_1054805 3300053085 Unclassified 542
377 Ga0500595_038586 3300053119 Bacteria 1552
378 Ga0075433_10393382
379 Ga0065715_10135975
380 Ga0065707_10491933
381 Ga0070676_10006221
382 Ga0070683_100073505
383 Ga0070670_100379226
384 Ga0070677_10140220
385 Ga0068869_100024589
386 Ga0068868_100089947
387 Ga0068868_100363529
388 Ga0068868_101275532
389 Ga0070660_100125819
390 Ga0070689_100053511
391 Ga0070689_100173391
392 Ga0070687_100247026
393 Ga0070687_100512344
394 Ga0070661_100016249
395 Ga0070692_10006797
396 Ga0070668_100001837
397 Ga0070669_100009736
398 Ga0070669_100101829
399 Ga0070669_100214797
400 Ga0070669_100780737
401 Ga0070675_100000997
402 Ga0070675_100004603
403 Ga0070675_100533275
404 Ga0070675_100893450
405 Ga0070671_100485185
406 Ga0070674_100115621
407 Ga0070673_100041248
408 Ga0070673_100067953
409 Ga0070673_100262224
410 Ga0070673_100526264
411 Ga0070688_100245339
412 Ga0070659_100128622
413 Ga0070667_100011514
414 Ga0070667_100899745
415 Ga0070667_102139306
416 Ga0070701_10003298
417 Ga0070701_10875939
418 Ga0070705_100811027
419 Ga0070700_100004441
420 Ga0070700_101007166
421 Ga0070694_100031966
422 Ga0070708_100861737
423 Ga0070663_100085165
424 Ga0070662_100020629
425 Ga0068867_100451817
426 Ga0070685_10003180
427 Ga0070685_10085739
428 Ga0070685_10366466
429 Ga0070706_100602671
430 Ga0070706_100806142
431 Ga0070707_102196109
432 Ga0070698_100183587
433 Ga0070698_100406013
434 Ga0070698_100750097
435 Ga0070684_100026560
436 Ga0070684_100077533
437 Ga0070684_100106171
438 Ga0070684_101151940
439 Ga0070697_100812743
440 Ga0068853_100165950
441 Ga0068853_100239347
442 Ga0070672_100247582
443 Ga0070672_101863021
444 Ga0070686_100310446
445 Ga0070696_100036142
446 Ga0070665_100315537
447 Ga0070665_101059127
448 Ga0070665_101973954
449 Ga0070704_100095003
450 Ga0068855_100081759
451 Ga0068855_101352967
452 Ga0068857_100018300
453 Ga0068857_101492181
454 Ga0068854_100108547
455 Ga0068856_100068015
456 Ga0068856_100231822
457 Ga0070702_101260426
458 Ga0068852_100036117
459 Ga0068852_100086779
460 Ga0068852_101651544
461 Ga0068852_101942974
462 Ga0068859_100403507
463 Ga0068859_100981083
464 Ga0068864_100111076
465 Ga0068864_101151116
466 Ga0068864_101766157
467 Ga0068866_10372702
468 Ga0068861_100001264
469 Ga0068851_10061577
470 Ga0068851_10120076
471 Ga0068870_10070481
472 Ga0068870_10162733
473 Ga0068870_10300238
474 Ga0068863_100087835
475 Ga0068863_100465354
476 Ga0068863_100814598
477 Ga0068858_100073593
478 Ga0068858_100242458
479 Ga0068858_100832491
480 Ga0068860_100080262
481 Ga0068860_100755437
482 Ga0068862_100016198
483 Ga0068862_100161883
484 Ga0068862_101240380
485 Ga0070717_10163458
486 Ga0097621_100448541
487 Ga0097621_100669004
488 Ga0097621_101119521
489 Ga0068871_100141373
490 Ga0068871_100203021
491 Ga0068871_100371151
492 Ga0068871_101322923
493 Ga0075430_100055787
494 Ga0075430_100538328
495 Ga0075431_100014387
496 Ga0075431_100352382
497 Ga0075431_102191196
498 Ga0075433_10727925
499 Ga0075434_100190793
500 Ga0068865_100114070
501 Ga0068865_100194661
502 Ga0097620_100403527
503 Ga0097620_100721350
504 Ga0097620_100981142
505 Ga0105240_10002486
506 Ga0111539_10109041
507 Ga0105245_10148021
508 Ga0105245_11450832
509 Ga0105245_13264234
510 Ga0105247_10071510
511 Ga0105247_11120532
512 Ga0114129_10113879
513 Ga0114129_12114497
514 Ga0105243_10265253
515 Ga0105243_10981725
516 Ga0105243_12662174
517 Ga0105241_10025384
518 Ga0105242_10056900
519 Ga0105248_10526606
