F427512

General Info

Members Datasets Scaffolds Average Seq Length
376 249 374 86

Family's Representative Sequence

Representative Sequence 3300049660|Ga0501216_049110|Ga0501216_049110_455_763
Length 102
Sequence MDRQPAAAAAYLLGTYMAKEELLEMNGEVSEVLPDSRFRVSLENGHQLIAYTSGKMRQNHIKILAGDKVTLELSPYDLSKGRITFRHIENRTGGAPFKRRRY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755523 Delftia sp. HK171 Isolate Unclassified
3 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
4 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
79 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
141 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
142 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
172 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 2.39
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.49
Nodule 1.06
Rhizoplane 1.86
Rhizosphere 70.21
Stem 0
Stem Tuber 0
Unclassified 10.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3793032 2162886007 Bacteria 1754
2 JGI25156J39149_1023136 3300002705 Bacteria 1041
3 JGI25154J39366_1000488 3300002738 Bacteria 20416
4 JGI25157J39369_1000199 3300002741 Bacteria 50810
5 JGI25151J46595_10007976 3300003187 Bacteria 5135
6 rootH2_10064237 3300003320 Bacteria 4223
7 rootL2_10000676 3300003322 Bacteria 21262
8 rootH1_10052143 3300003323 Bacteria 11607
9 rootH1_10073883 3300003316 Bacteria 5494
10 rootH1_10073883 3300003323 Bacteria 2894
11 rootH1_10118140 3300003323 Bacteria 2858
12 rootH1_10160129 3300003323 Bacteria 2943
13 Ga0055539_1000659 3300003752 Bacteria 9147
14 Ga0055526_1003351 3300003771 Bacteria 10230
15 Ga0055526_1022399 3300003771 Bacteria 2149
16 Ga0055524_1004384 3300003775 Bacteria 6514
17 Ga0055536_1047450 3300003781 Bacteria 968
18 Ga0055528_1034120 3300003790 Bacteria 1261
19 Ga0055528_1045148 3300003790 Bacteria 942
20 Ga0055530_10052216 3300003791 Bacteria 944
21 Ga0055540_1018606 3300003792 Bacteria 1899
22 Ga0055540_1059728 3300003792 Bacteria 764
23 Ga0055531_10005582 3300003794 Bacteria 7338
24 Ga0055531_10007727 3300003794 Bacteria 5805
25 Ga0055531_10070150 3300003794 Bacteria 812
26 Ga0055543_1005917 3300004625 Bacteria 3045
27 Ga0065165_1000474 3300005262 Bacteria 62687
28 Ga0065704_10102644 3300005289 Bacteria 2197
29 Ga0065704_10406150 3300005289 Bacteria 726
30 Ga0070658_10194607 3300005327 Bacteria 1710
31 Ga0070658_10994472 3300005327 Bacteria 729
32 Ga0070683_100064577 3300005329 Bacteria 3408
33 Ga0070683_100120314 3300005329 Bacteria 2480
34 Ga0070690_100037072 3300005330 Bacteria 3070
35 Ga0068869_100300510 3300005334 Bacteria 1296
36 Ga0068869_101657906 3300005334 Bacteria 570
37 Ga0070680_100110965 3300005336 Bacteria 2283
38 Ga0070682_100478396 3300005337 Bacteria 960
39 Ga0070660_100062694 3300005339 Bacteria 2889
40 Ga0070660_100295220 3300005339 Bacteria 1328
41 Ga0070687_101047077 3300005343 Bacteria 594
42 Ga0070661_100002004 3300005344 Bacteria 14094
43 Ga0070661_100803695 3300005344 Bacteria 772
44 Ga0070675_101685050 3300005354 Bacteria 585
45 Ga0070671_102016908 3300005355 Bacteria 514
46 Ga0070659_100034203 3300005366 Bacteria 3952
47 Ga0070659_100488367 3300005366 Bacteria 1048
48 Ga0070714_100003370 3300005435 Bacteria 11907
49 Ga0070713_100113455 3300005436 Bacteria 2366
50 Ga0070710_11415468 3300005437 Bacteria 520
51 Ga0070708_100509746 3300005445 Bacteria 1135
52 Ga0070663_100403328 3300005455 Bacteria 1118
53 Ga0070663_101701149 3300005455 Bacteria 564
54 Ga0070678_101216021 3300005456 Bacteria 699
55 Ga0070681_10056972 3300005458 Bacteria 3888
56 Ga0068867_100528148 3300005459 Bacteria 1019
57 Ga0070685_10488607 3300005466 Bacteria 869
58 Ga0070706_101865346 3300005467 Bacteria 546
59 Ga0070707_101546239 3300005468 Bacteria 630
60 Ga0070679_100547816 3300005530 Bacteria 1100
61 Ga0070679_101016214 3300005530 Bacteria 773
62 Ga0070684_100004651 3300005535 Bacteria 10477
63 Ga0068853_100292608 3300005539 Bacteria 1503
64 Ga0068853_100525951 3300005539 Bacteria 1118
65 Ga0068855_100003683 3300005563 Bacteria 18751
66 Ga0068855_100006805 3300005563 Bacteria 13870
67 Ga0068855_100074235 3300005563 Bacteria 3950
68 Ga0070664_100006100 3300005564 Bacteria 9745
69 Ga0068857_100001581 3300005577 Bacteria 18238
70 Ga0068857_100019019 3300005577 Bacteria 6026
71 Ga0068854_100016701 3300005578 Bacteria 4897
72 Ga0068854_100179877 3300005578 Bacteria 1651
73 Ga0068854_101555717 3300005578 Bacteria 601
74 Ga0068856_100001069 3300005614 Bacteria 29002
75 Ga0068856_100005989 3300005614 Bacteria 11971
76 Ga0068852_100002176 3300005616 Bacteria 13431
77 Ga0068852_100746616 3300005616 Bacteria 991
78 Ga0068866_10657977 3300005718 Bacteria 714
79 Ga0068861_100064223 3300005719 Bacteria 2824
80 Ga0068851_10003891 3300005834 Bacteria 6682
81 Ga0068851_10554897 3300005834 Bacteria 695
82 Ga0075364_10012027 3300006051 Bacteria 5278
83 Ga0075432_10409765 3300006058 Unclassified 587
84 Ga0070712_100677005 3300006175 Bacteria 878
85 Ga0075362_10058005 3300006177 Bacteria 1746
86 Ga0075362_10070188 3300006177 Bacteria 1599
87 Ga0075366_10013655 3300006195 Bacteria 4630
88 Ga0075366_10055045 3300006195 Bacteria 2363
89 Ga0075366_10060251 3300006195 Bacteria 2255
90 Ga0075366_10071002 3300006195 Bacteria 2075
91 Ga0075366_10766515 3300006195 Unclassified 600
92 Ga0097621_101551561 3300006237 Bacteria 629
93 Ga0075370_10000041 3300006353 Bacteria 40659
