F427531

General Info

Members Datasets Scaffolds Average Seq Length
376 270 752 275

Family's Representative Sequence

Representative Sequence 3300059505|Ga0587083_0025499|Ga0587083_0025499_125_1030
Length 301
Sequence MILSRTAALRRADTTRLPYPCATMKEPAVSADPTQTLAFDTSCHLFDGCGFPAPGLHSFMFKPLWGDADSNLYFNKTMLLALLGSIIVLGFFWAAFAKPKVVPGKLQMVAEAGYDFIRRGVVYETIGKKEGEKYVPFVVSLFFFIWMMNLWSIIPVAAFPVTSIISYPAVLAGLVYLIWVPLTFKRHGFVGAFKNFTGYDKTLGGVLPLSMTIEFFSNLLVRPFTHAVRLFANMFAGHTLLLLFTIASWYMLNGIGIAYSGVSFVMVIVMTAFELFIQAVQAYVFVLLTCSYIQGALAEHH

Samples

Sample ID Description Type Environment
1 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
19 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
20 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
25 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
31 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
32 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
43 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
44 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
45 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
46 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
49 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
50 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
51 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
52 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
53 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
54 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
55 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
56 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
57 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
124 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
178 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
181 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
182 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
183 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
184 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
185 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
186 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
187 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
188 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
191 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
192 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
193 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
194 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
200 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
201 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
202 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
203 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
204 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
205 2643221548 Streptomyces sp. Root55 Isolate Unclassified
206 2643221578 Streptomyces sp. Root63 Isolate Unclassified
207 2643221647 Streptomyces sp. Root369 Isolate Unclassified
208 2643221670 Streptomyces sp. Root431 Isolate Unclassified
209 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
210 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
211 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
212 2643221714 Streptomyces sp. Root264 Isolate Unclassified
213 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
214 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
215 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
216 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
217 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
218 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
219 2808606448 Streptomyces sp. 193411 Isolate Unclassified
220 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
221 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
222 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
223 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
224 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
225 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
226 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
227 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
228 2862574272 Streptomyces sp. AcE210 Isolate Nodule
