F427584

General Info

Members Datasets Scaffolds Average Seq Length
377 216 754 128

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101077972|Ga0070683_1010779721
Length 130
Sequence MPRITNASVFVDDQAKALAFYTDVLGFLPKTDVPVGEFRWLTVVSPDVPDGVELLLEPDEHPAAKPFKEALVADGIPLTSFGVDDVDAVHEDLVAKGVTIVQPPTDMGPVRTLILDDTCGNLIQLAAMKE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
155 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
156 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
159 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
160 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
165 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
166 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
214 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 5.04
Rhizosphere 90.19
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101077972 3300005329 Bacteria 772
2 Ga0065712_10333792 3300005290 Bacteria 810
3 Ga0065715_10238979 3300005293 Bacteria 1192
4 Ga0065707_10130841 3300005295 Bacteria 1923
5 Ga0070658_10335031 3300005327 Bacteria 1293
6 Ga0070676_10572939 3300005328 Bacteria 811
7 Ga0070683_100390312 3300005329 Bacteria 1327
8 Ga0070690_101524948 3300005330 Bacteria 540
9 Ga0070670_100556480 3300005331 Bacteria 1024
10 Ga0070670_100754186 3300005331 Bacteria 877
11 Ga0070670_101062873 3300005331 Bacteria 737
12 Ga0070670_102131591 3300005331 Bacteria 517
13 Ga0068869_100884238 3300005334 Bacteria 772
14 Ga0068869_101193286 3300005334 Unclassified 669
15 Ga0070666_10092510 3300005335 Bacteria 2079
16 Ga0070666_10119985 3300005335 Bacteria 1823
17 Ga0070666_10957752 3300005335 Unclassified 634
18 Ga0068868_101281589 3300005338 Bacteria 680
19 Ga0070660_100350987 3300005339 Bacteria 1215
20 Ga0070689_100522020 3300005340 Bacteria 1020
21 Ga0070668_100039948 3300005347 Bacteria 3589
22 Ga0070668_100114994 3300005347 Bacteria 2144
23 Ga0070668_100420514 3300005347 Bacteria 1144
24 Ga0070669_100342105 3300005353 Bacteria 1212
25 Ga0070669_100774894 3300005353 Unclassified 814
26 Ga0070675_100037576 3300005354 Bacteria 3945
27 Ga0070675_100077980 3300005354 Bacteria 2758
28 Ga0070675_100886396 3300005354 Bacteria 817
29 Ga0070675_101358475 3300005354 Bacteria 655
30 Ga0070671_100343668 3300005355 Bacteria 1273
31 Ga0070674_100204874 3300005356 Unclassified 1525
32 Ga0070673_100077701 3300005364 Bacteria 2683
33 Ga0070673_100398087 3300005364 Bacteria 1231
34 Ga0070673_100831778 3300005364 Bacteria 854
35 Ga0070688_100824297 3300005365 Bacteria 727
36 Ga0070667_100113365 3300005367 Bacteria 2353
37 Ga0070667_101112137 3300005367 Bacteria 739
38 Ga0070714_100296744 3300005435 Bacteria 1505
39 Ga0070701_10318415 3300005438 Bacteria 962
40 Ga0070701_11074871 3300005438 Unclassified 565
41 Ga0070705_100326275 3300005440 Bacteria 1110
42 Ga0070700_101396606 3300005441 Bacteria 592
43 Ga0070663_100373283 3300005455 Bacteria 1160
44 Ga0070663_101558068 3300005455 Unclassified 588
45 Ga0070678_100022740 3300005456 Bacteria 4161
46 Ga0070678_100340110 3300005456 Bacteria 1287
47 Ga0070678_100940619 3300005456 Bacteria 792
48 Ga0070662_100760612 3300005457 Bacteria 822
49 Ga0070662_101537550 3300005457 Bacteria 574
50 Ga0070681_10037225 3300005458 Bacteria 4884
51 Ga0068867_100089437 3300005459 Bacteria 2335
52 Ga0068867_100553072 3300005459 Bacteria 997
53 Ga0068867_100647844 3300005459 Bacteria 926
54 Ga0068867_101160960 3300005459 Bacteria 707
55 Ga0070685_10032289 3300005466 Bacteria 2932
56 Ga0070706_101160436 3300005467 Unclassified 710
57 Ga0070684_100110949 3300005535 Bacteria 2459