94 Ga0075370_10000595 3300006353 Bacteria 13965
95 Ga0075370_10830523 3300006353 Bacteria 564
96 Ga0068871_100304365 3300006358 Bacteria 1400
97 Ga0099823_1000559 3300006944 Bacteria 25703
98 Ga0105250_10011199 3300009092 Bacteria 3722
99 Ga0105240_10002630 3300009093 Bacteria 28616
100 Ga0105245_11000688 3300009098 Bacteria 880
101 Ga0105243_10060485 3300009148 Bacteria 3026
102 Ga0105241_10119707 3300009174 Bacteria 2119
103 Ga0105241_10176476 3300009174 Bacteria 1769
104 Ga0105242_10042982 3300009176 Bacteria 3653
105 Ga0105242_12382924 3300009176 Bacteria 576
106 Ga0105248_12114146 3300009177 Bacteria 640
107 Ga0105237_10027324 3300009545 Bacteria 5826
108 Ga0105237_10492057 3300009545 Bacteria 1233
109 Ga0105237_12061859 3300009545 Bacteria 579
110 Ga0105238_10001395 3300009551 Bacteria 24233
111 Ga0105238_10022041 3300009551 Bacteria 6493
112 Ga0105238_10990626 3300009551 Bacteria 861
113 Ga0105239_10274113 3300010375 Bacteria 1898
114 Ga0105239_10984153 3300010375 Bacteria 969
115 Ga0105246_10007067 3300011119 Bacteria 6871
116 Ga0157317_1001203 3300012475 Bacteria 1352
117 Ga0157319_1000005 3300012497 Bacteria 372810
118 Ga0157373_10016271 3300013100 Bacteria 5428
119 Ga0157370_10016975 3300013104 Bacteria 7358
120 Ga0157370_10035486 3300013104 Bacteria 4846
121 Ga0157369_10036705 3300013105 Bacteria 5368
122 Ga0157369_10086706 3300013105 Bacteria 3343
123 Ga0157374_10165805 3300013296 Bacteria 2153
124 Ga0157374_11717280 3300013296 Bacteria 652
125 Ga0157378_10468653 3300013297 Bacteria 1253
126 Ga0157372_10005959 3300013307 Bacteria 12957
127 Ga0157372_10551102 3300013307 Bacteria 1344
128 Ga0163163_11279148 3300014325 Bacteria 796
129 Ga0182008_10080770 3300014497 Bacteria 1600
130 Ga0182008_10257967 3300014497 Bacteria 901
131 Ga0182007_10109718 3300015262 Bacteria 917
132 Ga0182007_10140858 3300015262 Bacteria 816
133 Ga0206352_10015283 3300020078 Bacteria 1031
134 Ga0209258_100789 3300025242 Bacteria 19058
135 Ga0209646_1000060 3300025246 Bacteria 256386
136 Ga0209026_1000049 3300025250 Bacteria 255273
137 Ga0209677_100469 3300025253 Bacteria 23221
138 Ga0209759_1000272 3300025256 Bacteria 73495
139 Ga0209759_1004114 3300025256 Bacteria 5552
140 Ga0209759_1008976 3300025256 Bacteria 3070
141 Ga0209759_1026138 3300025256 Bacteria 1229
142 Ga0209673_1004669 3300025273 Bacteria 7231
143 Ga0209673_1009823 3300025273 Bacteria 4100
144 Ga0209673_1011873 3300025273 Bacteria 3555
145 Ga0209675_1096349 3300025291 Bacteria 527
146 Ga0209676_1002401 3300025292 Bacteria 13395
147 Ga0209025_1006124 3300025294 Bacteria 9487
148 Ga0209564_1000021 3300025295 Bacteria 571316
149 Ga0209564_1000657 3300025295 Bacteria 51494
150 Ga0209564_1038733 3300025295 Bacteria 1321
151 Ga0209758_1166143 3300025297 Bacteria 543
152 Ga0209050_1001572 3300025298 Bacteria 23718
153 Ga0209050_1030564 3300025298 Bacteria 1698
154 Ga0209256_1000339 3300025299 Bacteria 77984
155 Ga0209256_1002979 3300025299 Bacteria 12645
156 Ga0209256_1035174 3300025299 Bacteria 1326
157 Ga0209051_1001818 3300025303 Bacteria 16889
158 Ga0209051_1004254 3300025303 Bacteria 8912
159 Ga0209051_1080869 3300025303 Bacteria 938
160 Ga0209257_1000981 3300025304 Bacteria 38736
161 Ga0209257_1003659 3300025304 Bacteria 12890
162 Ga0209257_1011372 3300025304 Bacteria 4295
163 Ga0209257_1108236 3300025304 Bacteria 667
164 Ga0207656_10037238 3300025321 Bacteria 2046
165 Ga0207656_10136676 3300025321 Bacteria 1152
166 Ga0207696_1009427 3300025711 Bacteria 3641
167 Ga0207685_10498316 3300025905 Bacteria 641
168 Ga0207705_10025850 3300025909 Bacteria 4190
169 Ga0207705_10159800 3300025909 Bacteria 1692
170 Ga0207705_10349697 3300025909 Bacteria 1138
171 Ga0207654_10073735 3300025911 Bacteria 2035
172 Ga0207654_10277451 3300025911 Bacteria 1133
173 Ga0207707_10036771 3300025912 Bacteria 4280
174 Ga0207695_10011114 3300025913 Bacteria 10930
175 Ga0207695_10038502 3300025913 Bacteria 5147
176 Ga0207695_11726037 3300025913 Bacteria 507
177 Ga0207671_10508038 3300025914 Bacteria 961
178 Ga0207693_10691676 3300025915 Bacteria 790
179 Ga0207660_10628787 3300025917 Bacteria 875
180 Ga0207662_10570579 3300025918 Bacteria 785
181 Ga0207657_10347403 3300025919 Bacteria 1170
182 Ga0207657_10370792 3300025919 Bacteria 1128
183 Ga0207649_10009833 3300025920 Bacteria 5242
184 Ga0207649_11099406 3300025920 Bacteria 627
185 Ga0207652_10186924 3300025921 Bacteria 1863
186 Ga0207652_11520130 3300025921 Bacteria 573
187 Ga0207694_10014233 3300025924 Bacteria 5998
188 Ga0207694_10137213 3300025924 Bacteria 1965
189 Ga0207700_10551277 3300025928 Bacteria 1023
190 Ga0207664_10024608 3300025929 Bacteria 4526
191 Ga0207690_10025695 3300025932 Bacteria 3701
192 Ga0207690_10818634 3300025932 Bacteria 770
193 Ga0207686_10547670 3300025934 Bacteria 904
194 Ga0207709_10000207 3300025935 Bacteria 76905
195 Ga0207670_10516653 3300025936 Bacteria 972
196 Ga0207665_10007860 3300025939 Bacteria 7044
197 Ga0207691_10163632 3300025940 Bacteria 1950
198 Ga0207689_10118055 3300025942 Bacteria 2181
199 Ga0207689_10871260 3300025942 Bacteria 760
200 Ga0207689_11160477 3300025942 Bacteria 651
201 Ga0207661_10093897 3300025944 Bacteria 2505
202 Ga0207661_10204512 3300025944 Bacteria 1737
203 Ga0207679_10468916 3300025945 Bacteria 1119
204 Ga0207667_10017333 3300025949 Bacteria 8110
205 Ga0207667_10028024 3300025949 Bacteria 6122
206 Ga0207667_10133819 3300025949 Bacteria 2553