229 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
230 2867369537 Streptomyces sp. Z26 Isolate Unclassified
231 2867428634 Streptomyces sp. RP5T Isolate Unclassified
232 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
233 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
234 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
235 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
236 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
237 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
238 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
239 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
240 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
241 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
242 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
243 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
244 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
245 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
246 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
247 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
248 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
249 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
250 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
251 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
252 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
253 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
254 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
255 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
256 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
257 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
258 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
259 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
260 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
261 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
262 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
263 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
264 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
265 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
266 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
267 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
268 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
269 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
270 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.41
Metatranscriptomes 11.44
Isolates 19.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 0.8
Rhizoplane 0.8
Rhizosphere 75.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587083_0025499 3300059505 Bacteria 1134
2 Ga0006759J45824_1012639 3300003163 Bacteria 2151
3 JGI25153J46596_10021698 3300003215 Bacteria 2387
4 Ga0006758J48902_1009036 3300003300 Bacteria 2300
5 Ga0006777J48905_1018869 3300003308 Bacteria 2352
6 rootH2_10098961 3300003320 Bacteria 3235
7 rootL2_10072879 3300003322 Bacteria 5730
8 Ga0032354_1027792 3300003693 Bacteria 2222
9 Ga0075365_10128183 3300006038 Bacteria 1755
10 Ga0075363_100003775 3300006048 Bacteria 6526
11 Ga0075367_10000321 3300006178 Bacteria 16931
12 Ga0105244_10062925 3300009036 Bacteria 1864
13 Ga0105250_10040187 3300009092 Bacteria 1876
14 Ga0105246_10004665 3300011119 Bacteria 8341
15 Ga0157369_10151837 3300013105 Bacteria 2448
16 Ga0157372_10042878 3300013307 Bacteria 5008
17 Ga0182008_10000936 3300014497 Bacteria 20326
18 Ga0182006_1010126 3300015261 Bacteria 4200
19 Ga0182007_10001027 3300015262 Bacteria 15273
20 Ga0182005_1003555 3300015265 Bacteria 5261
21 Ga0183367_1002 3300015688 Bacteria 1101531
22 Ga0197907_10710587 3300020069 Bacteria 1722
23 Ga0206352_11352203 3300020078 Bacteria 2139
24 Ga0209758_1001875 3300025297 Bacteria 23033
25 Ga0207426_1004648 3300025302 Bacteria 6602
26 Ga0207426_1010363 3300025302 Bacteria 3620
27 Ga0207426_1014208 3300025302 Bacteria 2922
28 Ga0207696_1014973 3300025711 Bacteria 2641
29 Ga0207694_10460944 3300025924 Bacteria 1062
30 Ga0307517_10003529 3300028786 Bacteria 24302
31 Ga0307517_10097460 3300028786 Bacteria 2347
32 Ga0307515_10004012 3300028794 Bacteria 30728
33 Ga0307515_10014631 3300028794 Bacteria 14524
