F427345

General Info

Members Datasets Scaffolds Average Seq Length
376 188 752 125

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10322516|Ga0105242_103225162
Length 142
Sequence MKGLSLLFNYPYNLKTYGMKILVVDDETDIQTLFEQRFRKEIRDHSLEFAFAFSGEDALEYLNLHEHEAVLILSDINMPGMSGLELLGHIKQKYLKPPPVVMMITAYGDAENFNMAKQLGADDFLTKPVDFNLLKEKLKSIH

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
159 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
181 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
182 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 0.8
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10322516 3300009176 Bacteria 1417
2 JGI25406J46586_10001307 3300003203 Bacteria 11728
3 rootH2_10052178 3300003320 Bacteria 1751
4 rootH2_10063755 3300003320 Bacteria 2350
5 Ga0065704_10106367 3300005289 Bacteria 2085
6 Ga0065704_10323896 3300005289 Unclassified 826
7 Ga0065712_10278972 3300005290 Bacteria 900
8 Ga0065707_10179846 3300005295 Unclassified 1425
9 Ga0070658_10352272 3300005327 Bacteria 1260
10 Ga0070658_10909515 3300005327 Bacteria 765
11 Ga0070676_10561952 3300005328 Bacteria 818
12 Ga0070683_100162136 3300005329 Bacteria 2121
13 Ga0070683_100225585 3300005329 Bacteria 1780
14 Ga0070690_100270179 3300005330 Bacteria 1209
15 Ga0070690_100719321 3300005330 Unclassified 768
16 Ga0070690_101252219 3300005330 Bacteria 593
17 Ga0070670_100123100 3300005331 Bacteria 2237
18 Ga0070670_100137565 3300005331 Bacteria 2111
19 Ga0070670_100292910 3300005331 Bacteria 1423
20 Ga0070670_100338041 3300005331 Bacteria 1321
21 Ga0070670_101452685 3300005331 Bacteria 629
22 Ga0070677_10013065 3300005333 Bacteria 2895
23 Ga0068869_100036820 3300005334 Bacteria 3475
24 Ga0068869_101041111 3300005334 Bacteria 714
25 Ga0068869_101550953 3300005334 Bacteria 589
26 Ga0070666_10000044 3300005335 Bacteria 111020
27 Ga0070666_10872903 3300005335 Bacteria 664
28 Ga0070680_100329335 3300005336 Bacteria 1297
29 Ga0070682_100073374 3300005337 Bacteria 2195
30 Ga0068868_100007456 3300005338 Bacteria 7791
31 Ga0068868_100328582 3300005338 Bacteria 1304
32 Ga0070660_100022137 3300005339 Bacteria 4697
33 Ga0070687_100373269 3300005343 Bacteria 927
34 Ga0070661_100115689 3300005344 Bacteria 2005
35 Ga0070692_10438843 3300005345 Bacteria 833
36 Ga0070668_100128865 3300005347 Bacteria 2029
37 Ga0070668_100165901 3300005347 Bacteria 1795
38 Ga0070668_100438912 3300005347 Bacteria 1120
39 Ga0070668_100570174 3300005347 Bacteria 987
40 Ga0070668_100907044 3300005347 Bacteria 788
41 Ga0070668_101341281 3300005347 Bacteria 651
42 Ga0070669_100077392 3300005353 Bacteria 2471
43 Ga0070669_100703518 3300005353 Bacteria 853
44 Ga0070669_101917340 3300005353 Bacteria 517
45 Ga0070675_100043759 3300005354 Bacteria 3660
46 Ga0070675_100126002 3300005354 Bacteria 2179
47 Ga0070675_101378481 3300005354 Bacteria 650
48 Ga0070671_100032368 3300005355 Bacteria 4323
49 Ga0070671_100095721 3300005355 Bacteria 2489
50 Ga0070671_100173145 3300005355 Bacteria 1826
51 Ga0070671_100327671 3300005355 Bacteria 1305
52 Ga0070671_100404291 3300005355 Bacteria 1168
53 Ga0070671_100959565 3300005355 Bacteria 748
54 Ga0070671_102053820 3300005355 Bacteria 509
55 Ga0070674_100596640 3300005356 Unclassified 933