207 Ga0207640_10011415 3300025981 Bacteria 5031
208 Ga0207640_10016053 3300025981 Bacteria 4347
209 Ga0207640_10409304 3300025981 Bacteria 1107
210 Ga0207639_10220709 3300026041 Bacteria 1637
211 Ga0207639_10472060 3300026041 Bacteria 1142
212 Ga0207678_10175220 3300026067 Bacteria 1831
213 Ga0207678_10725822 3300026067 Bacteria 875
214 Ga0207702_10000395 3300026078 Bacteria 49788
215 Ga0207702_10014050 3300026078 Bacteria 6648
216 Ga0207702_10766918 3300026078 Bacteria 953
217 Ga0207648_10143048 3300026089 Bacteria 2109
218 Ga0207674_10000005 3300026116 Bacteria 237935
219 Ga0207674_10740650 3300026116 Bacteria 949
220 Ga0207674_11068159 3300026116 Bacteria 776
221 Ga0207675_100032021 3300026118 Bacteria 4899
222 Ga0207698_10077701 3300026142 Bacteria 2662
223 Ga0207698_10311719 3300026142 Bacteria 1470
224 Ga0209281_1000067 3300027111 Bacteria 284517
225 Ga0209389_1006254 3300027296 Bacteria 10313
226 Ga0209371_1014790 3300027312 Bacteria 2123
227 Ga0209588_1002117 3300027671 Bacteria 5354
228 Ga0209588_1247300 3300027671 Unclassified 545
229 Ga0268264_10237783 3300028381 Bacteria 1686
230 Ga0307517_10453059 3300028786 Bacteria 664
231 Ga0307515_10000020 3300028794 Bacteria 411735
232 Ga0307515_10426629 3300028794 Bacteria 945
233 Ga0268256_1016423 3300030500 Bacteria 2123
234 Ga0307511_10028608 3300030521 Bacteria 5054
235 Ga0265316_10086895 3300031344 Bacteria 2390
236 Ga0307509_10383302 3300031507 Bacteria 1118
237 Ga0307408_100007117 3300031548 Bacteria 7406
238 Ga0307408_100034970 3300031548 Bacteria 3523
239 Ga0307405_10842966 3300031731 Bacteria 771
240 Ga0307405_11360514 3300031731 Bacteria 619
241 Ga0307406_10042551 3300031901 Bacteria 2836
242 Ga0307406_11238539 3300031901 Bacteria 649
243 Ga0307414_10548331 3300032004 Bacteria 1030
244 Ga0373936_0061587 3300035113 Bacteria 1533
245 Ga0373956_0021401 3300035119 Bacteria 2759
246 Ga0373956_0277811 3300035119 Bacteria 797
247 Ga0373957_0023283 3300035120 Bacteria 2214
248 Ga0373931_0133030 3300035691 Bacteria 1433
249 Ga0373927_0249085 3300035695 Bacteria 1168
250 Ga0373933_0291389 3300035724 Bacteria 1055
251 Ga0373937_0091649 3300036401 Bacteria 2816
252 Ga0373925_0805457 3300037068 Bacteria 774
253 Ga0395899_0016898 3300037312 Bacteria 5562
254 Ga0395899_0163719 3300037312 Bacteria 1570
255 Ga0395900_0069305 3300037418 Bacteria 3625
256 Ga0395900_0092542 3300037418 Bacteria 3106
257 Ga0395898_0110382 3300037466 Bacteria 2636
258 Ga0395905_0004845 3300037471 Bacteria 13879
259 Ga0395905_0025598 3300037471 Bacteria 5564
260 Ga0395905_0430947 3300037471 Bacteria 1215
261 Ga0395905_1490722 3300037471 Unclassified 581
262 Ga0395901_0061199 3300038443 Bacteria 3917
263 Ga0395901_0828891 3300038443 Bacteria 912
264 Ga0395901_1416210 3300038443 Bacteria 653
265 Ga0451853_0699757 3300041512 Bacteria 554
266 Ga0439443_086700 3300042003 Bacteria 587
267 Ga0439448_0102169 3300042005 Bacteria 975
268 Ga0439463_070243 3300042016 Bacteria 897
269 Ga0450911_000311 3300042115 Bacteria 17566
270 Ga0439435_0030430 3300042436 Bacteria 1463
271 Ga0439459_0017352 3300042438 Bacteria 1340
272 Ga0439459_0226948 3300042438 Bacteria 519
273 Ga0451577_0006860 3300042876 Bacteria 11270
274 Ga0466972_0000093 3300044658 Bacteria 79289
275 Ga0453683_0007448 3300044673 Bacteria 7424
276 Ga0453683_0620267 3300044673 Bacteria 706
277 Ga0466961_0309381 3300044693 Bacteria 964
278 Ga0466963_0326431 3300044694 Bacteria 1080
279 Ga0453684_0034666 3300044712 Bacteria 6997
280 Ga0453684_0292843 3300044712 Bacteria 1853
281 Ga0453684_0746670 3300044712 Bacteria 1060
282 Ga0466971_0113647 3300044719 Bacteria 1251
283 Ga0466957_0524679 3300044842 Bacteria 823
284 Ga0466960_0498540 3300044901 Bacteria 713
285 Ga0466959_0114709 3300045049 Bacteria 1920
286 Ga0451576_0010255 3300045051 Bacteria 10770
287 Ga0451576_0018197 3300045051 Bacteria 7707
288 Ga0451576_0735123 3300045051 Bacteria 1037
289 Ga0451576_2492216 3300045051 Bacteria 528
290 Ga0466967_0186174 3300045976 Bacteria 1960
291 Ga0495638_0301344 3300046460 Bacteria 863
292 Ga0495651_0005304 3300046462 Bacteria 9828
293 Ga0495651_0806092 3300046462 Bacteria 579
294 Ga0495607_0000219 3300046501 Bacteria 61110
295 Ga0495583_0000546 3300046506 Bacteria 52832
296 Ga0495606_0003282 3300046507 Bacteria 17328
297 Ga0495598_0087962 3300046537 Bacteria 1008
298 Ga0495621_0039546 3300046539 Bacteria 1649
299 Ga0495668_0020329 3300046616 Bacteria 3820
300 Ga0495625_0007470 3300046660 Bacteria 9505
301 Ga0495670_0059785 3300046691 Bacteria 1914
302 Ga0495671_0052320 3300046692 Bacteria 2030
303 Ga0495649_0000270 3300046694 Bacteria 46170
304 Ga0495589_0002736 3300046794 Bacteria 9753
305 Ga0495636_0154197 3300047318 Bacteria 1032
306 Ga0495683_0070378 3300047323 Bacteria 1718
307 Ga0496101_0438670 3300048904 Bacteria 1030
308 Ga0496106_0939855 3300048909 Bacteria 682
309 Ga0496108_0817426 3300048911 Bacteria 803
310 Ga0496109_0398730 3300048912 Bacteria 1300
311 Ga0496109_0491692 3300048912 Bacteria 1158
312 Ga0496110_1028043 3300048913 Unclassified 732
313 Ga0496113_0914766 3300048916 Bacteria 693
314 Ga0496121_0002603 3300048924 Bacteria 27252
315 Ga0496122_0003645 3300048925 Bacteria 20023
316 Ga0496122_0032773 3300048925 Bacteria 4289
317 Ga0496122_0508699 3300048925 Bacteria 583
318 Ga0496123_0008785 3300048926 Bacteria 9211
319 Ga0496123_0040715 3300048926 Bacteria 3231