34 Ga0268256_1015337 3300030500 Bacteria 2242
35 Ga0307511_10070211 3300030521 Bacteria 2566
36 Ga0307512_10002661 3300030522 Bacteria 22042
37 Ga0307512_10023471 3300030522 Bacteria 5510
38 Ga0307513_10034963 3300031456 Bacteria 5630
39 Ga0307509_10141174 3300031507 Bacteria 2344
40 Ga0307508_10010996 3300031616 Bacteria 8272
41 Ga0307508_10012560 3300031616 Bacteria 7746
42 Ga0307508_10030839 3300031616 Bacteria 4845
43 Ga0307514_10008300 3300031649 Bacteria 8863
44 Ga0307516_10005886 3300031730 Bacteria 14510
45 Ga0307516_10192909 3300031730 Bacteria 1762
46 Ga0307510_10017495 3300033180 Bacteria 8449
47 Ga0307510_10061650 3300033180 Bacteria 3841
48 Ga0307510_10183751 3300033180 Bacteria 1649
49 Ga0395898_0003850 3300037466 Bacteria 16607
50 Ga0395898_0008215 3300037466 Bacteria 11037
51 Ga0395898_0057064 3300037466 Bacteria 3805
52 Ga0395905_0256807 3300037471 Bacteria 1632
53 Ga0395901_0012207 3300038443 Bacteria 8719
54 Ga0439439_0015460 3300041406 Bacteria 1864
55 Ga0451802_0935414 3300041460 Bacteria 1193
56 Ga0451853_3018125 3300041512 Bacteria 3908
57 Ga0439433_0002970 3300041999 Bacteria 3631
58 Ga0439442_001517 3300042002 Bacteria 4565
59 Ga0439449_0010816 3300042007 Bacteria 3444
60 Ga0439449_0047588 3300042007 Bacteria 1588
61 Ga0439457_000419 3300042014 Bacteria 12192
62 Ga0439457_000894 3300042014 Bacteria 9002
63 Ga0439457_008671 3300042014 Bacteria 2388
64 Ga0439463_086995 3300042016 Bacteria 804
65 Ga0450894_000170 3300042131 Bacteria 11533
66 Ga0450898_003999 3300042134 Bacteria 2153
67 Ga0450903_000144 3300042138 Bacteria 15642
68 Ga0450903_018783 3300042138 Bacteria 1075
69 Ga0450906_000444 3300042145 Bacteria 8627
70 Ga0439458_0002261 3300042157 Bacteria 4740
71 Ga0439458_0014564 3300042157 Bacteria 1776
72 Ga0450908_002644 3300042184 Bacteria 3514
73 Ga0450901_003106 3300042533 Bacteria 1742
74 Ga0466965_0062842 3300044683 Bacteria 1858
75 Ga0466966_0005731 3300044684 Bacteria 8174
76 Ga0466966_0132812 3300044684 Bacteria 1523
77 Ga0466961_0023473 3300044693 Bacteria 3968
78 Ga0466963_0002878 3300044694 Bacteria 9725
79 Ga0466971_0021752 3300044719 Bacteria 2854
80 Ga0466968_0013254 3300044735 Bacteria 3240
81 Ga0466970_0157344 3300044765 Bacteria 1256
82 Ga0466960_0002784 3300044901 Bacteria 6626
83 Ga0466959_0037994 3300045049 Bacteria 3558
84 Ga0466958_0102317 3300045836 Bacteria 1782
85 Ga0466967_0004065 3300045976 Bacteria 9765
86 Ga0495617_001480 3300046452 Bacteria 10272
87 Ga0495592_0006433 3300046454 Bacteria 8746
88 Ga0495592_0071147 3300046454 Bacteria 2532
89 Ga0495603_0002077 3300046455 Bacteria 11783
90 Ga0495603_0011400 3300046455 Bacteria 5382
91 Ga0495603_0043500 3300046455 Bacteria 2681
92 Ga0495603_0132400 3300046455 Bacteria 1451
93 Ga0495590_0030688 3300046457 Bacteria 1883
94 Ga0495629_0008726 3300046459 Bacteria 7454
95 Ga0495629_0011369 3300046459 Bacteria 6465
96 Ga0495629_0079899 3300046459 Bacteria 2283
97 Ga0495651_0021463 3300046462 Bacteria 5019
98 Ga0495651_0095888 3300046462 Bacteria 2217
99 Ga0495651_0167391 3300046462 Bacteria 1568
100 Ga0495582_0102026 3300046473 Bacteria 1607
101 Ga0495582_0153949 3300046473 Bacteria 1306
102 Ga0495605_0001651 3300046474 Bacteria 14340
103 Ga0495639_0016429 3300046475 Bacteria 3213
104 Ga0495662_0020033 3300046476 Bacteria 3237
105 Ga0495662_0054577 3300046476 Bacteria 1930
106 Ga0495664_0008995 3300046477 Bacteria 5582
107 Ga0495664_0097746 3300046477 Bacteria 1767
108 Ga0495585_0068087 3300046492 Bacteria 1945
109 Ga0495594_0002248 3300046499 Bacteria 10050
110 Ga0495594_0040967 3300046499 Bacteria 2536
111 Ga0495594_0043774 3300046499 Bacteria 2454
112 Ga0495607_0098695 3300046501 Bacteria 1568
113 Ga0495583_0099698 3300046506 Bacteria 1241
114 Ga0495610_0074258 3300046512 Bacteria 1578
115 Ga0495618_0045685 3300046514 Bacteria 2763
116 Ga0495628_0100952 3300046516 Bacteria 2227
117 Ga0495631_0031815 3300046518 Bacteria 2381
118 Ga0495631_0043002 3300046518 Bacteria 1994
119 Ga0495632_0073665 3300046519 Bacteria 1637
120 Ga0495643_0108175 3300046522 Bacteria 1416
121 Ga0495643_0131871 3300046522 Bacteria 1254
122 Ga0495648_0200088 3300046524 Bacteria 1001