58 Ga0070684_100500297 3300005535 Bacteria 1126
59 Ga0070684_100870480 3300005535 Bacteria 844
60 Ga0068853_100113498 3300005539 Bacteria 2409
61 Ga0068853_100124499 3300005539 Bacteria 2302
62 Ga0068853_100861718 3300005539 Unclassified 869
63 Ga0068853_101902793 3300005539 Bacteria 577
64 Ga0070672_100092915 3300005543 Bacteria 2436
65 Ga0070672_100107195 3300005543 Bacteria 2274
66 Ga0070672_100198522 3300005543 Bacteria 1677
67 Ga0070672_101615265 3300005543 Bacteria 582
68 Ga0070695_100158199 3300005545 Bacteria 1588
69 Ga0070695_101566415 3300005545 Archaea 549
70 Ga0070696_100030908 3300005546 Bacteria 3668
71 Ga0070696_101854095 3300005546 Bacteria 522
72 Ga0070693_100015736 3300005547 Bacteria 3900
73 Ga0070665_100020161 3300005548 Bacteria 6693
74 Ga0070665_101288232 3300005548 Bacteria 741
75 Ga0070665_101916249 3300005548 Bacteria 598
76 Ga0070704_100112489 3300005549 Bacteria 2075
77 Ga0068855_100000798 3300005563 Bacteria 38977
78 Ga0068855_101027084 3300005563 Bacteria 865
79 Ga0070664_100092113 3300005564 Bacteria 2624
80 Ga0068857_100898897 3300005577 Bacteria 849
81 Ga0068857_101722299 3300005577 Bacteria 613
82 Ga0068856_100000874 3300005614 Bacteria 32282
83 Ga0068856_100624761 3300005614 Bacteria 1098
84 Ga0068856_102294375 3300005614 Bacteria 548
85 Ga0068852_100075735 3300005616 Bacteria 2969
86 Ga0068859_100107462 3300005617 Bacteria 2850
87 Ga0068859_100107916 3300005617 Bacteria 2845
88 Ga0068859_100759344 3300005617 Bacteria 1058
89 Ga0068859_100946087 3300005617 Bacteria 945
90 Ga0068864_100004966 3300005618 Bacteria 10906
91 Ga0068866_10070412 3300005718 Bacteria 1846
92 Ga0068866_11463097 3300005718 Bacteria 501
93 Ga0068861_100305802 3300005719 Bacteria 1379
94 Ga0068851_10593402 3300005834 Unclassified 673
95 Ga0068870_10051275 3300005840 Bacteria 2184
96 Ga0068863_100001977 3300005841 Bacteria 20384
97 Ga0068863_100576312 3300005841 Bacteria 1112
98 Ga0068858_100011776 3300005842 Bacteria 8252
99 Ga0068858_100100170 3300005842 Bacteria 2702
100 Ga0068858_100449130 3300005842 Bacteria 1242
101 Ga0068860_100194840 3300005843 Bacteria 1962
102 Ga0068860_100283481 3300005843 Bacteria 1620
103 Ga0068862_100241055 3300005844 Bacteria 1644
104 Ga0068862_100587942 3300005844 Bacteria 1067
105 Ga0068862_100590560 3300005844 Unclassified 1065
106 Ga0097621_100000675 3300006237 Bacteria 23911
107 Ga0097621_100029681 3300006237 Bacteria 4321
108 Ga0097621_100609899 3300006237 Bacteria 998
109 Ga0068871_100079324 3300006358 Bacteria 2716
110 Ga0068871_101025092 3300006358 Bacteria 769
111 Ga0075428_100704682 3300006844 Bacteria 1075
112 Ga0075430_100293209 3300006846 Unclassified 1346
113 Ga0075431_100047071 3300006847 Bacteria 4446
114 Ga0068865_100006098 3300006881 Bacteria 7352
115 Ga0068865_100090594 3300006881 Bacteria 2218
116 Ga0068865_100393677 3300006881 Bacteria 1133
117 Ga0068865_100875172 3300006881 Bacteria 780
118 Ga0075436_100012908 3300006914 Bacteria 5729
119 Ga0097620_100107471 3300006931 Bacteria 2850
120 Ga0097620_100107917 3300006931 Bacteria 2845
121 Ga0097620_100759279 3300006931 Bacteria 1058
122 Ga0097620_100945892 3300006931 Bacteria 945
123 Ga0105240_10160420 3300009093 Bacteria 2671
124 Ga0111539_11066668 3300009094 Bacteria 939
125 Ga0105245_10149126 3300009098 Bacteria 2210
126 Ga0105245_10202910 3300009098 Bacteria 1905
127 Ga0105245_10558407 3300009098 Bacteria 1167
128 Ga0105245_10912172 3300009098 Bacteria 920
129 Ga0105245_11953889 3300009098 Bacteria 640
130 Ga0105247_10704556 3300009101 Bacteria 760
131 Ga0114129_12915311 3300009147 Unclassified 565
132 Ga0105243_10012834 3300009148 Bacteria 6331