320 Ga0496124_0031036 3300048927 Bacteria 4734
321 Ga0496124_0034279 3300048927 Bacteria 4457
322 Ga0496124_0191950 3300048927 Bacteria 1562
323 Ga0496125_0000135 3300048928 Bacteria 160987
324 Ga0496125_0006296 3300048928 Bacteria 12887
325 Ga0496125_0010972 3300048928 Bacteria 9099
326 Ga0496126_0051679 3300048929 Bacteria 3740
327 Ga0496126_0082124 3300048929 Bacteria 2848
328 Ga0496126_0148844 3300048929 Bacteria 2008
329 Ga0496126_0505849 3300048929 Bacteria 965
330 Ga0496126_0708459 3300048929 Bacteria 781
331 Ga0501306_008216 3300049127 Bacteria 1268
332 Ga0501315_023728 3300049531 Bacteria 844
333 Ga0501336_004519 3300049552 Bacteria 979
334 Ga0501031_0286288 3300049568 Bacteria 1069
335 Ga0501032_0079949 3300049569 Bacteria 2176
336 Ga0501032_0379347 3300049569 Bacteria 909
337 Ga0501034_0713550 3300049571 Bacteria 900
338 Ga0501036_0198687 3300049572 Bacteria 1687
339 Ga0501038_0946206 3300049574 Bacteria 634
340 Ga0501043_0000517 3300049579 Bacteria 34673
341 Ga0501043_0464380 3300049579 Bacteria 949
342 Ga0501046_0000363 3300049580 Bacteria 45740
343 Ga0501046_0124642 3300049580 Bacteria 1958
344 Ga0501047_0000137 3300049581 Bacteria 89064
345 Ga0501048_0031993 3300049582 Bacteria 3803
346 Ga0501216_049110 3300049660 Unclassified 826
347 Ga0501080_0117681 3300049742 Bacteria 2463
348 Ga0501083_0456473 3300049744 Bacteria 832
349 Ga0501035_0686032 3300049822 Bacteria 827
350 Ga0501044_0317778 3300049823 Bacteria 1482
351 Ga0501044_0342688 3300049823 Bacteria 1415
352 nmdc:mga03683_337878_c1 3300050489 Bacteria 711
353 nmdc:mga00v17_5952_c2 3300050491 Bacteria 5263
354 nmdc:mga0k408_2265_c1 3300050493 Bacteria 10268
355 nmdc:mga0k408_62711_c1 3300050493 Bacteria 2162
356 nmdc:mga07m45_233728_c1 3300050496 Bacteria 1070
357 nmdc:mga08x19_1700_c1 3300050514 Bacteria 13537
358 nmdc:mga08x19_283922_c1 3300050514 Bacteria 1147
359 Ga0500578_0164006 3300053086 Bacteria 1377
360 Ga0500608_068947 3300053122 Bacteria 1683
361 Ga0500564_382437 3300053138 Bacteria 514
362 Ga0500622_0006730 3300053156 Bacteria 6625
363 Ga0500636_0015926 3300053177 Bacteria 4430
364 Ga0500661_041685 3300055283 Bacteria 813
365 Ga0590071_003751 3300059421 Bacteria 3727
366 Ga0590071_046648 3300059421 Bacteria 1047
367 Ga0590074_005366 3300059423 Bacteria 2122
368 Ga0590075_014235 3300059424 Bacteria 1944
369 Ga0590077_041350 3300059426 Bacteria 1024
370 Ga0587080_140862 3300059503 Bacteria 551
371 Ga0587090_128956 3300059510 Bacteria 556
372 Ga0587109_062404 3300059624 Bacteria 788
373 Ga0587111_0026239 3300060346 Bacteria 1159
374 Ga0587111_0220033 3300060346 Bacteria 548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0021401 Ga0373956_0021401_1812_2084 79
2 3300036401 Ga0373937_0091649 Ga0373937_0091649_763_1035 79
3 3300005355 Ga0070671_102016908 Ga0070671_1020169081 81
4 3300005468 Ga0070707_101546239 Ga0070707_1015462391 81
5 3300006177 Ga0075362_10058005 Ga0075362_100580054 81
6 3300006177 Ga0075362_10070188 Ga0075362_100701882 81
7 3300006195 Ga0075366_10060251 Ga0075366_100602512 81
8 3300028794 Ga0307515_10426629 Ga0307515_104266292 81
9 3300035691 Ga0373931_0133030 Ga0373931_0133030_367_618 81
10 3300037471 Ga0395905_1490722 Ga0395905_1490722_201_449 81
11 3300046462 Ga0495651_0806092 Ga0495651_0806092_301_552 81
12 3300050489 nmdc:mga03683_337878_c1 nmdc:mga03683_337878_c1_436_687 81
13 3300050493 nmdc:mga0k408_62711_c1 nmdc:mga0k408_62711_c1_825_1076 81
14 iso_pu_bacteria 2904479285 2904480140 81
15 3300003320 rootH2_10064237 rootH2_100642373 82
16 3300003322 rootL2_10000676 rootL2_100006766 82
17 3300003323 rootH1_10073883 rootH1_100738835 82
18 3300003323 rootH1_10160129 rootH1_101601295 82
19 3300003771 Ga0055526_1003351 Ga0055526_10033518 82
20 3300003775 Ga0055524_1004384 Ga0055524_10043844 82
21 3300003790 Ga0055528_1034120 Ga0055528_10341202 82
22 3300003790 Ga0055528_1045148 Ga0055528_10451482 82
23 3300003791 Ga0055530_10052216 Ga0055530_100522162 82
24 3300003792 Ga0055540_1059728 Ga0055540_10597281 82
25 3300003794 Ga0055531_10005582 Ga0055531_100055827 82
26 3300003794 Ga0055531_10007727 Ga0055531_100077277 82
27 3300004625 Ga0055543_1005917 Ga0055543_10059172 82
28 3300005262 Ga0065165_1000474 Ga0065165_100047453 82
29 3300006195 Ga0075366_10055045 Ga0075366_100550452 82
30 3300006353 Ga0075370_10000595 Ga0075370_100005954 82
31 3300006944 Ga0099823_1000559 Ga0099823_100055917 82
32 3300009092 Ga0105250_10011199 Ga0105250_100111992 82
33 3300009148 Ga0105243_10060485 Ga0105243_100604854 82
34 3300012475 Ga0157317_1001203 Ga0157317_10012033 82
35 3300012497 Ga0157319_1000005 Ga0157319_1000005124 82
36 3300025273 Ga0209673_1004669 Ga0209673_10046699 82
37 3300025273 Ga0209673_1009823 Ga0209673_10098234 82
38 3300025273 Ga0209673_1011873 Ga0209673_10118734 82
39 3300025295 Ga0209564_1000021 Ga0209564_100002173 82
40 3300025297 Ga0209758_1166143 Ga0209758_11661432 82
41 3300025298 Ga0209050_1001572 Ga0209050_100157215 82
42 3300025299 Ga0209256_1000339 Ga0209256_100033954 82
43 3300025299 Ga0209256_1002979 Ga0209256_10029795 82
44 3300025299 Ga0209256_1035174 Ga0209256_10351742 82
45 3300025303 Ga0209051_1004254 Ga0209051_10042544 82
46 3300025303 Ga0209051_1080869 Ga0209051_10808692 82
47 3300025304 Ga0209257_1000981 Ga0209257_100098134 82
48 3300025304 Ga0209257_1003659 Ga0209257_10036598 82
49 3300025711 Ga0207696_1009427 Ga0207696_10094277 82