123 Ga0495666_0008308 3300046526 Bacteria 5202
124 Ga0495666_0063699 3300046526 Bacteria 1760
125 Ga0495652_0097301 3300046529 Bacteria 2394
126 Ga0495665_0106678 3300046531 Bacteria 1470
127 Ga0495587_0007449 3300046536 Bacteria 7086
128 Ga0495609_0007313 3300046538 Bacteria 5526
129 Ga0495597_0028182 3300046542 Bacteria 2571
130 Ga0495645_0058140 3300046543 Bacteria 2805
131 Ga0495633_0011060 3300046558 Bacteria 4896
132 Ga0495656_0106481 3300046615 Bacteria 1305
133 Ga0495634_0002467 3300046642 Bacteria 15369
134 Ga0495611_0012280 3300046648 Bacteria 3642
135 Ga0495611_0012835 3300046648 Bacteria 3560
136 Ga0495611_0051016 3300046648 Bacteria 1864
137 Ga0495611_0169108 3300046648 Bacteria 1022
138 Ga0495625_0002557 3300046660 Bacteria 19548
139 Ga0495625_0024793 3300046660 Bacteria 4556
140 Ga0495625_0103951 3300046660 Bacteria 1947
141 Ga0495625_0112296 3300046660 Bacteria 1862
142 Ga0495635_0037175 3300046663 Bacteria 3371
143 Ga0495661_0013277 3300046665 Bacteria 5537
144 Ga0495661_0043934 3300046665 Bacteria 2743
145 Ga0495588_0034533 3300046674 Bacteria 2559
146 Ga0495657_0008144 3300046675 Bacteria 8034
147 Ga0495657_0008916 3300046675 Bacteria 7639
148 Ga0495657_0246969 3300046675 Bacteria 1075
149 Ga0495646_0002033 3300046680 Bacteria 12266
150 Ga0495613_0000571 3300046689 Bacteria 30034
151 Ga0495613_0103777 3300046689 Bacteria 2052
152 Ga0495613_0123743 3300046689 Bacteria 1855
153 Ga0495613_0366890 3300046689 Bacteria 986
154 Ga0495624_0113063 3300046690 Bacteria 1669
155 Ga0495670_0017490 3300046691 Bacteria 3528
156 Ga0495671_0091250 3300046692 Bacteria 1491
157 Ga0495589_0093263 3300046794 Bacteria 1461
158 Ga0495589_0194953 3300046794 Bacteria 957
159 Ga0495600_0278042 3300046809 Bacteria 1060
160 Ga0495581_0185893 3300047315 Bacteria 1215
161 Ga0495604_0000623 3300047317 Bacteria 30451
162 Ga0495604_0279920 3300047317 Bacteria 1127
163 Ga0495636_0094931 3300047318 Bacteria 1298
164 Ga0495636_0106114 3300047318 Bacteria 1232
165 Ga0495674_0195012 3300047319 Bacteria 1682
166 Ga0495676_0015610 3300047321 Bacteria 6755
167 Ga0495676_0016010 3300047321 Bacteria 6659
168 Ga0495676_0017631 3300047321 Bacteria 6308
169 Ga0495680_0011373 3300047322 Bacteria 7879
170 Ga0495683_0030120 3300047323 Bacteria 2770
171 Ga0495687_004471 3300047443 Bacteria 9419
172 Ga0495687_006861 3300047443 Bacteria 6863
173 Ga0495687_062075 3300047443 Bacteria 1535
174 Ga0495675_0003140 3300047444 Bacteria 9915
175 Ga0495675_0135202 3300047444 Bacteria 1531
176 Ga0495685_003567 3300047447 Bacteria 4976
177 Ga0495685_015454 3300047447 Bacteria 2603
178 Ga0495685_031560 3300047447 Bacteria 1820
179 Ga0495685_052295 3300047447 Bacteria 1383
180 Ga0495673_0057171 3300047469 Bacteria 1685
181 Ga0495681_0000926 3300047470 Bacteria 22637
182 Ga0495681_0043679 3300047470 Bacteria 2159
183 Ga0495681_0116790 3300047470 Bacteria 1149
184 Ga0495684_0084176 3300047471 Bacteria 2413
185 Ga0495686_0033397 3300047472 Bacteria 3322
186 Ga0495686_0046113 3300047472 Bacteria 2757
187 Ga0495593_0025376 3300047673 Bacteria 3280
188 Ga0495593_0080617 3300047673 Bacteria 1683
189 Ga0495602_0017544 3300048088 Bacteria 7173
190 Ga0495602_0307836 3300048088 Bacteria 1157
191 Ga0495614_0000863 3300048089 Bacteria 12821
192 Ga0496106_0064428 3300048909 Bacteria 2788
193 Ga0496109_0237991 3300048912 Bacteria 1713
194 Ga0501306_000714 3300049127 Bacteria 2734
195 Ga0501306_001353 3300049127 Bacteria 2281
196 Ga0501306_003142 3300049127 Bacteria 1755
197 Ga0501306_006441 3300049127 Bacteria 1378
198 Ga0501306_020369 3300049127 Bacteria 922
199 Ga0501309_000391 3300049129 Bacteria 3410
200 Ga0501309_007437 3300049129 Bacteria 1358
201 Ga0501309_007446 3300049129 Bacteria 1358
202 Ga0501310_001371 3300049130 Bacteria 2205
203 Ga0501310_002123 3300049130 Bacteria 1863
204 Ga0501310_012077 3300049130 Bacteria 985
205 Ga0501305_001784 3300049161 Bacteria 2195
206 Ga0501307_000376 3300049162 Bacteria 2908
207 Ga0495678_022609 3300049459 Bacteria 2746
208 Ga0501311_000689 3300049527 Bacteria 2541
209 Ga0501311_001625 3300049527 Bacteria 2006
210 Ga0501312_001904 3300049528 Bacteria 2162
211 Ga0501315_000117 3300049531 Bacteria 4270
