F427461

General Info

Members Datasets Scaffolds Average Seq Length
376 192 752 154

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0042485|Ga0495640_0042485_2678_3130
Length 150
Sequence MAWLPDDFTHPERVELGTGHHLRPIRESDVDIDFPAVMGSRERLWVKYGEAWGWPPATMTLEQDRDDLAHHEAEIAAHETFNYAILDGAETELLGCVYIDPPGSQAPADAVVSWWVVDRMVDSDLDRELGEFVPRWLDDAWGFRAVDYSP

Samples

Sample ID Description Type Environment
1 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 13.83
Rhizosphere 82.98
Stem 0
Stem Tuber 0
Unclassified 7.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495640_0042485 3300046533 Bacteria 3171
2 Ga0070683_100096162 3300005329 Bacteria 2785
3 Ga0070683_100098783 3300005329 Bacteria 2747
4 Ga0070683_101246948 3300005329 Bacteria 714
5 Ga0068868_100261392 3300005338 Bacteria 1460
6 Ga0070660_100549871 3300005339 Bacteria 963
7 Ga0070689_100945951 3300005340 Bacteria 764
8 Ga0070691_10140314 3300005341 Bacteria 1231
9 Ga0070668_100680582 3300005347 Unclassified 906
10 Ga0070668_101125981 3300005347 Bacteria 709
11 Ga0070688_100578770 3300005365 Bacteria 857
12 Ga0070659_101031387 3300005366 Bacteria 723
13 Ga0070714_100031661 3300005435 Bacteria 4415
14 Ga0070714_100048692 3300005435 Bacteria 3605
15 Ga0070714_100201473 3300005435 Bacteria 1821
16 Ga0070714_100268642 3300005435 Bacteria 1581
17 Ga0070713_100236173 3300005436 Unclassified 1663
18 Ga0070710_11101184 3300005437 Bacteria 583
19 Ga0070711_100054809 3300005439 Bacteria 2753
20 Ga0070711_100199769 3300005439 Bacteria 1542
21 Ga0070711_100233485 3300005439 Bacteria 1435
22 Ga0070681_10041188 3300005458 Bacteria 4628
23 Ga0070685_10150463 3300005466 Unclassified 1474
24 Ga0070679_100018705 3300005530 Bacteria 6725
25 Ga0070679_100374451 3300005530 Bacteria 1371
26 Ga0070684_101666701 3300005535 Bacteria 602
27 Ga0070686_100163727 3300005544 Bacteria 1568
28 Ga0070693_100482824 3300005547 Bacteria 876
29 Ga0068855_100188381 3300005563 Bacteria 2329
30 Ga0068855_101050490 3300005563 Unclassified 854
31 Ga0068854_100066407 3300005578 Bacteria 2625
32 Ga0068856_100075651 3300005614 Bacteria 3335
33 Ga0068856_100854521 3300005614 Bacteria 929
34 Ga0068856_100953337 3300005614 Bacteria 877
35 Ga0068852_100259350 3300005616 Bacteria 1668
36 Ga0068859_100361948 3300005617 Bacteria 1546
37 Ga0068864_100514882 3300005618 Bacteria 1153
38 Ga0068860_100813912 3300005843 Unclassified 948
39 Ga0068862_100590294 3300005844 Bacteria 1065
40 Ga0081455_10015281 3300005937 Bacteria 7464
41 Ga0070717_10032331 3300006028 Bacteria 4216
42 Ga0070717_10073394 3300006028 Bacteria 2860
43 Ga0070717_10210908 3300006028 Unclassified 1704
44 Ga0070717_10286139 3300006028 Bacteria 1463
45 Ga0070717_10411537 3300006028 Bacteria 1216
46 Ga0075432_10016978 3300006058 Bacteria 2484
47 Ga0070712_100000286 3300006175 Bacteria 28494
48 Ga0070712_100607820 3300006175 Bacteria 926
49 Ga0075362_10136395 3300006177 Bacteria 1170
50 Ga0075430_100008389 3300006846 Bacteria 8727
51 Ga0075434_100333699 3300006871 Bacteria 1537
52 Ga0075434_100374339 3300006871 Unclassified 1445
53 Ga0075434_101727443 3300006871 Bacteria 633
54 Ga0075429_100054988 3300006880 Bacteria 3463
55 Ga0068865_100416033 3300006881 Bacteria 1104
56 Ga0097620_100361940 3300006931 Bacteria 1546
57 Ga0075435_100416490 3300007076 Bacteria 1157
58 Ga0105240_10010186 3300009093 Bacteria 13232
59 Ga0111539_10072308 3300009094 Bacteria 4067
60 Ga0105245_10146043 3300009098 Unclassified 2232
61 Ga0105245_10269388 3300009098 Unclassified 1660
62 Ga0105243_10801591 3300009148 Bacteria 928