50 3300025935 Ga0207709_10000207 Ga0207709_1000020765 82
51 3300027111 Ga0209281_1000067 Ga0209281_1000067115 82
52 3300027296 Ga0209389_1006254 Ga0209389_10062542 82
53 3300027312 Ga0209371_1014790 Ga0209371_10147903 82
54 3300030500 Ga0268256_1016423 Ga0268256_10164232 82
55 3300031548 Ga0307408_100034970 Ga0307408_1000349705 82
56 3300042003 Ga0439443_086700 Ga0439443_086700_279_536 82
57 3300042436 Ga0439435_0030430 Ga0439435_0030430_904_1161 82
58 3300042438 Ga0439459_0017352 Ga0439459_0017352_211_468 82
59 3300044694 Ga0466963_0326431 Ga0466963_0326431_111_368 82
60 3300045051 Ga0451576_0735123 Ga0451576_0735123_199_453 82
61 3300046460 Ga0495638_0301344 Ga0495638_0301344_284_541 82
62 3300046691 Ga0495670_0059785 Ga0495670_0059785_876_1133 82
63 3300048912 Ga0496109_0491692 Ga0496109_0491692_859_1116 82
64 3300048925 Ga0496122_0508699 Ga0496122_0508699_211_468 82
65 3300048927 Ga0496124_0031036 Ga0496124_0031036_803_1060 82
66 3300049569 Ga0501032_0079949 Ga0501032_0079949_394_657 82
67 3300049579 Ga0501043_0000517 Ga0501043_0000517_22168_22431 82
68 3300049580 Ga0501046_0000363 Ga0501046_0000363_23310_23573 82
69 3300049581 Ga0501047_0000137 Ga0501047_0000137_76402_76665 82
70 3300049582 Ga0501048_0031993 Ga0501048_0031993_2233_2496 82
71 3300049823 Ga0501044_0317778 Ga0501044_0317778_1131_1394 82
72 3300050496 nmdc:mga07m45_233728_c1 nmdc:mga07m45_233728_c1_635_892 82
73 3300053156 Ga0500622_0006730 Ga0500622_0006730_3716_3973 82
74 3300003792 Ga0055540_1018606 Ga0055540_10186061 83
75 3300005329 Ga0070683_100064577 Ga0070683_1000645774 83
76 3300005336 Ga0070680_100110965 Ga0070680_1001109653 83
77 3300005337 Ga0070682_100478396 Ga0070682_1004783962 83
78 3300005339 Ga0070660_100062694 Ga0070660_1000626944 83
79 3300005344 Ga0070661_100002004 Ga0070661_10000200410 83
80 3300005366 Ga0070659_100034203 Ga0070659_1000342035 83
81 3300005435 Ga0070714_100003370 Ga0070714_10000337011 83
82 3300005436 Ga0070713_100113455 Ga0070713_1001134553 83
83 3300005437 Ga0070710_11415468 Ga0070710_114154682 83
84 3300005455 Ga0070663_100403328 Ga0070663_1004033282 83
85 3300005458 Ga0070681_10056972 Ga0070681_100569727 83
86 3300005530 Ga0070679_100547816 Ga0070679_1005478163 83
87 3300005535 Ga0070684_100004651 Ga0070684_1000046517 83
88 3300005563 Ga0068855_100006805 Ga0068855_10000680512 83
89 3300005564 Ga0070664_100006100 Ga0070664_1000061008 83
90 3300005577 Ga0068857_100019019 Ga0068857_1000190197 83
91 3300005578 Ga0068854_100016701 Ga0068854_1000167017 83
92 3300005614 Ga0068856_100005989 Ga0068856_1000059898 83
93 3300005616 Ga0068852_100002176 Ga0068852_1000021768 83
94 3300005834 Ga0068851_10003891 Ga0068851_100038919 83
95 3300006175 Ga0070712_100677005 Ga0070712_1006770052 83
96 3300009093 Ga0105240_10002630 Ga0105240_1000263021 83
97 3300009174 Ga0105241_10119707 Ga0105241_101197072 83
98 3300009545 Ga0105237_10027324 Ga0105237_100273245 83
99 3300009551 Ga0105238_10001395 Ga0105238_1000139512 83
100 3300010375 Ga0105239_10274113 Ga0105239_102741134 83
101 3300013100 Ga0157373_10016271 Ga0157373_100162715 83
102 3300013104 Ga0157370_10016975 Ga0157370_100169754 83
103 3300013104 Ga0157370_10035486 Ga0157370_100354864 83
104 3300013105 Ga0157369_10036705 Ga0157369_100367057 83
105 3300013296 Ga0157374_10165805 Ga0157374_101658053 83
106 3300013307 Ga0157372_10005959 Ga0157372_1000595911 83
107 3300014497 Ga0182008_10080770 Ga0182008_100807703 83
108 3300025303 Ga0209051_1001818 Ga0209051_100181818 83
109 3300025304 Ga0209257_1108236 Ga0209257_11082361 83
110 3300025321 Ga0207656_10037238 Ga0207656_100372384 83
111 3300025909 Ga0207705_10025850 Ga0207705_100258503 83
112 3300025911 Ga0207654_10073735 Ga0207654_100737353 83
113 3300025912 Ga0207707_10036771 Ga0207707_100367717 83
114 3300025913 Ga0207695_10038502 Ga0207695_100385025 83
115 3300025913 Ga0207695_11726037 Ga0207695_117260372 83
116 3300025914 Ga0207671_10508038 Ga0207671_105080382 83
117 3300025915 Ga0207693_10691676 Ga0207693_106916762 83
118 3300025917 Ga0207660_10628787 Ga0207660_106287872 83
119 3300025919 Ga0207657_10347403 Ga0207657_103474032 83
120 3300025920 Ga0207649_10009833 Ga0207649_100098335 83
121 3300025921 Ga0207652_10186924 Ga0207652_101869243 83
122 3300025924 Ga0207694_10014233 Ga0207694_100142335 83
123 3300025928 Ga0207700_10551277 Ga0207700_105512772 83
124 3300025929 Ga0207664_10024608 Ga0207664_100246085 83
125 3300025932 Ga0207690_10025695 Ga0207690_100256952 83
126 3300025944 Ga0207661_10204512 Ga0207661_102045123 83
127 3300025945 Ga0207679_10468916 Ga0207679_104689162 83
128 3300025949 Ga0207667_10028024 Ga0207667_100280246 83
129 3300025981 Ga0207640_10011415 Ga0207640_100114157 83
130 3300026067 Ga0207678_10725822 Ga0207678_107258222 83
131 3300026078 Ga0207702_10014050 Ga0207702_100140507 83
132 3300026116 Ga0207674_10000005 Ga0207674_10000005110 83
133 3300026142 Ga0207698_10077701 Ga0207698_100777012 83
134 3300045976 Ga0466967_0186174 Ga0466967_0186174_896_1150 83
135 3300048911 Ga0496108_0817426 Ga0496108_0817426_203_460 83
136 3300048912 Ga0496109_0398730 Ga0496109_0398730_554_811 83
137 3300048916 Ga0496113_0914766 Ga0496113_0914766_154_411 83
138 3300049531 Ga0501315_023728 Ga0501315_023728_467_724 83
139 3300059421 Ga0590071_003751 Ga0590071_003751_3157_3408 83
140 3300059423 Ga0590074_005366 Ga0590074_005366_980_1231 83