212 Ga0501316_000115 3300049532 Bacteria 4133
213 Ga0501316_000416 3300049532 Bacteria 2882
214 Ga0501317_000313 3300049533 Bacteria 3206
215 Ga0501318_000525 3300049534 Bacteria 2499
216 Ga0501318_001168 3300049534 Bacteria 1984
217 Ga0501318_013611 3300049534 Bacteria 948
218 Ga0501320_000242 3300049536 Bacteria 2871
219 Ga0501320_000497 3300049536 Bacteria 2327
220 Ga0501321_000329 3300049537 Bacteria 2879
221 Ga0501323_000511 3300049539 Bacteria 2916
222 Ga0501323_001120 3300049539 Bacteria 2273
223 Ga0501324_000177 3300049540 Bacteria 2868
224 Ga0501324_000240 3300049540 Bacteria 2670
225 Ga0501325_000230 3300049541 Bacteria 2326
226 Ga0501325_000301 3300049541 Bacteria 2164
227 Ga0501326_02038 3300049542 Bacteria 973
228 Ga0501031_0038786 3300049568 Bacteria 3108
229 Ga0501032_0061995 3300049569 Bacteria 2506
230 Ga0501033_0007740 3300049570 Bacteria 8331
231 Ga0501033_0014872 3300049570 Bacteria 5908
232 Ga0501033_0113489 3300049570 Bacteria 1970
233 Ga0501034_0005286 3300049571 Bacteria 14162
234 Ga0501034_0013378 3300049571 Bacteria 8447
235 Ga0501034_0038173 3300049571 Bacteria 4864
236 Ga0501034_0052253 3300049571 Bacteria 4117
237 Ga0501036_0010812 3300049572 Bacteria 7542
238 Ga0501036_0016950 3300049572 Bacteria 6086
239 Ga0501036_0026882 3300049572 Bacteria 4862
240 Ga0501037_0010921 3300049573 Bacteria 6674
241 Ga0501037_0083122 3300049573 Bacteria 2319
242 Ga0501038_0023189 3300049574 Bacteria 5552
243 Ga0501039_0011658 3300049575 Bacteria 6694
244 Ga0501039_0055250 3300049575 Bacteria 3074
245 Ga0501042_0035773 3300049578 Bacteria 3523
246 Ga0501043_0006250 3300049579 Bacteria 9562
247 Ga0501043_0007109 3300049579 Bacteria 8906
248 Ga0501043_0018775 3300049579 Bacteria 5426
249 Ga0501047_0014929 3300049581 Bacteria 7391
250 Ga0501048_0017025 3300049582 Bacteria 5355
251 Ga0501068_0159668 3300049584 Bacteria 1421
252 Ga0501070_0000119 3300049586 Bacteria 70355
253 Ga0501070_0009395 3300049586 Bacteria 8267
254 Ga0501070_0183952 3300049586 Bacteria 1719
255 Ga0501071_0326305 3300049587 Bacteria 1166
256 Ga0501073_0099678 3300049589 Bacteria 2017
257 Ga0501074_0001283 3300049590 Bacteria 16635
258 Ga0501257_013469 3300049686 Bacteria 1875
259 Ga0501035_0008845 3300049822 Bacteria 9369
260 Ga0501035_0016499 3300049822 Bacteria 6810
261 Ga0501035_0173311 3300049822 Bacteria 1863
262 Ga0501044_0008387 3300049823 Bacteria 11334
263 Ga0501044_0017541 3300049823 Bacteria 7680
264 Ga0501044_0040226 3300049823 Bacteria 4873
265 Ga0501044_0214926 3300049823 Bacteria 1875
266 Ga0501044_0463622 3300049823 Bacteria 1172
267 Ga0501045_0022104 3300049824 Bacteria 4551
268 nmdc:mga0yw44_235530_c1 3300050492 Bacteria 1216
269 nmdc:mga06z11_946_c1 3300050494 Bacteria 10572
270 nmdc:mga07m45_75639_c1 3300050496 Bacteria 1919
271 Ga0495655_0004760 3300053083 Bacteria 2349
272 Ga0495619_0086338 3300053085 Bacteria 2121
273 Ga0500578_0121854 3300053086 Bacteria 1639
274 Ga0500578_0140630 3300053086 Bacteria 1509
275 Ga0500566_0062996 3300053094 Bacteria 2095
276 Ga0500566_0078425 3300053094 Bacteria 1843
277 Ga0500640_078969 3300053095 Bacteria 1399
278 Ga0500641_0099243 3300053096 Bacteria 1248
279 Ga0500650_0059462 3300053098 Bacteria 1783
280 Ga0500654_054597 3300053099 Bacteria 2113
281 Ga0500654_111469 3300053099 Bacteria 1118
282 Ga0500660_034656 3300053100 Bacteria 2610
283 Ga0500560_013320 3300053107 Bacteria 2159
284 Ga0500569_021600 3300053109 Bacteria 1704
285 Ga0500652_054031 3300053131 Bacteria 1644
286 Ga0500652_163255 3300053131 Bacteria 919
287 Ga0500561_0001812 3300053137 Bacteria 3524
288 Ga0500561_0041350 3300053137 Bacteria 1218
289 Ga0500573_0007821 3300053140 Bacteria 5854
290 Ga0500573_0021280 3300053140 Bacteria 3716
291 Ga0500600_0071420 3300053149 Bacteria 1902
292 Ga0500600_0073779 3300053149 Bacteria 1864
293 Ga0500600_0100375 3300053149 Bacteria 1527
294 Ga0500616_0051258 3300053153 Bacteria 2175
295 Ga0500616_0060046 3300053153 Bacteria 1972
296 Ga0500624_005849 3300053157 Bacteria 1648
297 Ga0500633_0032273 3300053160 Bacteria 1699
298 Ga0500634_0092261 3300053161 Bacteria 1534
299 Ga0500587_004640 3300053739 Bacteria 1877
300 Ga0587090_008704 3300059510 Bacteria 1369