63 Ga0105248_10208658 3300009177 Bacteria 2201
64 Ga0105248_11581757 3300009177 Bacteria 742
65 Ga0105238_11545451 3300009551 Unclassified 693
66 Ga0105239_10121479 3300010375 Bacteria 2901
67 Ga0105239_10159247 3300010375 Bacteria 2522
68 Ga0105239_10204859 3300010375 Unclassified 2210
69 Ga0157370_10128430 3300013104 Bacteria 2365
70 Ga0157370_11006288 3300013104 Bacteria 754
71 Ga0157369_10088026 3300013105 Bacteria 3315
72 Ga0157369_10347977 3300013105 Bacteria 1539
73 Ga0157369_10738385 3300013105 Bacteria 1013
74 Ga0157374_10212324 3300013296 Bacteria 1898
75 Ga0157374_10562437 3300013296 Bacteria 1149
76 Ga0157374_12095891 3300013296 Bacteria 592
77 Ga0163162_10492021 3300013306 Unclassified 1357
78 Ga0157372_10644411 3300013307 Bacteria 1234
79 Ga0157372_10914308 3300013307 Bacteria 1018
80 Ga0157372_11163859 3300013307 Bacteria 892
81 Ga0157372_11335685 3300013307 Bacteria 827
82 Ga0157375_10458333 3300013308 Bacteria 1440
83 Ga0163163_10027494 3300014325 Bacteria 5450
84 Ga0163163_10057006 3300014325 Bacteria 3862
85 Ga0157379_10232459 3300014968 Bacteria 1671
86 Ga0157376_10173945 3300014969 Bacteria 1963
87 Ga0157376_12054008 3300014969 Bacteria 609
88 Ga0206353_10480553 3300020082 Bacteria 1122
89 Ga0213876_10003944 3300021384 Bacteria 8375
90 Ga0213876_10016200 3300021384 Bacteria 3940
91 Ga0213876_10042533 3300021384 Bacteria 2401
92 Ga0224712_10221025 3300022467 Bacteria 867
93 Ga0207688_10053157 3300025901 Bacteria 2271
94 Ga0207707_10039926 3300025912 Bacteria 4100
95 Ga0207707_10048438 3300025912 Bacteria 3702
96 Ga0207695_10020222 3300025913 Bacteria 7631
97 Ga0207693_10000287 3300025915 Bacteria 46766
98 Ga0207693_10546297 3300025915 Bacteria 904
99 Ga0207693_10599753 3300025915 Bacteria 857
100 Ga0207660_10097331 3300025917 Bacteria 2192
101 Ga0207687_10273918 3300025927 Unclassified 1350
102 Ga0207700_10099488 3300025928 Bacteria 2315
103 Ga0207664_10198483 3300025929 Bacteria 1730
104 Ga0207706_10467945 3300025933 Unclassified 1090
105 Ga0207704_10353437 3300025938 Bacteria 1145
106 Ga0207711_10116125 3300025941 Bacteria 2386
107 Ga0207661_10284392 3300025944 Bacteria 1479
108 Ga0207661_10431615 3300025944 Bacteria 1198
109 Ga0207667_10266822 3300025949 Bacteria 1750
110 Ga0207667_10685088 3300025949 Bacteria 1028
111 Ga0207668_10529667 3300025972 Unclassified 1018
112 Ga0207668_11071061 3300025972 Bacteria 722
113 Ga0207640_10064512 3300025981 Bacteria 2439
114 Ga0207640_10335171 3300025981 Bacteria 1210
115 Ga0207640_10663337 3300025981 Bacteria 890
116 Ga0207677_10057130 3300026023 Bacteria 2678
117 Ga0207708_10003021 3300026075 Bacteria 12409
118 Ga0207702_10165010 3300026078 Bacteria 2025
119 Ga0207641_10936725 3300026088 Unclassified 861
120 Ga0207676_10185448 3300026095 Bacteria 1826
121 Ga0207674_10553838 3300026116 Bacteria 1111
122 Ga0207698_10332294 3300026142 Bacteria 1428
123 Ga0207698_11513764 3300026142 Bacteria 686
124 Ga0207428_10050228 3300027907 Bacteria 3338
125 Ga0268266_11122506 3300028379 Bacteria 761
126 Ga0268265_10176211 3300028380 Bacteria 1833
127 Ga0373953_0064551 3300035117 Bacteria 1502
128 Ga0373935_0219635 3300035692 Unclassified 1320
129 Ga0373937_0001806 3300036401 Bacteria 17960
130 Ga0373937_0590502 3300036401 Bacteria 1054
131 Ga0373937_0881162 3300036401 Bacteria 844
132 Ga0395899_0234935 3300037312 Bacteria 1264
133 Ga0395900_0066709 3300037418 Bacteria 3698
134 Ga0395898_0215493 3300037466 Bacteria 1831
135 Ga0436364_0802352 3300037853 Bacteria 1796
136 Ga0395901_0006092 3300038443 Bacteria 12215
137 Ga0395901_0512071 3300038443 Bacteria 1220