520 Ga0105248_10589261
521 Ga0105248_11371918
522 Ga0105248_11672021
523 Ga0105237_10581003
524 Ga0105238_10069762
525 Ga0105238_10406236
526 Ga0105238_10859978
527 Ga0105238_10868515
528 Ga0105249_10036047
529 Ga0105239_10012114
530 Ga0105239_10015155
531 Ga0105246_10122426
532 Ga0157373_10173674
533 Ga0157371_10012827
534 Ga0157370_10002582
535 Ga0157369_10006098
536 Ga0157374_10065435
537 Ga0157378_12968020
538 Ga0163162_10091662
539 Ga0163162_13291321
540 Ga0157372_10014730
541 Ga0157372_12648359
542 Ga0157375_10006004
543 Ga0163163_11669560
544 Ga0163163_13009928
545 Ga0157380_10015720
546 Ga0157380_10269954
547 Ga0157380_10509744
548 Ga0157380_12900576
549 Ga0157377_10010038
550 Ga0157379_10013971
551 Ga0157376_11023787
552 Ga0157376_11089775
553 Ga0157376_12271264
554 Ga0163161_10012531
555 Ga0207697_10002268
556 Ga0207653_10270257
557 Ga0207682_10216038
558 Ga0207642_10008785
559 Ga0207642_11015543
560 Ga0207710_10083997
561 Ga0207710_10357862
562 Ga0207688_10251439
563 Ga0207680_10107335
564 Ga0207647_10247186
565 Ga0207645_10006775
566 Ga0207643_10077457
567 Ga0207643_10220232
568 Ga0207643_10545819
569 Ga0207654_10284029
570 Ga0207695_10021768
571 Ga0207671_11384422
572 Ga0207693_10143567
573 Ga0207693_10710981
574 Ga0207663_10176026
575 Ga0207662_10001923
576 Ga0207657_10053886
577 Ga0207649_10182106
578 Ga0207681_10131511
579 Ga0207681_10449227
580 Ga0207681_10631598
581 Ga0207681_11537991
582 Ga0207694_10426039
583 Ga0207694_11408074
584 Ga0207650_10023901
585 Ga0207650_10024242
586 Ga0207650_11892684
587 Ga0207659_10002126
588 Ga0207659_10332205
589 Ga0207659_10357176
590 Ga0207659_10923607
591 Ga0207687_11628903
592 Ga0207644_10037394
593 Ga0207644_11261221
594 Ga0207690_10537087
595 Ga0207706_10000748
596 Ga0207686_10028490
597 Ga0207686_10193668
598 Ga0207686_10961410
599 Ga0207709_10076430
600 Ga0207709_10423319
601 Ga0207670_10160633
602 Ga0207670_10517303
603 Ga0207670_10935170
604 Ga0207669_10044105
605 Ga0207669_10244194
606 Ga0207669_11683130
607 Ga0207704_10327194
608 Ga0207704_10959907
609 Ga0207691_10003256
610 Ga0207691_11369471
611 Ga0207711_10276320
612 Ga0207711_11486885
613 Ga0207689_10008595
614 Ga0207689_10158372
615 Ga0207661_10012250
616 Ga0207661_10452643
617 Ga0207679_10002393
618 Ga0207679_11739835
619 Ga0207667_10341886
620 Ga0207667_11792009
621 Ga0207651_10102650
622 Ga0207651_10418167
623 Ga0207651_10481256
624 Ga0207651_10657798
625 Ga0207712_10002773
626 Ga0207668_10138073
627 Ga0207640_10314369
628 Ga0207658_10907910
629 Ga0207677_10470698
630 Ga0207703_10434905
631 Ga0207639_10192536
632 Ga0207639_10221512
633 Ga0207678_10062251
634 Ga0207708_10005360
635 Ga0207708_10352311
636 Ga0207702_10049540
637 Ga0207702_10236293
638 Ga0207641_11215765
639 Ga0207641_11838438
640 Ga0207648_10017145
641 Ga0207648_10436237
642 Ga0207648_11409836
643 Ga0207676_10056184
644 Ga0207676_10611758
645 Ga0207674_10003628
646 Ga0207675_100000638
647 Ga0207683_10062089
648 Ga0207683_10799571
649 Ga0207698_10157859
650 Ga0207698_10223332
651 Ga0207698_11290080
652 Ga0207428_10129494
653 Ga0207428_10929058
654 Ga0268266_10218451
655 Ga0268266_10823157
656 Ga0268265_10023648
657 Ga0268264_10107323
658 Ga0268264_10958870
659 Ga0265318_10137911
660 Ga0307408_102505575
661 Ga0307405_11011019
662 Ga0307407_10891433
663 Ga0307411_11991960
664 Ga0373934_0133699
665 Ga0373953_0290498
666 Ga0373956_0003950
667 Ga0373960_0157058
668 Ga0373943_0155400
669 Ga0373955_0184178