301 Ga0587122_000975 3300059628 Bacteria 1739
302 Ga0587067_007890 3300059640 Bacteria 1538
303 Ga0501082_0402448 3300060353 Bacteria 1195
304 Ga0466962_0017989 3300061719 Bacteria 3400
305 2547408411 2547132111 Bacteria 8013147
306 2554256242 2554235005 Bacteria 6457341
307 2585296596 2582581312 Bacteria 7308206
308 2585309037 2582581313 Bacteria 10042643
309 2616697281 2616644814 Bacteria 11555299
310 2616899928 2616644941 Bacteria 8510691
311 2643764004 2643221548 Bacteria 8053412
312 2643902278 2643221578 Bacteria 9213798
313 2644265824 2643221647 Bacteria 10741251
314 2644386879 2643221670 Bacteria 6497041
315 2644403848 2643221673 Bacteria 9196637
316 2644440036 2643221678 Bacteria 9540101
317 2644461563 2643221682 Bacteria 6743283
318 2644632639 2643221714 Bacteria 9015452
319 2784590394 2784132148 Bacteria 8627943
320 2785341220 2784746763 Bacteria 9783172
321 2785371483 2784746768 Bacteria 10036182
322 2786672642 2786546132 Bacteria 10419719
323 2804847885 2802429296 Bacteria 7227771
324 2808844014 2808606359 Bacteria 9866990
325 2809234068 2808606448 Bacteria 8656184
326 2811844428 2808606982 Bacteria 7791042
327 2812355962 2811994879 Bacteria 9313447
328 2812478771 2811994917 Bacteria 7761064
329 2852641005 2852635781 Bacteria 8251373
330 2862186394 2862178590 Bacteria 8583590
331 2862284766 2862281513 Bacteria 9621493
332 2862388102 2862382967 Bacteria 10317375
333 2862512694 2862507626 Bacteria 9425308
334 2862577526 2862574272 Bacteria 10567477
335 2863408593 2863404153 Bacteria 9672205
336 2867373852 2867369537 Bacteria 6501581
337 2867430552 2867428634 Bacteria 9590268
338 2873154072 2873151551 Bacteria 8625867
339 2875396678 2875391855 Bacteria 7600475
340 2877679120 2877676314 Bacteria 9512378
341 2912717632 2912715099 Bacteria 9460473
342 2912730185 2912723979 Bacteria 8557534
343 2912762730 2912757875 Bacteria 7940295
344 2918506488 2918501144 Bacteria 8668083
345 2919471719 2919468124 Bacteria 9133025
346 2935395060 2935390628 Bacteria 7043367
347 2946047877 2946045630 Bacteria 8527308
348 2946069825 2946064051 Bacteria 8957905
349 2947226975 2947224130 Bacteria 9938529
350 2954005454 2954002825 Bacteria 9173742
351 2954384024 2954380949 Bacteria 10050426
352 2954678934 2954673503 Bacteria 9685905
353 2954685217 2954682443 Bacteria 9862841
354 2954694823 2954691527 Bacteria 10720516
355 2954710025 2954701450 Bacteria 10834262
356 2954714335 2954711539 Bacteria 10867210
357 2954724284 2954721474 Bacteria 10456478
358 2954737555 2954731030 Bacteria 10243860
359 2954743181 2954740390 Bacteria 10229294
360 2954756389 2954749733 Bacteria 10366972
361 2954762139 2954759201 Bacteria 9358192
362 2990062925 2990059506 Bacteria 9321252
363 2997452847 2997451912 Bacteria 8492419
364 3006393574 3006393351 Bacteria 6615579
365 3006429910 3006425503 Bacteria 6491253
366 3006491301 3006486233 Bacteria 8157040
367 3006500103 3006493962 Bacteria 8825450
368 8008562768 8008558824 Bacteria 10610750
369 8008577185 8008574985 Bacteria 7815457
370 8023627173 8023623736 Bacteria 8593882
371 8025413930 8025413630 Bacteria 7014048
372 8025485665 8025478263 Bacteria 8209203
373 8025531335 8025530807 Bacteria 8495698
374 8048411943 8048406513 Bacteria 8936924
375 8056453191 8056447290 Bacteria 7680491
376 8056668094 8056667051 Bacteria 6953971
377 Ga0587083_0025499
378 Ga0006759J45824_1012639
379 JGI25153J46596_10021698
380 Ga0006758J48902_1009036
381 Ga0006777J48905_1018869
382 rootH2_10098961
383 rootL2_10072879
384 Ga0032354_1027792
385 Ga0075365_10128183
386 Ga0075363_100003775
387 Ga0075367_10000321
388 Ga0105244_10062925
389 Ga0105250_10040187
390 Ga0105246_10004665
391 Ga0157369_10151837
392 Ga0157372_10042878
393 Ga0182008_10000936
394 Ga0182006_1010126
395 Ga0182007_10001027
396 Ga0182005_1003555
397 Ga0183367_1002
398 Ga0197907_10710587
399 Ga0206352_11352203
400 Ga0209758_1001875
401 Ga0207426_1004648
402 Ga0207426_1010363
403 Ga0207426_1014208
404 Ga0207696_1014973
405 Ga0207694_10460944
406 Ga0307517_10003529
407 Ga0307517_10097460
408 Ga0307515_10004012
409 Ga0307515_10014631
410 Ga0268256_1015337
411 Ga0307511_10070211
412 Ga0307512_10002661
413 Ga0307512_10023471