138 Ga0395901_0666647 3300038443 Unclassified 1042
139 Ga0436365_0539518 3300039437 Bacteria 1087
140 Ga0436365_0577991 3300039437 Bacteria 7112
141 Ga0436365_0625566 3300039437 Bacteria 909
142 Ga0436365_1024446 3300039437 Bacteria 3693
143 Ga0436365_1501762 3300039437 Bacteria 11122
144 Ga0436363_0169834 3300039450 Unclassified 3514
145 Ga0436362_0181569 3300039453 Bacteria 1411
146 Ga0451853_0403944 3300041512 Bacteria 869
147 Ga0466966_0171583 3300044684 Bacteria 1318
148 Ga0466963_0017755 3300044694 Bacteria 4438
149 Ga0466963_0071060 3300044694 Bacteria 2342
150 Ga0466963_0104437 3300044694 Bacteria 1941
151 Ga0466964_0809227 3300044706 Bacteria 530
152 Ga0466971_0197907 3300044719 Bacteria 948
153 Ga0466968_0072350 3300044735 Bacteria 1503
154 Ga0466970_0103057 3300044765 Bacteria 1555
155 Ga0466957_0009111 3300044842 Bacteria 5659
156 Ga0466957_0388245 3300044842 Bacteria 953
157 Ga0466960_0105234 3300044901 Bacteria 1458
158 Ga0466959_0036769 3300045049 Bacteria 3617
159 Ga0466959_0250665 3300045049 Bacteria 1221
160 Ga0466958_0015488 3300045836 Bacteria 4369
161 Ga0466958_0321108 3300045836 Bacteria 995
162 Ga0466958_0433682 3300045836 Bacteria 850
163 Ga0466967_0002771 3300045976 Bacteria 11097
164 Ga0466967_0021370 3300045976 Bacteria 5254
165 Ga0466967_0033287 3300045976 Bacteria 4361
166 Ga0466967_0623612 3300045976 Bacteria 1065
167 Ga0466967_0628380 3300045976 Bacteria 1061
168 Ga0466967_1194308 3300045976 Bacteria 758
169 Ga0495592_0200223 3300046454 Bacteria 1348
170 Ga0495651_0003406 3300046462 Bacteria 12194
171 Ga0495653_0048785 3300046463 Bacteria 3266
172 Ga0495582_0158667 3300046473 Bacteria 1286
173 Ga0495664_0224211 3300046477 Bacteria 1138
174 Ga0495608_0004769 3300046511 Bacteria 9697
175 Ga0495608_0122525 3300046511 Bacteria 1667
176 Ga0495618_0529064 3300046514 Bacteria 708
177 Ga0495628_0227664 3300046516 Unclassified 1398
178 Ga0495630_0512349 3300046517 Unclassified 920
179 Ga0495652_0020624 3300046529 Bacteria 5858
180 Ga0495587_0121722 3300046536 Unclassified 1494
181 Ga0495587_0153399 3300046536 Bacteria 1313
182 Ga0495667_0260738 3300046559 Bacteria 1102
183 Ga0495657_0004069 3300046675 Bacteria 11723
184 Ga0495657_0237043 3300046675 Bacteria 1102
185 Ga0495657_0720828 3300046675 Bacteria 573
186 Ga0495599_0142413 3300046678 Bacteria 1487
187 Ga0495623_0498915 3300046679 Bacteria 643
188 Ga0495646_0106852 3300046680 Bacteria 1597
189 Ga0495658_0705082 3300046683 Bacteria 646
190 Ga0495613_0118686 3300046689 Unclassified 1901
191 Ga0495613_0495393 3300046689 Bacteria 823
192 Ga0495600_0031249 3300046809 Bacteria 3449
193 Ga0495600_0350960 3300046809 Bacteria 924
194 Ga0495604_0060694 3300047317 Bacteria 2894
195 Ga0495674_0193710 3300047319 Unclassified 1688
196 Ga0495680_0003727 3300047322 Bacteria 14845
197 Ga0495680_0282943 3300047322 Bacteria 1168
198 Ga0495680_0671527 3300047322 Bacteria 687
199 Ga0495675_0147735 3300047444 Bacteria 1454
200 Ga0495684_0010214 3300047471 Bacteria 7263
201 Ga0495593_0132157 3300047673 Bacteria 1267
202 Ga0495602_0009919 3300048088 Bacteria 9878
203 Ga0495602_0236006 3300048088 Bacteria 1371
204 Ga0495602_0529460 3300048088 Bacteria 820
205 Ga0496100_0031352 3300048903 Bacteria 3305
206 Ga0496101_0022764 3300048904 Bacteria 4318
207 Ga0496101_0200609 3300048904 Bacteria 1542
208 Ga0496101_0249916 3300048904 Bacteria 1381
209 Ga0496101_0778544 3300048904 Bacteria 755
210 Ga0496102_0131490 3300048905 Bacteria 2343
211 Ga0496102_0390351 3300048905 Bacteria 1309
212 Ga0496102_0396910 3300048905 Bacteria 1297