133 Ga0105241_10072449 3300009174 Bacteria 2677
134 Ga0105241_10469728 3300009174 Bacteria 1116
135 Ga0105242_10020962 3300009176 Bacteria 5126
136 Ga0105242_10212232 3300009176 Bacteria 1726
137 Ga0105242_10377585 3300009176 Bacteria 1317
138 Ga0105242_10477418 3300009176 Bacteria 1181
139 Ga0105242_11356227 3300009176 Unclassified 737
140 Ga0105242_11406907 3300009176 Bacteria 725
141 Ga0105242_11793798 3300009176 Bacteria 652
142 Ga0105248_10001960 3300009177 Bacteria 22889
143 Ga0105248_10363849 3300009177 Bacteria 1628
144 Ga0105248_10536742 3300009177 Bacteria 1319
145 Ga0105248_10720197 3300009177 Bacteria 1126
146 Ga0105238_10005598 3300009551 Bacteria 12411
147 Ga0105238_10210768 3300009551 Bacteria 1919
148 Ga0105238_10652676 3300009551 Bacteria 1062
149 Ga0105249_10534197 3300009553 Bacteria 1222
150 Ga0105249_10764374 3300009553 Unclassified 1029
151 Ga0105249_11929763 3300009553 Bacteria 663
152 Ga0105239_10001394 3300010375 Bacteria 32377
153 Ga0105239_10095560 3300010375 Bacteria 3283
154 Ga0105239_12128040 3300010375 Bacteria 652
155 Ga0105246_10087158 3300011119 Bacteria 2240
156 Ga0105246_10383299 3300011119 Bacteria 1162
157 Ga0105246_10492491 3300011119 Bacteria 1039
158 Ga0157373_10514178 3300013100 Bacteria 866
159 Ga0157371_10068293 3300013102 Bacteria 2515
160 Ga0157371_10361185 3300013102 Bacteria 1058
161 Ga0157371_10519782 3300013102 Bacteria 880
162 Ga0157369_10696674 3300013105 Bacteria 1046
163 Ga0157369_11442049 3300013105 Bacteria 701
164 Ga0157374_10000368 3300013296 Bacteria 41541
165 Ga0157374_10139105 3300013296 Bacteria 2356
166 Ga0157374_11450264 3300013296 Bacteria 709
167 Ga0157374_11451376 3300013296 Bacteria 709
168 Ga0157378_10002403 3300013297 Bacteria 16641
169 Ga0157378_10054629 3300013297 Bacteria 3556
170 Ga0157378_12555003 3300013297 Bacteria 563
171 Ga0163162_10389581 3300013306 Bacteria 1526
172 Ga0163162_10776969 3300013306 Bacteria 1076
173 Ga0157372_10001958 3300013307 Bacteria 22380
174 Ga0157372_10360953 3300013307 Bacteria 1693
175 Ga0157372_10813152 3300013307 Bacteria 1085
176 Ga0157372_12053249 3300013307 Unclassified 657
177 Ga0157375_10186169 3300013308 Bacteria 2230
178 Ga0157375_10407246 3300013308 Bacteria 1526
179 Ga0163163_10127206 3300014325 Bacteria 2586
180 Ga0163163_10252413 3300014325 Bacteria 1814
181 Ga0157380_10015779 3300014326 Bacteria 5557
182 Ga0157380_11247373 3300014326 Bacteria 789
183 Ga0157377_10285056 3300014745 Bacteria 1084
184 Ga0157377_10289171 3300014745 Bacteria 1077
185 Ga0157376_10001162 3300014969 Bacteria 17291
186 Ga0157376_10100823 3300014969 Bacteria 2522
187 Ga0157376_11017550 3300014969 Bacteria 852
188 Ga0207656_10260086 3300025321 Unclassified 852
189 Ga0207642_10081802 3300025899 Bacteria 1571
190 Ga0207688_10164114 3300025901 Bacteria 1318
191 Ga0207688_10597867 3300025901 Bacteria 695
192 Ga0207680_10201225 3300025903 Bacteria 1357
193 Ga0207645_10011133 3300025907 Bacteria 6155
194 Ga0207643_10040351 3300025908 Bacteria 2628
195 Ga0207643_10110525 3300025908 Bacteria 1619
196 Ga0207705_11056884 3300025909 Bacteria 626
197 Ga0207654_10075839 3300025911 Bacteria 2010
198 Ga0207695_10031775 3300025913 Bacteria 5785
199 Ga0207695_10086887 3300025913 Bacteria 3152
200 Ga0207660_10344217 3300025917 Bacteria 1194
201 Ga0207662_10887896 3300025918 Bacteria 631
202 Ga0207649_11575433 3300025920 Bacteria 520
203 Ga0207652_10301934 3300025921 Bacteria 1445
204 Ga0207681_10332135 3300025923 Unclassified 1212
205 Ga0207681_10441976 3300025923 Bacteria 1057
206 Ga0207681_10470268 3300025923 Bacteria 1025