670 Ga0373955_0299460
671 Ga0373931_0200770
672 Ga0373933_0000937
673 Ga0373937_0000025
674 Ga0373937_0114907
675 Ga0373937_1470010
676 Ga0373925_0063350
677 Ga0395905_0121589
678 Ga0395905_1298995
679 Ga0453683_0541692
680 Ga0453684_0054121
681 Ga0451576_0067528
682 Ga0495592_0062272
683 Ga0495629_0087087
684 Ga0495653_0002806
685 Ga0495653_0077432
686 Ga0495582_0359644
687 Ga0495608_0004033
688 Ga0495608_0086139
689 Ga0495618_0013371
690 Ga0495628_0000283
691 Ga0495630_1512765
692 Ga0495652_0000557
693 Ga0495652_0293071
694 Ga0495640_0091196
695 Ga0495586_0211800
696 Ga0495586_0253022
697 Ga0495587_0000445
698 Ga0495587_0001122
699 Ga0495587_0377520
700 Ga0495621_0097713
701 Ga0495621_0336146
702 Ga0495621_0499661
703 Ga0495645_0008146
704 Ga0495667_0000684
705 Ga0495667_0414611
706 Ga0495635_0051431
707 Ga0495635_0740222
708 Ga0495659_0116988
709 Ga0495599_0004091
710 Ga0495599_0204880
711 Ga0495599_0323027
712 Ga0495623_0084257
713 Ga0495646_0390289
714 Ga0495647_0139953
715 Ga0495647_0464437
716 Ga0495658_0086713
717 Ga0495658_0087425
718 Ga0495600_0007848
719 Ga0495600_0783218
720 Ga0495600_0880492
721 Ga0495581_0628014
722 Ga0495604_0002494
723 Ga0495680_0003805
724 Ga0495680_0255848
725 Ga0495675_0000494
726 Ga0495675_0004788
727 Ga0495684_0001505
728 Ga0495602_0000089
729 Ga0495602_0005361
730 Ga0496102_1898970
731 Ga0496106_0557705
732 Ga0496107_1160849
733 Ga0496114_0120262
734 Ga0496121_0005083
735 Ga0501067_0353671
736 Ga0501068_0789378
737 Ga0501243_092628
738 Ga0501225_0101480
739 nmdc:mga05p37_81977_c1
740 nmdc:mga09592_874938_c1
741 nmdc:mga0qj67_6183_c1
742 nmdc:mga06r32_25328_c1
743 nmdc:mga06r32_349422_c1
744 nmdc:mga06r32_5771_c1
745 nmdc:mga08y16_25253_c1
746 nmdc:mga08y16_430766_c1
747 nmdc:mga0n895_115440_c1
748 nmdc:mga0rr50_313038_c1
749 nmdc:mga0a205_377784_c1
750 nmdc:mga0a205_448824_c1
751 Ga0495601_0504066
752 Ga0495619_0332021
753 Ga0495619_1054805
754 Ga0500595_038586

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v03-assembly1.cif.gz_B a positive allosteric modulator binding pocket in sk2 ion channels is shared by riluzole and cyppa 0.8472 2 60
1g4y-assembly1.cif.gz_B-2 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin 0.846 2 60
4j9y-assembly1.cif.gz_B calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant 0.8443 2 60
5wbx-assembly1.cif.gz_B structural insights into the potency of sk/ik channel positive modulators 0.8427 2 59
6czq-assembly1.cif.gz_B a v-to-f substitution in sk2 channels causes ca2+ hypersensitivity and improves locomotion in a c. elegans als model 0.8416 2 59
ID Description Score Start End Superfamily
af_A0A1D6K2L3_127_221_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9097 6 60 1.20.1280.290
4g27B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8472 2 60 1.10.287.70
4g28B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8472 2 60 1.10.287.70
5v02B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8467 2 60 1.10.287.70
1g4yB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.846 2 60 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A537JYK4-F1-model_v4 Uncharacterized protein 0.9976 1 58 GO:0016020
AF-A0A3L7X038-F1-model_v4 DUF5668 domain-containing protein 0.9972 1 59 GO:0016020
AF-A0A1I5G188-F1-model_v4 Integral membrane protein 0.9947 2 57 GO:0016020
AF-A0A536EYC8-F1-model_v4 Integral membrane protein 0.9926 1 59 GO:0016020
AF-A0A7W1E4B7-F1-model_v4 Uncharacterized protein 0.9885 4 61 GO:0016020

Map