213 Ga0496102_1772030 3300048905 Bacteria 535
214 Ga0496103_0432807 3300048906 Bacteria 844
215 Ga0496104_0040957 3300048907 Bacteria 4343
216 Ga0496104_0055417 3300048907 Bacteria 3749
217 Ga0496104_0065732 3300048907 Bacteria 3442
218 Ga0496104_0515109 3300048907 Bacteria 1107
219 Ga0496104_0575583 3300048907 Bacteria 1037
220 Ga0496105_0007781 3300048908 Bacteria 8318
221 Ga0496105_0060435 3300048908 Bacteria 3127
222 Ga0496105_0067011 3300048908 Bacteria 2964
223 Ga0496105_0079173 3300048908 Bacteria 2714
224 Ga0496105_0158267 3300048908 Bacteria 1860
225 Ga0496106_0017472 3300048909 Bacteria 5307
226 Ga0496106_0314238 3300048909 Bacteria 1257
227 Ga0496107_0036475 3300048910 Bacteria 3527
228 Ga0496107_0055472 3300048910 Unclassified 2862
229 Ga0496108_0440078 3300048911 Bacteria 1139
230 Ga0496109_0081097 3300048912 Bacteria 2990
231 Ga0496109_0085768 3300048912 Bacteria 2907
232 Ga0496109_0150613 3300048912 Bacteria 2178
233 Ga0496109_0708294 3300048912 Bacteria 944
234 Ga0496110_0008793 3300048913 Bacteria 8137
235 Ga0496110_0172244 3300048913 Bacteria 1964
236 Ga0496110_0574754 3300048913 Bacteria 1023
237 Ga0496111_0028632 3300048914 Unclassified 3949
238 Ga0496111_0030116 3300048914 Bacteria 3859
239 Ga0496111_0113987 3300048914 Bacteria 1993
240 Ga0496111_0661886 3300048914 Unclassified 761
241 Ga0496111_0670022 3300048914 Bacteria 756
242 Ga0496112_0003239 3300048915 Bacteria 13411
243 Ga0496112_0131079 3300048915 Bacteria 2478
244 Ga0496112_0195706 3300048915 Bacteria 1982
245 Ga0496112_0280543 3300048915 Bacteria 1613
246 Ga0496112_0716030 3300048915 Unclassified 928
247 Ga0496112_0859386 3300048915 Bacteria 830
248 Ga0496113_0019629 3300048916 Bacteria 4732
249 Ga0496113_0599798 3300048916 Bacteria 882
250 Ga0496114_0007989 3300048917 Bacteria 8370
251 Ga0496114_0030720 3300048917 Bacteria 4420
252 Ga0496114_0543693 3300048917 Bacteria 1027
253 Ga0496115_0007071 3300048918 Bacteria 8243
254 Ga0496115_0137800 3300048918 Bacteria 2013
255 Ga0496115_0156929 3300048918 Bacteria 1880
256 Ga0496115_0527919 3300048918 Bacteria 946
257 Ga0501031_0008483 3300049568 Bacteria 6688
258 Ga0501031_0030604 3300049568 Bacteria 3511
259 Ga0501032_0002833 3300049569 Bacteria 13489
260 Ga0501032_0107373 3300049569 Bacteria 1848
261 Ga0501033_0003375 3300049570 Bacteria 13177
262 Ga0501033_0112282 3300049570 Bacteria 1982
263 Ga0501034_0023575 3300049571 Bacteria 6270
264 Ga0501034_0140099 3300049571 Bacteria 2399
265 Ga0501036_0024163 3300049572 Bacteria 5122
266 Ga0501036_0061806 3300049572 Bacteria 3173
267 Ga0501036_0142502 3300049572 Bacteria 2022
268 Ga0501037_0000865 3300049573 Bacteria 22602
269 Ga0501037_0590777 3300049573 Bacteria 746
270 Ga0501038_0021979 3300049574 Bacteria 5721
271 Ga0501038_0028274 3300049574 Bacteria 4981
272 Ga0501038_0102811 3300049574 Bacteria 2377
273 Ga0501039_0005966 3300049575 Bacteria 9231
274 Ga0501039_0007290 3300049575 Bacteria 8424
275 Ga0501039_0055992 3300049575 Bacteria 3054
276 Ga0501040_0005262 3300049576 Bacteria 8365
277 Ga0501040_0010961 3300049576 Bacteria 5926
278 Ga0501040_0014951 3300049576 Bacteria 5125
279 Ga0501040_0033040 3300049576 Bacteria 3503
280 Ga0501041_0002475 3300049577 Bacteria 10495
281 Ga0501041_0008381 3300049577 Bacteria 6078
282 Ga0501042_0004053 3300049578 Bacteria 9290
283 Ga0501042_0007251 3300049578 Bacteria 7252
284 Ga0501042_0022773 3300049578 Bacteria 4377
285 Ga0501042_0642603 3300049578 Bacteria 771
286 Ga0501043_0006017 3300049579 Bacteria 9755
287 Ga0501043_0145831 3300049579 Bacteria 1853