207 Ga0207694_10300685 3300025924 Bacteria 1321
208 Ga0207694_10465748 3300025924 Bacteria 1056
209 Ga0207659_10472563 3300025926 Bacteria 1058
210 Ga0207687_10519862 3300025927 Bacteria 995
211 Ga0207687_10608274 3300025927 Bacteria 922
212 Ga0207664_10069926 3300025929 Bacteria 2823
213 Ga0207644_10907344 3300025931 Bacteria 739
214 Ga0207690_10224595 3300025932 Bacteria 1439
215 Ga0207686_10100543 3300025934 Bacteria 1930
216 Ga0207686_10134487 3300025934 Bacteria 1700
217 Ga0207686_10489117 3300025934 Bacteria 953
218 Ga0207686_10992599 3300025934 Bacteria 681
219 Ga0207709_11341367 3300025935 Bacteria 592
220 Ga0207670_10490041 3300025936 Bacteria 997
221 Ga0207669_10077263 3300025937 Bacteria 2117
222 Ga0207669_10359228 3300025937 Bacteria 1128
223 Ga0207704_10024720 3300025938 Bacteria 3264
224 Ga0207704_10122265 3300025938 Bacteria 1784
225 Ga0207704_10185193 3300025938 Bacteria 1509
226 Ga0207704_10502564 3300025938 Bacteria 977
227 Ga0207704_11272322 3300025938 Bacteria 628
228 Ga0207665_11252559 3300025939 Unclassified 592
229 Ga0207691_10066851 3300025940 Bacteria 3251
230 Ga0207691_10121870 3300025940 Bacteria 2310
231 Ga0207691_10134229 3300025940 Bacteria 2185
232 Ga0207691_10474866 3300025940 Bacteria 1063
233 Ga0207691_10982657 3300025940 Bacteria 705
234 Ga0207711_10017737 3300025941 Bacteria 5915
235 Ga0207711_10431884 3300025941 Bacteria 1225
236 Ga0207689_10000971 3300025942 Bacteria 27524
237 Ga0207689_10145525 3300025942 Bacteria 1952
238 Ga0207689_10216195 3300025942 Bacteria 1584
239 Ga0207661_10118781 3300025944 Bacteria 2248
240 Ga0207661_10224680 3300025944 Bacteria 1661
241 Ga0207661_10320732 3300025944 Bacteria 1393
242 Ga0207661_11877532 3300025944 Bacteria 545
243 Ga0207667_10007983 3300025949 Bacteria 12626
244 Ga0207651_10081518 3300025960 Bacteria 2332
245 Ga0207651_10706945 3300025960 Bacteria 888
246 Ga0207712_10866980 3300025961 Bacteria 796
247 Ga0207712_10984810 3300025961 Unclassified 748
248 Ga0207668_10084720 3300025972 Bacteria 2310
249 Ga0207668_10916143 3300025972 Bacteria 781
250 Ga0207658_10060373 3300025986 Bacteria 2829
251 Ga0207677_10078592 3300026023 Bacteria 2357
252 Ga0207677_10092044 3300026023 Bacteria 2207
253 Ga0207703_10070136 3300026035 Unclassified 2892
254 Ga0207703_10088406 3300026035 Bacteria 2600
255 Ga0207639_10055287 3300026041 Bacteria 3037
256 Ga0207639_10651841 3300026041 Bacteria 974
257 Ga0207639_10750267 3300026041 Bacteria 907
258 Ga0207708_10511940 3300026075 Unclassified 1007
259 Ga0207708_10878298 3300026075 Bacteria 775
260 Ga0207702_10036385 3300026078 Bacteria 4118
261 Ga0207702_10927441 3300026078 Bacteria 863
262 Ga0207702_11681124 3300026078 Bacteria 628
263 Ga0207641_10010259 3300026088 Bacteria 7705
264 Ga0207641_10245574 3300026088 Bacteria 1670
265 Ga0207648_10163784 3300026089 Bacteria 1964
266 Ga0207648_10686764 3300026089 Bacteria 948
267 Ga0207648_11089140 3300026089 Unclassified 749
268 Ga0207676_10003575 3300026095 Bacteria 10981
269 Ga0207674_10897330 3300026116 Bacteria 854
270 Ga0207675_100126796 3300026118 Bacteria 2418
271 Ga0207675_100216922 3300026118 Bacteria 1842
272 Ga0207683_10034433 3300026121 Bacteria 4402
273 Ga0207683_10262270 3300026121 Bacteria 1578
274 Ga0207683_10386442 3300026121 Bacteria 1287
275 Ga0209974_10033040 3300027876 Bacteria 1716
276 Ga0268266_10222416 3300028379 Bacteria 1736
277 Ga0268266_10224173 3300028379 Bacteria 1729
278 Ga0268266_12335973 3300028379 Bacteria 506
279 Ga0268265_10174500 3300028380 Unclassified 1841
280 Ga0268265_10660317 3300028380 Bacteria 1006
281 Ga0268265_10948253 3300028380 Bacteria 847