414 Ga0307513_10034963
415 Ga0307509_10141174
416 Ga0307508_10010996
417 Ga0307508_10012560
418 Ga0307508_10030839
419 Ga0307514_10008300
420 Ga0307516_10005886
421 Ga0307516_10192909
422 Ga0307510_10017495
423 Ga0307510_10061650
424 Ga0307510_10183751
425 Ga0395898_0003850
426 Ga0395898_0008215
427 Ga0395898_0057064
428 Ga0395905_0256807
429 Ga0395901_0012207
430 Ga0439439_0015460
431 Ga0451802_0935414
432 Ga0451853_3018125
433 Ga0439433_0002970
434 Ga0439442_001517
435 Ga0439449_0010816
436 Ga0439449_0047588
437 Ga0439457_000419
438 Ga0439457_000894
439 Ga0439457_008671
440 Ga0439463_086995
441 Ga0450894_000170
442 Ga0450898_003999
443 Ga0450903_000144
444 Ga0450903_018783
445 Ga0450906_000444
446 Ga0439458_0002261
447 Ga0439458_0014564
448 Ga0450908_002644
449 Ga0450901_003106
450 Ga0466965_0062842
451 Ga0466966_0005731
452 Ga0466966_0132812
453 Ga0466961_0023473
454 Ga0466963_0002878
455 Ga0466971_0021752
456 Ga0466968_0013254
457 Ga0466970_0157344
458 Ga0466960_0002784
459 Ga0466959_0037994
460 Ga0466958_0102317
461 Ga0466967_0004065
462 Ga0495617_001480
463 Ga0495592_0006433
464 Ga0495592_0071147
465 Ga0495603_0002077
466 Ga0495603_0011400
467 Ga0495603_0043500
468 Ga0495603_0132400
469 Ga0495590_0030688
470 Ga0495629_0008726
471 Ga0495629_0011369
472 Ga0495629_0079899
473 Ga0495651_0021463
474 Ga0495651_0095888
475 Ga0495651_0167391
476 Ga0495582_0102026
477 Ga0495582_0153949
478 Ga0495605_0001651
479 Ga0495639_0016429
480 Ga0495662_0020033
481 Ga0495662_0054577
482 Ga0495664_0008995
483 Ga0495664_0097746
484 Ga0495585_0068087
485 Ga0495594_0002248
486 Ga0495594_0040967
487 Ga0495594_0043774
488 Ga0495607_0098695
489 Ga0495583_0099698
490 Ga0495610_0074258
491 Ga0495618_0045685
492 Ga0495628_0100952
493 Ga0495631_0031815
494 Ga0495631_0043002
495 Ga0495632_0073665
496 Ga0495643_0108175
497 Ga0495643_0131871
498 Ga0495648_0200088
499 Ga0495666_0008308
500 Ga0495666_0063699
501 Ga0495652_0097301
502 Ga0495665_0106678
503 Ga0495587_0007449
504 Ga0495609_0007313
505 Ga0495597_0028182
506 Ga0495645_0058140
507 Ga0495633_0011060
508 Ga0495656_0106481
509 Ga0495634_0002467
510 Ga0495611_0012280
511 Ga0495611_0012835
512 Ga0495611_0051016
513 Ga0495611_0169108
514 Ga0495625_0002557
515 Ga0495625_0024793
516 Ga0495625_0103951
517 Ga0495625_0112296
518 Ga0495635_0037175
519 Ga0495661_0013277
520 Ga0495661_0043934
521 Ga0495588_0034533
522 Ga0495657_0008144
523 Ga0495657_0008916
524 Ga0495657_0246969
525 Ga0495646_0002033
526 Ga0495613_0000571
527 Ga0495613_0103777
528 Ga0495613_0123743
529 Ga0495613_0366890
530 Ga0495624_0113063
531 Ga0495670_0017490
532 Ga0495671_0091250
533 Ga0495589_0093263
534 Ga0495589_0194953
535 Ga0495600_0278042
536 Ga0495581_0185893
537 Ga0495604_0000623
538 Ga0495604_0279920
539 Ga0495636_0094931
540 Ga0495636_0106114
541 Ga0495674_0195012
542 Ga0495676_0015610
543 Ga0495676_0016010
544 Ga0495676_0017631
545 Ga0495680_0011373
546 Ga0495683_0030120
547 Ga0495687_004471
548 Ga0495687_006861
549 Ga0495687_062075
550 Ga0495675_0003140
551 Ga0495675_0135202
552 Ga0495685_003567
553 Ga0495685_015454
554 Ga0495685_031560
555 Ga0495685_052295
556 Ga0495673_0057171
557 Ga0495681_0000926
558 Ga0495681_0043679
559 Ga0495681_0116790
560 Ga0495684_0084176
561 Ga0495686_0033397
562 Ga0495686_0046113
563 Ga0495593_0025376
564 Ga0495593_0080617
565 Ga0495602_0017544
566 Ga0495602_0307836
567 Ga0495614_0000863
568 Ga0496106_0064428
569 Ga0496109_0237991
570 Ga0501306_000714
571 Ga0501306_001353
572 Ga0501306_003142
573 Ga0501306_006441
574 Ga0501306_020369
575 Ga0501309_000391
576 Ga0501309_007437
577 Ga0501309_007446
578 Ga0501310_001371
579 Ga0501310_002123
580 Ga0501310_012077
581 Ga0501305_001784
582 Ga0501307_000376
583 Ga0495678_022609
584 Ga0501311_000689
585 Ga0501311_001625
586 Ga0501312_001904
587 Ga0501315_000117
588 Ga0501316_000115
589 Ga0501316_000416
590 Ga0501317_000313
591 Ga0501318_000525
592 Ga0501318_001168
593 Ga0501318_013611
594 Ga0501320_000242
595 Ga0501320_000497
596 Ga0501321_000329
597 Ga0501323_000511
598 Ga0501323_001120
599 Ga0501324_000177
600 Ga0501324_000240
601 Ga0501325_000230
602 Ga0501325_000301
603 Ga0501326_02038
604 Ga0501031_0038786