141 3300059503 Ga0587080_140862 Ga0587080_140862_282_539 83
142 3300059624 Ga0587109_062404 Ga0587109_062404_470_724 83
143 iso_pu_bacteria 2721755523 2722884245 83
144 iso_pu_bacteria 2894023352 2894025193 83
145 3300002738 JGI25154J39366_1000488 JGI25154J39366_10004889 84
146 3300002741 JGI25157J39369_1000199 JGI25157J39369_100019929 84
147 3300003323 rootH1_10052143 rootH1_100521439 84
148 3300003323 rootH1_10118140 rootH1_101181404 84
149 3300003752 Ga0055539_1000659 Ga0055539_10006595 84
150 3300005327 Ga0070658_10994472 Ga0070658_109944721 84
151 3300005329 Ga0070683_100120314 Ga0070683_1001203144 84
152 3300005330 Ga0070690_100037072 Ga0070690_1000370724 84
153 3300005334 Ga0068869_100300510 Ga0068869_1003005102 84
154 3300005334 Ga0068869_101657906 Ga0068869_1016579062 84
155 3300005339 Ga0070660_100295220 Ga0070660_1002952202 84
156 3300005343 Ga0070687_101047077 Ga0070687_1010470771 84
157 3300005344 Ga0070661_100803695 Ga0070661_1008036952 84
158 3300005366 Ga0070659_100488367 Ga0070659_1004883671 84
159 3300005445 Ga0070708_100509746 Ga0070708_1005097462 84
160 3300005455 Ga0070663_101701149 Ga0070663_1017011491 84
161 3300005456 Ga0070678_101216021 Ga0070678_1012160211 84
162 3300005459 Ga0068867_100528148 Ga0068867_1005281482 84
163 3300005466 Ga0070685_10488607 Ga0070685_104886071 84
164 3300005467 Ga0070706_101865346 Ga0070706_1018653461 84
165 3300005530 Ga0070679_101016214 Ga0070679_1010162142 84
166 3300005539 Ga0068853_100292608 Ga0068853_1002926082 84
167 3300005539 Ga0068853_100525951 Ga0068853_1005259511 84
168 3300005563 Ga0068855_100003683 Ga0068855_10000368312 84
169 3300005563 Ga0068855_100074235 Ga0068855_1000742356 84
170 3300005577 Ga0068857_100001581 Ga0068857_1000015817 84
171 3300005578 Ga0068854_100179877 Ga0068854_1001798774 84
172 3300005614 Ga0068856_100001069 Ga0068856_10000106920 84
173 3300005616 Ga0068852_100746616 Ga0068852_1007466162 84
174 3300005719 Ga0068861_100064223 Ga0068861_1000642234 84
175 3300005834 Ga0068851_10554897 Ga0068851_105548972 84
176 3300006058 Ga0075432_10409765 Ga0075432_104097652 84
177 3300006195 Ga0075366_10013655 Ga0075366_100136555 84
178 3300006195 Ga0075366_10766515 Ga0075366_107665151 84
179 3300006237 Ga0097621_101551561 Ga0097621_1015515612 84
180 3300006358 Ga0068871_100304365 Ga0068871_1003043654 84
181 3300009098 Ga0105245_11000688 Ga0105245_110006883 84
182 3300009174 Ga0105241_10176476 Ga0105241_101764763 84
183 3300009176 Ga0105242_10042982 Ga0105242_100429824 84
184 3300009176 Ga0105242_12382924 Ga0105242_123829242 84
185 3300009177 Ga0105248_12114146 Ga0105248_121141462 84
186 3300009545 Ga0105237_10492057 Ga0105237_104920572 84
187 3300009545 Ga0105237_12061859 Ga0105237_120618591 84
188 3300009551 Ga0105238_10022041 Ga0105238_100220419 84
189 3300009551 Ga0105238_10990626 Ga0105238_109906262 84
190 3300010375 Ga0105239_10984153 Ga0105239_109841532 84
191 3300011119 Ga0105246_10007067 Ga0105246_100070678 84
192 3300013105 Ga0157369_10086706 Ga0157369_100867067 84
193 3300013296 Ga0157374_11717280 Ga0157374_117172802 84
194 3300013297 Ga0157378_10468653 Ga0157378_104686533 84
195 3300013307 Ga0157372_10551102 Ga0157372_105511022 84
196 3300014325 Ga0163163_11279148 Ga0163163_112791482 84
197 3300015262 Ga0182007_10140858 Ga0182007_101408581 84
198 3300020078 Ga0206352_10015283 Ga0206352_100152832 84
199 3300025242 Ga0209258_100789 Ga0209258_10078914 84
200 3300025246 Ga0209646_1000060 Ga0209646_1000060216 84
201 3300025250 Ga0209026_1000049 Ga0209026_1000049214 84
202 3300025253 Ga0209677_100469 Ga0209677_10046914 84
203 3300025256 Ga0209759_1000272 Ga0209759_100027245 84
204 3300025256 Ga0209759_1008976 Ga0209759_10089764 84
205 3300025256 Ga0209759_1026138 Ga0209759_10261382 84
206 3300025321 Ga0207656_10136676 Ga0207656_101366761 84
207 3300025909 Ga0207705_10159800 Ga0207705_101598003 84
208 3300025911 Ga0207654_10277451 Ga0207654_102774513 84
209 3300025913 Ga0207695_10011114 Ga0207695_100111149 84
210 3300025918 Ga0207662_10570579 Ga0207662_105705792 84
211 3300025919 Ga0207657_10370792 Ga0207657_103707922 84
212 3300025920 Ga0207649_11099406 Ga0207649_110994061 84
213 3300025921 Ga0207652_11520130 Ga0207652_115201301 84
214 3300025924 Ga0207694_10137213 Ga0207694_101372133 84
215 3300025932 Ga0207690_10818634 Ga0207690_108186342 84
216 3300025934 Ga0207686_10547670 Ga0207686_105476701 84
217 3300025936 Ga0207670_10516653 Ga0207670_105166532 84
218 3300025940 Ga0207691_10163632 Ga0207691_101636323 84
219 3300025942 Ga0207689_10118055 Ga0207689_101180553 84
220 3300025942 Ga0207689_11160477 Ga0207689_111604772 84
221 3300025944 Ga0207661_10093897 Ga0207661_100938974 84
222 3300025949 Ga0207667_10017333 Ga0207667_100173334 84
223 3300025949 Ga0207667_10133819 Ga0207667_101338192 84
224 3300025981 Ga0207640_10016053 Ga0207640_100160535 84
225 3300026041 Ga0207639_10220709 Ga0207639_102207093 84
226 3300026041 Ga0207639_10472060 Ga0207639_104720602 84
227 3300026067 Ga0207678_10175220 Ga0207678_101752202 84
228 3300026078 Ga0207702_10000395 Ga0207702_1000039515 84
229 3300026078 Ga0207702_10766918 Ga0207702_107669182 84
230 3300026089 Ga0207648_10143048 Ga0207648_101430483 84
231 3300026116 Ga0207674_10740650 Ga0207674_107406502 84
232 3300026116 Ga0207674_11068159 Ga0207674_110681592 84
233 3300026118 Ga0207675_100032021 Ga0207675_1000320213 84