282 Ga0268264_10447035 3300028381 Bacteria 1251
283 Ga0268264_12287063 3300028381 Bacteria 548
284 Ga0307517_10413165 3300028786 Bacteria 710
285 Ga0307515_10000232 3300028794 Bacteria 137778
286 Ga0307512_10095698 3300030522 Bacteria 2041
287 Ga0307512_10288640 3300030522 Bacteria 776
288 Ga0307509_10190129 3300031507 Bacteria 1905
289 Ga0307509_10231925 3300031507 Bacteria 1648
290 Ga0307408_100709272 3300031548 Bacteria 905
291 Ga0307514_10000348 3300031649 Bacteria 107998
292 Ga0307516_10001957 3300031730 Bacteria 28200
293 Ga0307518_10252965 3300031838 Unclassified 1118
294 Ga0307410_11863435 3300031852 Bacteria 535
295 Ga0307407_11048909 3300031903 Bacteria 632
296 Ga0307507_10043893 3300033179 Bacteria 4429
297 Ga0373939_0298296 3300035114 Bacteria 642
298 Ga0373931_0046285 3300035691 Bacteria 2299
299 Ga0436360_0041365 3300039438 Bacteria 21117
300 Ga0436362_1163541 3300039453 Unclassified 1745
301 Ga0451787_363961 3300041441 Bacteria 575
302 Ga0451795_0150787 3300041456 Bacteria 1129
303 Ga0451800_1200203 3300041459 Bacteria 1217
304 Ga0451807_1585164 3300041486 Bacteria 736
305 Ga0451837_1010451 3300041494 Bacteria 551
306 Ga0451839_0059812 3300041496 Bacteria 687
307 Ga0451847_0883295 3300041503 Bacteria 544
308 Ga0451843_0878331 3300041509 Bacteria 515
309 Ga0451853_1219384 3300041512 Bacteria 822
310 Ga0451853_2352019 3300041512 Bacteria 906
311 Ga0439431_0004073 3300041997 Bacteria 3215
312 Ga0450889_003945 3300042144 Bacteria 1465
313 Ga0450906_062364 3300042145 Bacteria 664
314 Ga0450909_079862 3300042185 Bacteria 529
315 Ga0439434_0008152 3300042435 Bacteria 3071
316 Ga0439434_0063025 3300042435 Bacteria 1161
317 Ga0450918_049686 3300042531 Bacteria 762
318 Ga0466969_0248051 3300044656 Bacteria 807
319 Ga0453683_0098304 3300044673 Bacteria 1837
320 Ga0466966_0031693 3300044684 Bacteria 3428
321 Ga0466961_0565624 3300044693 Bacteria 684
322 Ga0453684_0211470 3300044712 Bacteria 2254
323 Ga0453684_0473648 3300044712 Unclassified 1390
324 Ga0453684_0840333 3300044712 Unclassified 987
325 Ga0466959_0005273 3300045049 Bacteria 8831
326 Ga0451576_0000129 3300045051 Bacteria 191840
327 Ga0451576_0876001 3300045051 Bacteria 942
328 Ga0495603_0701604 3300046455 Bacteria 579
329 Ga0495638_0000001 3300046460 Bacteria 1114121
330 Ga0495653_0057189 3300046463 Bacteria 2970
331 Ga0495640_0376562 3300046533 Bacteria 874
332 Ga0495667_0946074 3300046559 Bacteria 527
333 Ga0495624_0549597 3300046690 Bacteria 690
334 Ga0495674_0415859 3300047319 Bacteria 1084
335 Ga0495684_0254991 3300047471 Bacteria 1275
336 Ga0496103_0373621 3300048906 Bacteria 916
337 Ga0496104_0180010 3300048907 Bacteria 2024
338 Ga0496105_0270827 3300048908 Bacteria 1371
339 Ga0496105_1239414 3300048908 Bacteria 547
340 Ga0496108_0092499 3300048911 Bacteria 2572
341 Ga0496108_0309708 3300048911 Bacteria 1376
342 Ga0496108_0548014 3300048911 Bacteria 1009
343 Ga0496108_0637116 3300048911 Unclassified 927
344 Ga0496108_1688258 3300048911 Bacteria 522
345 Ga0496112_0881315 3300048915 Bacteria 818
346 Ga0496112_1623774 3300048915 Bacteria 560
347 Ga0496113_0484235 3300048916 Unclassified 994
348 Ga0496113_1046643 3300048916 Bacteria 642
349 Ga0496114_0063224 3300048917 Bacteria 3099
350 Ga0496114_0554412 3300048917 Bacteria 1015
351 Ga0501039_0162395 3300049575 Bacteria 1756
352 Ga0501040_0073899 3300049576 Bacteria 2356
353 Ga0501046_0907676 3300049580 Bacteria 614
354 Ga0501068_0493753 3300049584 Bacteria 794
355 Ga0501069_0103947 3300049585 Bacteria 1614
356 Ga0501069_0397931 3300049585 Bacteria 815
357 Ga0501071_0141691 3300049587 Bacteria 1790