288 Ga0501043_0202584 3300049579 Bacteria 1540
289 Ga0501046_0000786 3300049580 Bacteria 30692
290 Ga0501046_0008252 3300049580 Bacteria 9093
291 Ga0501046_0173438 3300049580 Bacteria 1617
292 Ga0501046_0709878 3300049580 Bacteria 708
293 Ga0501047_0157108 3300049581 Bacteria 2147
294 Ga0501048_0001705 3300049582 Bacteria 16761
295 Ga0501048_0042381 3300049582 Bacteria 3259
296 Ga0501048_0052775 3300049582 Bacteria 2893
297 Ga0501048_0088115 3300049582 Bacteria 2189
298 Ga0501067_0030485 3300049583 Bacteria 2991
299 Ga0501068_0009191 3300049584 Bacteria 5521
300 Ga0501068_0011066 3300049584 Bacteria 5079
301 Ga0501068_0121637 3300049584 Bacteria 1628
302 Ga0501069_0020192 3300049585 Bacteria 3608
303 Ga0501069_0028392 3300049585 Bacteria 3067
304 Ga0501070_0006669 3300049586 Bacteria 9831
305 Ga0501070_0140164 3300049586 Bacteria 1996
306 Ga0501071_0031661 3300049587 Bacteria 3751
307 Ga0501071_0048628 3300049587 Bacteria 3051
308 Ga0501071_0056179 3300049587 Bacteria 2842
309 Ga0501071_0061265 3300049587 Bacteria 2724
310 Ga0501071_1388007 3300049587 Bacteria 542
311 Ga0501072_0009801 3300049588 Bacteria 7284
312 Ga0501072_0054718 3300049588 Bacteria 3144
313 Ga0501072_0055194 3300049588 Bacteria 3131
314 Ga0501072_0134104 3300049588 Bacteria 1974
315 Ga0501073_0048510 3300049589 Bacteria 2980
316 Ga0501073_0211424 3300049589 Bacteria 1340
317 Ga0501074_0016299 3300049590 Bacteria 5395
318 Ga0501074_0046305 3300049590 Bacteria 3144
319 Ga0501074_0091060 3300049590 Bacteria 2184
320 Ga0501075_0004222 3300049591 Bacteria 9708
321 Ga0501075_0020111 3300049591 Bacteria 4849
322 Ga0501075_0108849 3300049591 Bacteria 2106
323 Ga0501075_0126036 3300049591 Bacteria 1949
324 Ga0501076_0007230 3300049592 Bacteria 8078
325 Ga0501076_0014933 3300049592 Bacteria 5860
326 Ga0501076_0203400 3300049592 Bacteria 1617
327 Ga0501076_0276081 3300049592 Bacteria 1376
328 Ga0501076_0693003 3300049592 Bacteria 841
329 Ga0501077_0017815 3300049593 Bacteria 4487
330 Ga0501077_0033016 3300049593 Bacteria 3295
331 Ga0501077_0169946 3300049593 Bacteria 1385
332 Ga0501077_0508416 3300049593 Bacteria 772
333 Ga0501079_0009913 3300049741 Bacteria 7229
334 Ga0501079_0024980 3300049741 Bacteria 4583
335 Ga0501079_0033785 3300049741 Bacteria 3935
336 Ga0501079_0153064 3300049741 Bacteria 1797
337 Ga0501079_0655078 3300049741 Bacteria 827
338 Ga0501080_0069443 3300049742 Bacteria 3276
339 Ga0501081_0002215 3300049743 Bacteria 12229
340 Ga0501081_0007819 3300049743 Bacteria 6930
341 Ga0501081_0011602 3300049743 Bacteria 5767
342 Ga0501081_0021420 3300049743 Bacteria 4313
343 Ga0501083_0000750 3300049744 Bacteria 21162
344 Ga0501083_0057373 3300049744 Bacteria 2606
345 Ga0501035_0001186 3300049822 Bacteria 27114
346 Ga0501035_0001297 3300049822 Bacteria 25816
347 Ga0501035_0076583 3300049822 Bacteria 2958
348 Ga0501044_0032082 3300049823 Bacteria 5523
349 Ga0501044_0087411 3300049823 Bacteria 3148
350 Ga0501045_0002382 3300049824 Bacteria 12761
351 Ga0501045_0010639 3300049824 Bacteria 6447
352 Ga0501045_0018404 3300049824 Bacteria 4969
353 Ga0501045_0029321 3300049824 Bacteria 3977
354 nmdc:mga05p37_677833_c1 3300050507 Bacteria 1149
355 nmdc:mga09592_392540_c1 3300050508 Bacteria 1200
356 nmdc:mga06r32_590966_c1 3300050510 Bacteria 1082
357 nmdc:mga08y16_247364_c1 3300050511 Bacteria 1843
358 nmdc:mga0n895_191428_c1 3300050512 Bacteria 2076
359 nmdc:mga0n895_250798_c1 3300050512 Bacteria 1796
360 Ga0495601_0683149 3300053077 Bacteria 656
361 Ga0495601_0911823 3300053077 Bacteria 555