605 Ga0501032_0061995
606 Ga0501033_0007740
607 Ga0501033_0014872
608 Ga0501033_0113489
609 Ga0501034_0005286
610 Ga0501034_0013378
611 Ga0501034_0038173
612 Ga0501034_0052253
613 Ga0501036_0010812
614 Ga0501036_0016950
615 Ga0501036_0026882
616 Ga0501037_0010921
617 Ga0501037_0083122
618 Ga0501038_0023189
619 Ga0501039_0011658
620 Ga0501039_0055250
621 Ga0501042_0035773
622 Ga0501043_0006250
623 Ga0501043_0007109
624 Ga0501043_0018775
625 Ga0501047_0014929
626 Ga0501048_0017025
627 Ga0501068_0159668
628 Ga0501070_0000119
629 Ga0501070_0009395
630 Ga0501070_0183952
631 Ga0501071_0326305
632 Ga0501073_0099678
633 Ga0501074_0001283
634 Ga0501257_013469
635 Ga0501035_0008845
636 Ga0501035_0016499
637 Ga0501035_0173311
638 Ga0501044_0008387
639 Ga0501044_0017541
640 Ga0501044_0040226
641 Ga0501044_0214926
642 Ga0501044_0463622
643 Ga0501045_0022104
644 nmdc:mga0yw44_235530_c1
645 nmdc:mga06z11_946_c1
646 nmdc:mga07m45_75639_c1
647 Ga0495655_0004760
648 Ga0495619_0086338
649 Ga0500578_0121854
650 Ga0500578_0140630
651 Ga0500566_0062996
652 Ga0500566_0078425
653 Ga0500640_078969
654 Ga0500641_0099243
655 Ga0500650_0059462
656 Ga0500654_054597
657 Ga0500654_111469
658 Ga0500660_034656
659 Ga0500560_013320
660 Ga0500569_021600
661 Ga0500652_054031
662 Ga0500652_163255
663 Ga0500561_0001812
664 Ga0500561_0041350
665 Ga0500573_0007821
666 Ga0500573_0021280
667 Ga0500600_0071420
668 Ga0500600_0073779
669 Ga0500600_0100375
670 Ga0500616_0051258
671 Ga0500616_0060046
672 Ga0500624_005849
673 Ga0500633_0032273
674 Ga0500634_0092261
675 Ga0500587_004640
676 Ga0587090_008704
677 Ga0587122_000975
678 Ga0587067_007890
679 Ga0501082_0402448
680 Ga0466962_0017989
681 2547408411
682 2554256242
683 2585296596
684 2585309037
685 2616697281
686 2616899928
687 2643764004
688 2643902278
689 2644265824
690 2644386879
691 2644403848
692 2644440036
693 2644461563
694 2644632639
695 2784590394
696 2785341220
697 2785371483
698 2786672642
699 2804847885
700 2808844014
701 2809234068
702 2811844428
703 2812355962
704 2812478771
705 2852641005
706 2862186394
707 2862284766
708 2862388102
709 2862512694
710 2862577526
711 2863408593
712 2867373852
713 2867430552
714 2873154072
715 2875396678
716 2877679120
717 2912717632
718 2912730185
719 2912762730
720 2918506488
721 2919471719
722 2935395060
723 2946047877
724 2946069825
725 2947226975
726 2954005454
727 2954384024
728 2954678934
729 2954685217
730 2954694823
731 2954710025
732 2954714335
733 2954724284
734 2954737555
735 2954743181
736 2954756389
737 2954762139
738 2990062925
739 2997452847
740 3006393574
741 3006429910
742 3006491301
743 3006500103
744 8008562768
745 8008577185
746 8023627173
747 8025413930
748 8025485665
749 8025531335
750 8048411943
751 8056453191
752 8056668094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

78

294

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.7582 31 255
7ajb-assembly1.cif.gz_a bovine atp synthase dimer state1:state1 0.7554 55 250
7ajf-assembly1.cif.gz_a bovine atp synthase dimer state2:state2 0.7534 55 251
6cp6-assembly1.cif.gz_X monomer yeast atp synthase (f1fo) reconstituted in nanodisc. 0.7508 34 255
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.7497 31 255
ID Description Score Start End Superfamily
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8114 89 255 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.7981 89 255 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.7964 87 255 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.7803 87 255 1.20.120.220
af_P00846_62_226_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.758 83 251 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A7Z0CI39-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8799 7 256 GO:0005886
GO:0045263
GO:0046933
AF-A0A7Z0CI39-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8576 7 256 GO:0005886
GO:0045263
GO:0046933
AF-A0A432JQY8-F1-model_v4 deleted 0.8541 7 256
AF-A0A7W0SGB2-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8508 19 256 GO:0005886
GO:0045263
GO:0046933
AF-K0EUB0-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8487 7 254 GO:0005886
GO:0016787
GO:0045263
GO:0046933

Map