358 Ga0501072_0025287 3300049588 Bacteria 4625
359 Ga0501074_0465566 3300049590 Bacteria 896
360 Ga0501075_0018883 3300049591 Bacteria 4997
361 Ga0501076_0194506 3300049592 Bacteria 1655
362 Ga0501079_0027647 3300049741 Bacteria 4351
363 Ga0501080_0394617 3300049742 Bacteria 1245
364 Ga0501081_0052021 3300049743 Bacteria 2825
365 Ga0501083_0088943 3300049744 Bacteria 2041
366 Ga0501045_0993590 3300049824 Bacteria 615
367 nmdc:mga0qj67_458145_c1 3300050509 Unclassified 1027
368 nmdc:mga06r32_50725_c1 3300050510 Bacteria 3969
369 nmdc:mga08y16_1017220_c1 3300050511 Bacteria 808
370 nmdc:mga0n895_1165410_c1 3300050512 Bacteria 746
371 nmdc:mga08x19_32288_c1 3300050514 Bacteria 3298
372 Ga0495612_0487892 3300053078 Bacteria 565
373 Ga0495595_0179205 3300053084 Bacteria 1050
374 Ga0500561_0202835 3300053137 Bacteria 627
375 Ga0500570_092895 3300053724 Bacteria 1305
376 Ga0501082_0002927 3300060353 Bacteria 14900
377 Ga0530510_0177924 3300061734 Bacteria 1577
378 Ga0070683_101077972
379 Ga0065712_10333792
380 Ga0065715_10238979
381 Ga0065707_10130841
382 Ga0070658_10335031
383 Ga0070676_10572939
384 Ga0070683_100390312
385 Ga0070690_101524948
386 Ga0070670_100556480
387 Ga0070670_100754186
388 Ga0070670_101062873
389 Ga0070670_102131591
390 Ga0068869_100884238
391 Ga0068869_101193286
392 Ga0070666_10092510
393 Ga0070666_10119985
394 Ga0070666_10957752
395 Ga0068868_101281589
396 Ga0070660_100350987
397 Ga0070689_100522020
398 Ga0070668_100039948
399 Ga0070668_100114994
400 Ga0070668_100420514
401 Ga0070669_100342105
402 Ga0070669_100774894
403 Ga0070675_100037576
404 Ga0070675_100077980
405 Ga0070675_100886396
406 Ga0070675_101358475
407 Ga0070671_100343668
408 Ga0070674_100204874
409 Ga0070673_100077701
410 Ga0070673_100398087
411 Ga0070673_100831778
412 Ga0070688_100824297
413 Ga0070667_100113365
414 Ga0070667_101112137
415 Ga0070714_100296744
416 Ga0070701_10318415
417 Ga0070701_11074871
418 Ga0070705_100326275
419 Ga0070700_101396606
420 Ga0070663_100373283
421 Ga0070663_101558068
422 Ga0070678_100022740
423 Ga0070678_100340110
424 Ga0070678_100940619
425 Ga0070662_100760612
426 Ga0070662_101537550
427 Ga0070681_10037225
428 Ga0068867_100089437
429 Ga0068867_100553072
430 Ga0068867_100647844
431 Ga0068867_101160960
432 Ga0070685_10032289
433 Ga0070706_101160436
434 Ga0070684_100110949
435 Ga0070684_100500297
436 Ga0070684_100870480
437 Ga0068853_100113498
438 Ga0068853_100124499
439 Ga0068853_100861718
440 Ga0068853_101902793
441 Ga0070672_100092915
442 Ga0070672_100107195
443 Ga0070672_100198522
444 Ga0070672_101615265
445 Ga0070695_100158199
446 Ga0070695_101566415
447 Ga0070696_100030908
448 Ga0070696_101854095
449 Ga0070693_100015736
450 Ga0070665_100020161
451 Ga0070665_101288232
452 Ga0070665_101916249
453 Ga0070704_100112489
454 Ga0068855_100000798
455 Ga0068855_101027084
456 Ga0070664_100092113
457 Ga0068857_100898897
458 Ga0068857_101722299
459 Ga0068856_100000874
460 Ga0068856_100624761
461 Ga0068856_102294375
462 Ga0068852_100075735
463 Ga0068859_100107462
464 Ga0068859_100107916
465 Ga0068859_100759344
466 Ga0068859_100946087
467 Ga0068864_100004966
468 Ga0068866_10070412
469 Ga0068866_11463097
470 Ga0068861_100305802
471 Ga0068851_10593402
472 Ga0068870_10051275
473 Ga0068863_100001977
474 Ga0068863_100576312
475 Ga0068858_100011776
476 Ga0068858_100100170
477 Ga0068858_100449130
478 Ga0068860_100194840
479 Ga0068860_100283481
480 Ga0068862_100241055
481 Ga0068862_100587942
482 Ga0068862_100590560
483 Ga0097621_100000675
484 Ga0097621_100029681
485 Ga0097621_100609899
486 Ga0068871_100079324