234 3300026142 Ga0207698_10311719 Ga0207698_103117193 84
235 3300028381 Ga0268264_10237783 Ga0268264_102377832 84
236 3300030521 Ga0307511_10028608 Ga0307511_100286082 84
237 3300031344 Ga0265316_10086895 Ga0265316_100868953 84
238 3300031507 Ga0307509_10383302 Ga0307509_103833022 84
239 3300032004 Ga0307414_10548331 Ga0307414_105483312 84
240 3300035695 Ga0373927_0249085 Ga0373927_0249085_255_515 84
241 3300042005 Ga0439448_0102169 Ga0439448_0102169_357_614 84
242 3300042438 Ga0439459_0226948 Ga0439459_0226948_39_296 84
243 3300044712 Ga0453684_0292843 Ga0453684_0292843_1419_1676 84
244 3300044712 Ga0453684_0746670 Ga0453684_0746670_544_807 84
245 3300046501 Ga0495607_0000219 Ga0495607_0000219_44738_44995 84
246 3300046506 Ga0495583_0000546 Ga0495583_0000546_8289_8549 84
247 3300046507 Ga0495606_0003282 Ga0495606_0003282_10475_10735 84
248 3300046616 Ga0495668_0020329 Ga0495668_0020329_597_857 84
249 3300046660 Ga0495625_0007470 Ga0495625_0007470_1735_1995 84
250 3300046692 Ga0495671_0052320 Ga0495671_0052320_336_596 84
251 3300046694 Ga0495649_0000270 Ga0495649_0000270_44267_44527 84
252 3300046794 Ga0495589_0002736 Ga0495589_0002736_9439_9699 84
253 3300047323 Ga0495683_0070378 Ga0495683_0070378_286_546 84
254 3300048904 Ga0496101_0438670 Ga0496101_0438670_273_533 84
255 3300048909 Ga0496106_0939855 Ga0496106_0939855_320_577 84
256 3300048913 Ga0496110_1028043 Ga0496110_1028043_33_293 84
257 3300048929 Ga0496126_0148844 Ga0496126_0148844_721_978 84
258 3300048929 Ga0496126_0505849 Ga0496126_0505849_325_585 84
259 3300049660 Ga0501216_049110 Ga0501216_049110_455_763 84
260 3300050493 nmdc:mga0k408_2265_c1 nmdc:mga0k408_2265_c1_1614_1871 84
261 3300053086 Ga0500578_0164006 Ga0500578_0164006_325_585 84
262 3300053122 Ga0500608_068947 Ga0500608_068947_424_684 84
263 3300053138 Ga0500564_382437 Ga0500564_382437_192_452 84
264 3300053177 Ga0500636_0015926 Ga0500636_0015926_766_1026 84
265 3300055283 Ga0500661_041685 Ga0500661_041685_45_305 84
266 3300059510 Ga0587090_128956 Ga0587090_128956_82_339 84
267 3300060346 Ga0587111_0026239 Ga0587111_0026239_434_691 84
268 3300060346 Ga0587111_0220033 Ga0587111_0220033_169_426 84
269 3300003187 JGI25151J46595_10007976 JGI25151J46595_100079762 85
270 3300003771 Ga0055526_1022399 Ga0055526_10223991 85
271 3300003781 Ga0055536_1047450 Ga0055536_10474502 85
272 3300003794 Ga0055531_10070150 Ga0055531_100701502 85
273 3300005289 Ga0065704_10406150 Ga0065704_104061502 85
274 3300005354 Ga0070675_101685050 Ga0070675_1016850501 85
275 3300005578 Ga0068854_101555717 Ga0068854_1015557171 85
276 3300006195 Ga0075366_10071002 Ga0075366_100710023 85
277 3300006353 Ga0075370_10000041 Ga0075370_100000417 85
278 3300006353 Ga0075370_10830523 Ga0075370_108305231 85
279 3300015262 Ga0182007_10109718 Ga0182007_101097181 85
280 3300025291 Ga0209675_1096349 Ga0209675_10963491 85
281 3300025292 Ga0209676_1002401 Ga0209676_100240121 85
282 3300025294 Ga0209025_1006124 Ga0209025_10061244 85
283 3300025295 Ga0209564_1000657 Ga0209564_100065761 85
284 3300025295 Ga0209564_1038733 Ga0209564_10387332 85
285 3300025298 Ga0209050_1030564 Ga0209050_10305642 85
286 3300025304 Ga0209257_1011372 Ga0209257_10113724 85
287 3300025905 Ga0207685_10498316 Ga0207685_104983161 85
288 3300025939 Ga0207665_10007860 Ga0207665_100078606 85
289 3300025981 Ga0207640_10409304 Ga0207640_104093042 85
290 3300027671 Ga0209588_1002117 Ga0209588_10021178 85
291 3300027671 Ga0209588_1247300 Ga0209588_12473002 85
292 3300031548 Ga0307408_100007117 Ga0307408_1000071173 85
293 3300031731 Ga0307405_10842966 Ga0307405_108429662 85
294 3300031731 Ga0307405_11360514 Ga0307405_113605141 85
295 3300031901 Ga0307406_10042551 Ga0307406_100425512 85
296 3300031901 Ga0307406_11238539 Ga0307406_112385391 85
297 3300035113 Ga0373936_0061587 Ga0373936_0061587_21_284 85
298 3300035119 Ga0373956_0277811 Ga0373956_0277811_508_780 85
299 3300035120 Ga0373957_0023283 Ga0373957_0023283_383_655 85
300 3300035724 Ga0373933_0291389 Ga0373933_0291389_230_502 85
301 3300037068 Ga0373925_0805457 Ga0373925_0805457_17_280 85
302 3300037471 Ga0395905_0004845 Ga0395905_0004845_825_1088 85
303 3300038443 Ga0395901_1416210 Ga0395901_1416210_301_564 85
304 3300042115 Ga0450911_000311 Ga0450911_000311_8231_8491 85
305 3300042876 Ga0451577_0006860 Ga0451577_0006860_7347_7607 85
306 3300044658 Ga0466972_0000093 Ga0466972_0000093_13330_13593 85
307 3300044673 Ga0453683_0007448 Ga0453683_0007448_2893_3162 85
308 3300044673 Ga0453683_0620267 Ga0453683_0620267_327_587 85
309 3300044712 Ga0453684_0034666 Ga0453684_0034666_4624_4884 85
310 3300044901 Ga0466960_0498540 Ga0466960_0498540_399_662 85
311 3300045051 Ga0451576_0010255 Ga0451576_0010255_9268_9528 85
312 3300045051 Ga0451576_0018197 Ga0451576_0018197_1390_1659 85
313 3300045051 Ga0451576_2492216 Ga0451576_2492216_96_356 85
314 3300046462 Ga0495651_0005304 Ga0495651_0005304_9235_9507 85
315 3300046537 Ga0495598_0087962 Ga0495598_0087962_478_741 85
316 3300046539 Ga0495621_0039546 Ga0495621_0039546_577_840 85
317 3300047318 Ga0495636_0154197 Ga0495636_0154197_394_666 85
318 3300048927 Ga0496124_0034279 Ga0496124_0034279_3971_4231 85
319 3300048928 Ga0496125_0010972 Ga0496125_0010972_4809_5069 85
320 3300048929 Ga0496126_0051679 Ga0496126_0051679_1521_1781 85
321 3300049127 Ga0501306_008216 Ga0501306_008216_278_553 85
322 3300049552 Ga0501336_004519 Ga0501336_004519_300_563 85