362 Ga0495601_0924499 3300053077 Bacteria 550
363 Ga0495595_0102778 3300053084 Unclassified 1380
364 Ga0495619_0582548 3300053085 Bacteria 766
365 Ga0495619_1128404 3300053085 Bacteria 521
366 Ga0501084_0010927 3300054114 Bacteria 7519
367 Ga0501084_0029568 3300054114 Bacteria 4583
368 Ga0501084_0100270 3300054114 Bacteria 2431
369 Ga0501082_0010368 3300060353 Bacteria 8024
370 Ga0501082_0031374 3300060353 Bacteria 4581
371 Ga0501082_0192207 3300060353 Bacteria 1775
372 Ga0501082_0244514 3300060353 Bacteria 1561
373 Ga0466962_0021863 3300061719 Bacteria 3071
374 Ga0466962_0054864 3300061719 Bacteria 1904
375 Ga0530510_0001091 3300061734 Bacteria 17991
376 Ga0530510_0010284 3300061734 Bacteria 6554
377 Ga0495640_0042485
378 Ga0070683_100096162
379 Ga0070683_100098783
380 Ga0070683_101246948
381 Ga0068868_100261392
382 Ga0070660_100549871
383 Ga0070689_100945951
384 Ga0070691_10140314
385 Ga0070668_100680582
386 Ga0070668_101125981
387 Ga0070688_100578770
388 Ga0070659_101031387
389 Ga0070714_100031661
390 Ga0070714_100048692
391 Ga0070714_100201473
392 Ga0070714_100268642
393 Ga0070713_100236173
394 Ga0070710_11101184
395 Ga0070711_100054809
396 Ga0070711_100199769
397 Ga0070711_100233485
398 Ga0070681_10041188
399 Ga0070685_10150463
400 Ga0070679_100018705
401 Ga0070679_100374451
402 Ga0070684_101666701
403 Ga0070686_100163727
404 Ga0070693_100482824
405 Ga0068855_100188381
406 Ga0068855_101050490
407 Ga0068854_100066407
408 Ga0068856_100075651
409 Ga0068856_100854521
410 Ga0068856_100953337
411 Ga0068852_100259350
412 Ga0068859_100361948
413 Ga0068864_100514882
414 Ga0068860_100813912
415 Ga0068862_100590294
416 Ga0081455_10015281
417 Ga0070717_10032331
418 Ga0070717_10073394
419 Ga0070717_10210908
420 Ga0070717_10286139
421 Ga0070717_10411537
422 Ga0075432_10016978
423 Ga0070712_100000286
424 Ga0070712_100607820
425 Ga0075362_10136395
426 Ga0075430_100008389
427 Ga0075434_100333699
428 Ga0075434_100374339
429 Ga0075434_101727443
430 Ga0075429_100054988
431 Ga0068865_100416033
432 Ga0097620_100361940
433 Ga0075435_100416490
434 Ga0105240_10010186
435 Ga0111539_10072308
436 Ga0105245_10146043
437 Ga0105245_10269388
438 Ga0105243_10801591
439 Ga0105248_10208658
440 Ga0105248_11581757
441 Ga0105238_11545451
442 Ga0105239_10121479
443 Ga0105239_10159247
444 Ga0105239_10204859
445 Ga0157370_10128430
446 Ga0157370_11006288
447 Ga0157369_10088026
448 Ga0157369_10347977
449 Ga0157369_10738385
450 Ga0157374_10212324
451 Ga0157374_10562437
452 Ga0157374_12095891
453 Ga0163162_10492021
454 Ga0157372_10644411
455 Ga0157372_10914308
456 Ga0157372_11163859
457 Ga0157372_11335685
458 Ga0157375_10458333
459 Ga0163163_10027494
460 Ga0163163_10057006
461 Ga0157379_10232459
462 Ga0157376_10173945
463 Ga0157376_12054008
464 Ga0206353_10480553
465 Ga0213876_10003944
466 Ga0213876_10016200
467 Ga0213876_10042533
468 Ga0224712_10221025
469 Ga0207688_10053157
470 Ga0207707_10039926
471 Ga0207707_10048438
472 Ga0207695_10020222
473 Ga0207693_10000287
474 Ga0207693_10546297
475 Ga0207693_10599753
476 Ga0207660_10097331
477 Ga0207687_10273918
478 Ga0207700_10099488
479 Ga0207664_10198483
480 Ga0207706_10467945
481 Ga0207704_10353437
482 Ga0207711_10116125
483 Ga0207661_10284392
484 Ga0207661_10431615
485 Ga0207667_10266822
486 Ga0207667_10685088
487 Ga0207668_10529667
488 Ga0207668_11071061
489 Ga0207640_10064512
490 Ga0207640_10335171
491 Ga0207640_10663337
492 Ga0207677_10057130
493 Ga0207708_10003021
494 Ga0207702_10165010
495 Ga0207641_10936725
496 Ga0207676_10185448
497 Ga0207674_10553838
498 Ga0207698_10332294