487 Ga0068871_101025092
488 Ga0075428_100704682
489 Ga0075430_100293209
490 Ga0075431_100047071
491 Ga0068865_100006098
492 Ga0068865_100090594
493 Ga0068865_100393677
494 Ga0068865_100875172
495 Ga0075436_100012908
496 Ga0097620_100107471
497 Ga0097620_100107917
498 Ga0097620_100759279
499 Ga0097620_100945892
500 Ga0105240_10160420
501 Ga0111539_11066668
502 Ga0105245_10149126
503 Ga0105245_10202910
504 Ga0105245_10558407
505 Ga0105245_10912172
506 Ga0105245_11953889
507 Ga0105247_10704556
508 Ga0114129_12915311
509 Ga0105243_10012834
510 Ga0105241_10072449
511 Ga0105241_10469728
512 Ga0105242_10020962
513 Ga0105242_10212232
514 Ga0105242_10377585
515 Ga0105242_10477418
516 Ga0105242_11356227
517 Ga0105242_11406907
518 Ga0105242_11793798
519 Ga0105248_10001960
520 Ga0105248_10363849
521 Ga0105248_10536742
522 Ga0105248_10720197
523 Ga0105238_10005598
524 Ga0105238_10210768
525 Ga0105238_10652676
526 Ga0105249_10534197
527 Ga0105249_10764374
528 Ga0105249_11929763
529 Ga0105239_10001394
530 Ga0105239_10095560
531 Ga0105239_12128040
532 Ga0105246_10087158
533 Ga0105246_10383299
534 Ga0105246_10492491
535 Ga0157373_10514178
536 Ga0157371_10068293
537 Ga0157371_10361185
538 Ga0157371_10519782
539 Ga0157369_10696674
540 Ga0157369_11442049
541 Ga0157374_10000368
542 Ga0157374_10139105
543 Ga0157374_11450264
544 Ga0157374_11451376
545 Ga0157378_10002403
546 Ga0157378_10054629
547 Ga0157378_12555003
548 Ga0163162_10389581
549 Ga0163162_10776969
550 Ga0157372_10001958
551 Ga0157372_10360953
552 Ga0157372_10813152
553 Ga0157372_12053249
554 Ga0157375_10186169
555 Ga0157375_10407246
556 Ga0163163_10127206
557 Ga0163163_10252413
558 Ga0157380_10015779
559 Ga0157380_11247373
560 Ga0157377_10285056
561 Ga0157377_10289171
562 Ga0157376_10001162
563 Ga0157376_10100823
564 Ga0157376_11017550
565 Ga0207656_10260086
566 Ga0207642_10081802
567 Ga0207688_10164114
568 Ga0207688_10597867
569 Ga0207680_10201225
570 Ga0207645_10011133
571 Ga0207643_10040351
572 Ga0207643_10110525
573 Ga0207705_11056884
574 Ga0207654_10075839
575 Ga0207695_10031775
576 Ga0207695_10086887
577 Ga0207660_10344217
578 Ga0207662_10887896
579 Ga0207649_11575433
580 Ga0207652_10301934
581 Ga0207681_10332135
582 Ga0207681_10441976
583 Ga0207681_10470268
584 Ga0207694_10300685
585 Ga0207694_10465748
586 Ga0207659_10472563
587 Ga0207687_10519862
588 Ga0207687_10608274
589 Ga0207664_10069926
590 Ga0207644_10907344
591 Ga0207690_10224595
592 Ga0207686_10100543
593 Ga0207686_10134487
594 Ga0207686_10489117
595 Ga0207686_10992599
596 Ga0207709_11341367
597 Ga0207670_10490041
598 Ga0207669_10077263
599 Ga0207669_10359228
600 Ga0207704_10024720
601 Ga0207704_10122265
602 Ga0207704_10185193
603 Ga0207704_10502564
604 Ga0207704_11272322
605 Ga0207665_11252559
606 Ga0207691_10066851
607 Ga0207691_10121870
608 Ga0207691_10134229
609 Ga0207691_10474866
610 Ga0207691_10982657
611 Ga0207711_10017737
612 Ga0207711_10431884
613 Ga0207689_10000971
614 Ga0207689_10145525
615 Ga0207689_10216195
616 Ga0207661_10118781
617 Ga0207661_10224680
618 Ga0207661_10320732
619 Ga0207661_11877532
620 Ga0207667_10007983
621 Ga0207651_10081518
622 Ga0207651_10706945
623 Ga0207712_10866980
624 Ga0207712_10984810
625 Ga0207668_10084720
626 Ga0207668_10916143
627 Ga0207658_10060373
628 Ga0207677_10078592
629 Ga0207677_10092044
630 Ga0207703_10070136
631 Ga0207703_10088406
632 Ga0207639_10055287
633 Ga0207639_10651841
634 Ga0207639_10750267
635 Ga0207708_10511940
636 Ga0207708_10878298
637 Ga0207702_10036385
638 Ga0207702_10927441
639 Ga0207702_11681124
640 Ga0207641_10010259
641 Ga0207641_10245574