56 Ga0070673_100032891 3300005364 Bacteria 3910
57 Ga0070673_100104543 3300005364 Bacteria 2338
58 Ga0070673_100513823 3300005364 Bacteria 1085
59 Ga0070673_100851163 3300005364 Bacteria 844
60 Ga0070688_100213161 3300005365 Bacteria 1357
61 Ga0070688_100502322 3300005365 Bacteria 915
62 Ga0070688_100550952 3300005365 Bacteria 877
63 Ga0070688_101209061 3300005365 Bacteria 607
64 Ga0070659_100077847 3300005366 Bacteria 2645
65 Ga0070659_100141055 3300005366 Bacteria 1962
66 Ga0070667_100002513 3300005367 Bacteria 15999
67 Ga0070667_100734274 3300005367 Bacteria 915
68 Ga0070663_100167025 3300005455 Bacteria 1698
69 Ga0070678_100144583 3300005456 Bacteria 1907
70 Ga0070678_100201429 3300005456 Bacteria 1643
71 Ga0070678_100794530 3300005456 Bacteria 859
72 Ga0070678_102022409 3300005456 Unclassified 545
73 Ga0070662_100031721 3300005457 Bacteria 3711
74 Ga0070681_10050404 3300005458 Bacteria 4154
75 Ga0068867_100169254 3300005459 Bacteria 1729
76 Ga0068867_100240857 3300005459 Bacteria 1467
77 Ga0068867_100248574 3300005459 Bacteria 1445
78 Ga0068867_101158312 3300005459 Bacteria 708
79 Ga0070685_10042150 3300005466 Bacteria 2603
80 Ga0070685_11370199 3300005466 Bacteria 542
81 Ga0070679_100065836 3300005530 Bacteria 3612
82 Ga0070679_100287392 3300005530 Bacteria 1596
83 Ga0070684_100182855 3300005535 Bacteria 1906
84 Ga0070684_100794868 3300005535 Bacteria 884
85 Ga0068853_100091891 3300005539 Bacteria 2669
86 Ga0070672_100093601 3300005543 Bacteria 2428
87 Ga0070672_100142456 3300005543 Bacteria 1978
88 Ga0070672_100900891 3300005543 Bacteria 781
89 Ga0070672_101802824 3300005543 Bacteria 550
90 Ga0068855_100000732 3300005563 Bacteria 40298
91 Ga0068855_100164581 3300005563 Bacteria 2515
92 Ga0070664_100113515 3300005564 Bacteria 2366
93 Ga0068857_100059546 3300005577 Bacteria 3392
94 Ga0068857_100498183 3300005577 Unclassified 1143
95 Ga0068857_101283942 3300005577 Bacteria 710
96 Ga0068857_102043478 3300005577 Bacteria 562
97 Ga0068854_100193489 3300005578 Bacteria 1595
98 Ga0068854_101193704 3300005578 Bacteria 681
99 Ga0068856_100246523 3300005614 Bacteria 1802
100 Ga0068852_100096922 3300005616 Bacteria 2652
101 Ga0068852_100361912 3300005616 Bacteria 1419
102 Ga0068859_100000060 3300005617 Bacteria 113756
103 Ga0068859_100001975 3300005617 Bacteria 20936
104 Ga0068864_100001596 3300005618 Bacteria 18684
105 Ga0068864_100268293 3300005618 Bacteria 1590
106 Ga0068864_100726342 3300005618 Bacteria 972
107 Ga0068866_10796858 3300005718 Bacteria 656
108 Ga0068866_11014916 3300005718 Bacteria 590
109 Ga0068861_100191252 3300005719 Bacteria 1711
110 Ga0068861_100572782 3300005719 Bacteria 1032
111 Ga0068851_10025916 3300005834 Bacteria 2878
112 Ga0068851_10094794 3300005834 Bacteria 1576
113 Ga0068851_10341353 3300005834 Bacteria 869
114 Ga0068870_10487692 3300005840 Bacteria 819
115 Ga0068870_10719992 3300005840 Bacteria 690
116 Ga0068863_100016280 3300005841 Bacteria 7135
117 Ga0068863_100020337 3300005841 Bacteria 6347
118 Ga0068863_101903459 3300005841 Bacteria 605
119 Ga0068863_101957963 3300005841 Bacteria 596
120 Ga0068858_100002556 3300005842 Bacteria 18342
121 Ga0068858_100902507 3300005842 Bacteria 864
122 Ga0068860_100001813 3300005843 Bacteria 22732
123 Ga0068862_100828802 3300005844 Bacteria 905