499 Ga0207698_11513764
500 Ga0207428_10050228
501 Ga0268266_11122506
502 Ga0268265_10176211
503 Ga0373953_0064551
504 Ga0373935_0219635
505 Ga0373937_0001806
506 Ga0373937_0590502
507 Ga0373937_0881162
508 Ga0395899_0234935
509 Ga0395900_0066709
510 Ga0395898_0215493
511 Ga0436364_0802352
512 Ga0395901_0006092
513 Ga0395901_0512071
514 Ga0395901_0666647
515 Ga0436365_0539518
516 Ga0436365_0577991
517 Ga0436365_0625566
518 Ga0436365_1024446
519 Ga0436365_1501762
520 Ga0436363_0169834
521 Ga0436362_0181569
522 Ga0451853_0403944
523 Ga0466966_0171583
524 Ga0466963_0017755
525 Ga0466963_0071060
526 Ga0466963_0104437
527 Ga0466964_0809227
528 Ga0466971_0197907
529 Ga0466968_0072350
530 Ga0466970_0103057
531 Ga0466957_0009111
532 Ga0466957_0388245
533 Ga0466960_0105234
534 Ga0466959_0036769
535 Ga0466959_0250665
536 Ga0466958_0015488
537 Ga0466958_0321108
538 Ga0466958_0433682
539 Ga0466967_0002771
540 Ga0466967_0021370
541 Ga0466967_0033287
542 Ga0466967_0623612
543 Ga0466967_0628380
544 Ga0466967_1194308
545 Ga0495592_0200223
546 Ga0495651_0003406
547 Ga0495653_0048785
548 Ga0495582_0158667
549 Ga0495664_0224211
550 Ga0495608_0004769
551 Ga0495608_0122525
552 Ga0495618_0529064
553 Ga0495628_0227664
554 Ga0495630_0512349
555 Ga0495652_0020624
556 Ga0495587_0121722
557 Ga0495587_0153399
558 Ga0495667_0260738
559 Ga0495657_0004069
560 Ga0495657_0237043
561 Ga0495657_0720828
562 Ga0495599_0142413
563 Ga0495623_0498915
564 Ga0495646_0106852
565 Ga0495658_0705082
566 Ga0495613_0118686
567 Ga0495613_0495393
568 Ga0495600_0031249
569 Ga0495600_0350960
570 Ga0495604_0060694
571 Ga0495674_0193710
572 Ga0495680_0003727
573 Ga0495680_0282943
574 Ga0495680_0671527
575 Ga0495675_0147735
576 Ga0495684_0010214
577 Ga0495593_0132157
578 Ga0495602_0009919
579 Ga0495602_0236006
580 Ga0495602_0529460
581 Ga0496100_0031352
582 Ga0496101_0022764
583 Ga0496101_0200609
584 Ga0496101_0249916
585 Ga0496101_0778544
586 Ga0496102_0131490
587 Ga0496102_0390351
588 Ga0496102_0396910
589 Ga0496102_1772030
590 Ga0496103_0432807
591 Ga0496104_0040957
592 Ga0496104_0055417
593 Ga0496104_0065732
594 Ga0496104_0515109
595 Ga0496104_0575583
596 Ga0496105_0007781
597 Ga0496105_0060435
598 Ga0496105_0067011
599 Ga0496105_0079173
600 Ga0496105_0158267
601 Ga0496106_0017472
602 Ga0496106_0314238
603 Ga0496107_0036475
604 Ga0496107_0055472
605 Ga0496108_0440078
606 Ga0496109_0081097
607 Ga0496109_0085768
608 Ga0496109_0150613
609 Ga0496109_0708294
610 Ga0496110_0008793
611 Ga0496110_0172244
612 Ga0496110_0574754
613 Ga0496111_0028632
614 Ga0496111_0030116
615 Ga0496111_0113987
616 Ga0496111_0661886
617 Ga0496111_0670022
618 Ga0496112_0003239
619 Ga0496112_0131079
620 Ga0496112_0195706
621 Ga0496112_0280543
622 Ga0496112_0716030
623 Ga0496112_0859386
624 Ga0496113_0019629
625 Ga0496113_0599798
626 Ga0496114_0007989
627 Ga0496114_0030720
628 Ga0496114_0543693
629 Ga0496115_0007071
630 Ga0496115_0137800
631 Ga0496115_0156929
632 Ga0496115_0527919
633 Ga0501031_0008483
634 Ga0501031_0030604
635 Ga0501032_0002833
636 Ga0501032_0107373
637 Ga0501033_0003375
638 Ga0501033_0112282
639 Ga0501034_0023575
640 Ga0501034_0140099
641 Ga0501036_0024163
642 Ga0501036_0061806
643 Ga0501036_0142502
644 Ga0501037_0000865
645 Ga0501037_0590777
646 Ga0501038_0021979
647 Ga0501038_0028274
648 Ga0501038_0102811
649 Ga0501039_0005966
650 Ga0501039_0007290
651 Ga0501039_0055992
652 Ga0501040_0005262
653 Ga0501040_0010961
654 Ga0501040_0014951
655 Ga0501040_0033040
656 Ga0501041_0002475
657 Ga0501041_0008381
658 Ga0501042_0004053