323 3300050514 nmdc:mga08x19_1700_c1 nmdc:mga08x19_1700_c1_12778_13050 85
324 3300050514 nmdc:mga08x19_283922_c1 nmdc:mga08x19_283922_c1_506_778 85
325 3300002705 JGI25156J39149_1023136 JGI25156J39149_10231361 86
326 3300005327 Ga0070658_10194607 Ga0070658_101946074 86
327 3300005718 Ga0068866_10657977 Ga0068866_106579771 86
328 3300006051 Ga0075364_10012027 Ga0075364_100120273 86
329 3300014497 Ga0182008_10257967 Ga0182008_102579672 86
330 3300025256 Ga0209759_1004114 Ga0209759_10041148 86
331 3300025909 Ga0207705_10349697 Ga0207705_103496972 86
332 3300025942 Ga0207689_10871260 Ga0207689_108712601 86
333 3300028786 Ga0307517_10453059 Ga0307517_104530591 86
334 3300028794 Ga0307515_10000020 Ga0307515_10000020189 86
335 3300037312 Ga0395899_0016898 Ga0395899_0016898_4506_4778 86
336 3300037418 Ga0395900_0092542 Ga0395900_0092542_2040_2312 86
337 3300037466 Ga0395898_0110382 Ga0395898_0110382_811_1083 86
338 3300037471 Ga0395905_0025598 Ga0395905_0025598_1731_2003 86
339 3300037471 Ga0395905_0430947 Ga0395905_0430947_264_530 86
340 3300038443 Ga0395901_0061199 Ga0395901_0061199_719_991 86
341 3300041512 Ga0451853_0699757 Ga0451853_0699757_140_409 86
342 3300042016 Ga0439463_070243 Ga0439463_070243_16_288 86
343 3300044693 Ga0466961_0309381 Ga0466961_0309381_305_571 86
344 3300044719 Ga0466971_0113647 Ga0466971_0113647_668_934 86
345 3300044842 Ga0466957_0524679 Ga0466957_0524679_529_795 86
346 3300045049 Ga0466959_0114709 Ga0466959_0114709_1000_1266 86
347 3300048924 Ga0496121_0002603 Ga0496121_0002603_21082_21345 86
348 3300048928 Ga0496125_0006296 Ga0496125_0006296_8952_9215 86
349 3300049568 Ga0501031_0286288 Ga0501031_0286288_62_328 86
350 3300049569 Ga0501032_0379347 Ga0501032_0379347_194_460 86
351 3300049571 Ga0501034_0713550 Ga0501034_0713550_248_514 86
352 3300049572 Ga0501036_0198687 Ga0501036_0198687_1186_1452 86
353 3300049574 Ga0501038_0946206 Ga0501038_0946206_144_410 86
354 3300049579 Ga0501043_0464380 Ga0501043_0464380_544_810 86
355 3300049580 Ga0501046_0124642 Ga0501046_0124642_71_337 86
356 3300049742 Ga0501080_0117681 Ga0501080_0117681_1468_1734 86
357 3300049744 Ga0501083_0456473 Ga0501083_0456473_511_777 86
358 3300049822 Ga0501035_0686032 Ga0501035_0686032_221_487 86
359 3300049823 Ga0501044_0342688 Ga0501044_0342688_965_1231 86
360 3300050491 nmdc:mga00v17_5952_c2 nmdc:mga00v17_5952_c2_1193_1459 86
361 3300059421 Ga0590071_046648 Ga0590071_046648_273_539 86
362 3300059424 Ga0590075_014235 Ga0590075_014235_801_1067 86
363 3300059426 Ga0590077_041350 Ga0590077_041350_406_672 86
364 3300037312 Ga0395899_0163719 Ga0395899_0163719_268_540 87
365 3300037418 Ga0395900_0069305 Ga0395900_0069305_771_1043 87
366 3300038443 Ga0395901_0828891 Ga0395901_0828891_446_718 87
367 3300048929 Ga0496126_0708459 Ga0496126_0708459_153_425 87
368 2162886007 SwRhRL2b_contig_3793032 SwRhRL2b_0056.00005930 89
369 3300005289 Ga0065704_10102644 Ga0065704_101026443 89
370 3300048925 Ga0496122_0003645 Ga0496122_0003645_14402_14671 89
371 3300048925 Ga0496122_0032773 Ga0496122_0032773_3772_4041 89
372 3300048926 Ga0496123_0008785 Ga0496123_0008785_6281_6550 89
373 3300048926 Ga0496123_0040715 Ga0496123_0040715_1602_1871 89
374 3300048927 Ga0496124_0191950 Ga0496124_0191950_590_859 89
375 3300048928 Ga0496125_0000135 Ga0496125_0000135_79463_79732 89
376 3300048929 Ga0496126_0082124 Ga0496126_0082124_1438_1707 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01176

eIF-1a

Translation initiation factor 1A / IF-1

23

86

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ql5-assembly1.cif.gz_A crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4 0.9594 5 69
3i4o-assembly2.cif.gz_B crystal structure of translation initiation factor 1 from mycobacterium tuberculosis 0.9479 7 69
4bts-assembly1.cif.gz_C0 the crystal structure of the eukaryotic 40s ribosomal subunit in complex with eif1 and eif1a 0.9399 8 69
1hr0-assembly1.cif.gz_W crystal structure of initiation factor if1 bound to the 30s ribosomal subunit 0.9289 1 70
6c00-assembly1.cif.gz_A solution structure of translation initiation factor 1 from clostridium difficile 0.9155 1 69
ID Description Score Start End Superfamily
af_I1JZH0_64_142_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9614 1 69 2.40.50.140
3i4oA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9463 7 69 2.40.50.140
af_Q12888_1477_1538_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.94 11 33 2.30.30.140
af_Q9XWF2_297_348_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.9064 11 33 2.30.30.140
af_A0A0G2JY53_26_77_2.30.30.360 Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal 0.9054 11 33 2.30.30.360
ID Description Score Start End GO Terms
AF-A0A382AYA2-F1-model_v4 S1-like domain-containing protein 0.9967 2 69 GO:0003723
GO:0003743
GO:0005829
GO:0043022
AF-A0A0C1JWE1-F1-model_v4 Translation initiation factor IF-1 0.9932 1 69 GO:0003743
GO:0005829
GO:0019843
GO:0043022
AF-A0A1E4JZR4-F1-model_v4 Translation initiation factor IF-1 0.9922 1 69 GO:0003723
GO:0003743
GO:0005829
GO:0043022
AF-A0A2D6Q317-F1-model_v4 Translation initiation factor IF-1 0.9917 4 69 GO:0003743
GO:0005829
GO:0019843
GO:0043022
AF-A0A1F6N213-F1-model_v4 Translation initiation factor IF-1 0.9915 1 69 GO:0003743
GO:0005829
GO:0019843
GO:0043022

Feature Viewer

pLDDT pTM Quality
72.62 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map