642 Ga0207648_10163784
643 Ga0207648_10686764
644 Ga0207648_11089140
645 Ga0207676_10003575
646 Ga0207674_10897330
647 Ga0207675_100126796
648 Ga0207675_100216922
649 Ga0207683_10034433
650 Ga0207683_10262270
651 Ga0207683_10386442
652 Ga0209974_10033040
653 Ga0268266_10222416
654 Ga0268266_10224173
655 Ga0268266_12335973
656 Ga0268265_10174500
657 Ga0268265_10660317
658 Ga0268265_10948253
659 Ga0268264_10447035
660 Ga0268264_12287063
661 Ga0307517_10413165
662 Ga0307515_10000232
663 Ga0307512_10095698
664 Ga0307512_10288640
665 Ga0307509_10190129
666 Ga0307509_10231925
667 Ga0307408_100709272
668 Ga0307514_10000348
669 Ga0307516_10001957
670 Ga0307518_10252965
671 Ga0307410_11863435
672 Ga0307407_11048909
673 Ga0307507_10043893
674 Ga0373939_0298296
675 Ga0373931_0046285
676 Ga0436360_0041365
677 Ga0436362_1163541
678 Ga0451787_363961
679 Ga0451795_0150787
680 Ga0451800_1200203
681 Ga0451807_1585164
682 Ga0451837_1010451
683 Ga0451839_0059812
684 Ga0451847_0883295
685 Ga0451843_0878331
686 Ga0451853_1219384
687 Ga0451853_2352019
688 Ga0439431_0004073
689 Ga0450889_003945
690 Ga0450906_062364
691 Ga0450909_079862
692 Ga0439434_0008152
693 Ga0439434_0063025
694 Ga0450918_049686
695 Ga0466969_0248051
696 Ga0453683_0098304
697 Ga0466966_0031693
698 Ga0466961_0565624
699 Ga0453684_0211470
700 Ga0453684_0473648
701 Ga0453684_0840333
702 Ga0466959_0005273
703 Ga0451576_0000129
704 Ga0451576_0876001
705 Ga0495603_0701604
706 Ga0495638_0000001
707 Ga0495653_0057189
708 Ga0495640_0376562
709 Ga0495667_0946074
710 Ga0495624_0549597
711 Ga0495674_0415859
712 Ga0495684_0254991
713 Ga0496103_0373621
714 Ga0496104_0180010
715 Ga0496105_0270827
716 Ga0496105_1239414
717 Ga0496108_0092499
718 Ga0496108_0309708
719 Ga0496108_0548014
720 Ga0496108_0637116
721 Ga0496108_1688258
722 Ga0496112_0881315
723 Ga0496112_1623774
724 Ga0496113_0484235
725 Ga0496113_1046643
726 Ga0496114_0063224
727 Ga0496114_0554412
728 Ga0501039_0162395
729 Ga0501040_0073899
730 Ga0501046_0907676
731 Ga0501068_0493753
732 Ga0501069_0103947
733 Ga0501069_0397931
734 Ga0501071_0141691
735 Ga0501072_0025287
736 Ga0501074_0465566
737 Ga0501075_0018883
738 Ga0501076_0194506
739 Ga0501079_0027647
740 Ga0501080_0394617
741 Ga0501081_0052021
742 Ga0501083_0088943
743 Ga0501045_0993590
744 nmdc:mga0qj67_458145_c1
745 nmdc:mga06r32_50725_c1
746 nmdc:mga08y16_1017220_c1
747 nmdc:mga0n895_1165410_c1
748 nmdc:mga08x19_32288_c1
749 Ga0495612_0487892
750 Ga0495595_0179205
751 Ga0500561_0202835
752 Ga0500570_092895
753 Ga0501082_0002927
754 Ga0530510_0177924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

125

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9698 1 126
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8665 1 125
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8619 1 129
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8558 1 129
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.851 1 127
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.971 2 126 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9409 2 126 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9085 79 124 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.872 78 125 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.87 78 127 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1G0EVI4-F1-model_v4 Glyoxalase 0.9953 1 127
AF-A0A838XB21-F1-model_v4 deleted 0.9887 1 126
AF-A0A6N8ZYY6-F1-model_v4 VOC family protein 0.9862 1 127
AF-A0A3D4B117-F1-model_v4 VOC domain-containing protein 0.9843 1 129 GO:0016020
AF-A0A2N8KKE3-F1-model_v4 Glyoxalase 0.9811 1 129

Map