659 Ga0501042_0007251
660 Ga0501042_0022773
661 Ga0501042_0642603
662 Ga0501043_0006017
663 Ga0501043_0145831
664 Ga0501043_0202584
665 Ga0501046_0000786
666 Ga0501046_0008252
667 Ga0501046_0173438
668 Ga0501046_0709878
669 Ga0501047_0157108
670 Ga0501048_0001705
671 Ga0501048_0042381
672 Ga0501048_0052775
673 Ga0501048_0088115
674 Ga0501067_0030485
675 Ga0501068_0009191
676 Ga0501068_0011066
677 Ga0501068_0121637
678 Ga0501069_0020192
679 Ga0501069_0028392
680 Ga0501070_0006669
681 Ga0501070_0140164
682 Ga0501071_0031661
683 Ga0501071_0048628
684 Ga0501071_0056179
685 Ga0501071_0061265
686 Ga0501071_1388007
687 Ga0501072_0009801
688 Ga0501072_0054718
689 Ga0501072_0055194
690 Ga0501072_0134104
691 Ga0501073_0048510
692 Ga0501073_0211424
693 Ga0501074_0016299
694 Ga0501074_0046305
695 Ga0501074_0091060
696 Ga0501075_0004222
697 Ga0501075_0020111
698 Ga0501075_0108849
699 Ga0501075_0126036
700 Ga0501076_0007230
701 Ga0501076_0014933
702 Ga0501076_0203400
703 Ga0501076_0276081
704 Ga0501076_0693003
705 Ga0501077_0017815
706 Ga0501077_0033016
707 Ga0501077_0169946
708 Ga0501077_0508416
709 Ga0501079_0009913
710 Ga0501079_0024980
711 Ga0501079_0033785
712 Ga0501079_0153064
713 Ga0501079_0655078
714 Ga0501080_0069443
715 Ga0501081_0002215
716 Ga0501081_0007819
717 Ga0501081_0011602
718 Ga0501081_0021420
719 Ga0501083_0000750
720 Ga0501083_0057373
721 Ga0501035_0001186
722 Ga0501035_0001297
723 Ga0501035_0076583
724 Ga0501044_0032082
725 Ga0501044_0087411
726 Ga0501045_0002382
727 Ga0501045_0010639
728 Ga0501045_0018404
729 Ga0501045_0029321
730 nmdc:mga05p37_677833_c1
731 nmdc:mga09592_392540_c1
732 nmdc:mga06r32_590966_c1
733 nmdc:mga08y16_247364_c1
734 nmdc:mga0n895_191428_c1
735 nmdc:mga0n895_250798_c1
736 Ga0495601_0683149
737 Ga0495601_0911823
738 Ga0495601_0924499
739 Ga0495595_0102778
740 Ga0495619_0582548
741 Ga0495619_1128404
742 Ga0501084_0010927
743 Ga0501084_0029568
744 Ga0501084_0100270
745 Ga0501082_0010368
746 Ga0501082_0031374
747 Ga0501082_0192207
748 Ga0501082_0244514
749 Ga0466962_0021863
750 Ga0466962_0054864
751 Ga0530510_0001091
752 Ga0530510_0010284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fck-assembly1.cif.gz_A-2 structure of a putative ribosomal-protein-serine acetyltransferase from vibrio cholerae. 0.7954 7 150
3fbu-assembly2.cif.gz_A the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.7887 13 148
3fbu-assembly2.cif.gz_B-2 the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.7816 13 148
3r96-assembly1.cif.gz_A crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp 0.7752 10 138
1nsl-assembly1.cif.gz_B crystal structure of probable acetyltransferase 0.7726 13 150
ID Description Score Start End Superfamily
2fckA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8311 7 150 3.40.630.30
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8183 14 150 3.40.630.30
3r9eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8156 9 144 3.40.630.30
3fbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7816 13 148 3.40.630.30
af_O05841_12_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7676 20 148 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A542YSG3-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9913 1 152
AF-A0A1G9DGP2-F1-model_v4 N-acetyltransferase domain-containing protein 0.9893 17 142 GO:0016747
AF-A0A7W9M1M4-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9848 1 152 GO:0016740
AF-A0A3N0CIP6-F1-model_v4 N-acetyltransferase 0.9826 3 150 GO:0016740
AF-A0A6G3SHP5-F1-model_v4 N-acetyltransferase 0.9824 1 150 GO:0016740

Map