124 Ga0081539_10000284 3300005985 Bacteria 114545
125 Ga0075366_10029011 3300006195 Bacteria 3249
126 Ga0097621_100055035 3300006237 Bacteria 3248
127 Ga0097621_100073882 3300006237 Bacteria 2823
128 Ga0097621_100395139 3300006237 Bacteria 1237
129 Ga0097621_100602160 3300006237 Bacteria 1004
130 Ga0097621_100788759 3300006237 Bacteria 880
131 Ga0097621_102426906 3300006237 Bacteria 502
132 Ga0068871_100005648 3300006358 Bacteria 8774
133 Ga0068871_100040996 3300006358 Bacteria 3711
134 Ga0068871_100255697 3300006358 Bacteria 1527
135 Ga0068871_100571934 3300006358 Bacteria 1025
136 Ga0068871_100667447 3300006358 Bacteria 950
137 Ga0068871_101306907 3300006358 Bacteria 682
138 Ga0068871_101901080 3300006358 Unclassified 566
139 Ga0075428_100332988 3300006844 Bacteria 1631
140 Ga0068865_100405789 3300006881 Bacteria 1117
141 Ga0068865_101666821 3300006881 Bacteria 574
142 Ga0097620_100000060 3300006931 Bacteria 113756
143 Ga0097620_100001975 3300006931 Bacteria 20936
144 Ga0075435_100555776 3300007076 Unclassified 994
145 Ga0111539_10611141 3300009094 Bacteria 1270
146 Ga0105245_10069235 3300009098 Bacteria 3199
147 Ga0105245_11055535 3300009098 Bacteria 858
148 Ga0105245_11784287 3300009098 Bacteria 668
149 Ga0105247_10004188 3300009101 Bacteria 9256
150 Ga0105247_10005352 3300009101 Bacteria 8089
151 Ga0105243_10347337 3300009148 Bacteria 1361
152 Ga0105241_10001266 3300009174 Bacteria 19291
153 Ga0105242_10057465 3300009176 Unclassified 3187
154 Ga0105242_10622511 3300009176 Bacteria 1046
155 Ga0105237_10003602 3300009545 Bacteria 18310
156 Ga0105249_10010466 3300009553 Bacteria 8151
157 Ga0105249_10023023 3300009553 Bacteria 5585
158 Ga0105249_11781249 3300009553 Bacteria 688
159 Ga0105239_10092579 3300010375 Bacteria 3337
160 Ga0105246_10157319 3300011119 Bacteria 1727
161 Ga0157373_10832546 3300013100 Bacteria 682
162 Ga0157371_10002222 3300013102 Bacteria 18778
163 Ga0157371_10030237 3300013102 Bacteria 3908
164 Ga0157371_10522166 3300013102 Bacteria 878
165 Ga0157370_10000252 3300013104 Bacteria 68083
166 Ga0157370_10006351 3300013104 Bacteria 13053
167 Ga0157370_11354558 3300013104 Bacteria 641
168 Ga0157369_10310606 3300013105 Bacteria 1639
169 Ga0157374_10028059 3300013296 Bacteria 5084
170 Ga0157374_10105083 3300013296 Bacteria 2711
171 Ga0157374_10132778 3300013296 Bacteria 2410
172 Ga0157374_10221863 3300013296 Bacteria 1855
173 Ga0157374_10249746 3300013296 Bacteria 1745
174 Ga0157374_11291337 3300013296 Bacteria 752
175 Ga0157378_10049240 3300013297 Bacteria 3748
176 Ga0157378_10057597 3300013297 Bacteria 3463
177 Ga0157378_10084700 3300013297 Bacteria 2871
178 Ga0157378_10239733 3300013297 Bacteria 1732
179 Ga0157378_10308694 3300013297 Bacteria 1533
180 Ga0157378_12474598 3300013297 Bacteria 571
181 Ga0163162_10000676 3300013306 Bacteria 31638
182 Ga0163162_10001875 3300013306 Bacteria 19790
183 Ga0163162_10020979 3300013306 Bacteria 6427
184 Ga0163162_10290786 3300013306 Bacteria 1766
185 Ga0157372_10013934 3300013307 Bacteria 8592
186 Ga0157372_10175357 3300013307 Bacteria 2481
187 Ga0157372_11412430 3300013307 Bacteria 802
188 Ga0157372_12005805 3300013307 Bacteria 665
189 Ga0157375_10370939 3300013308 Bacteria 1597
190 Ga0157375_10408055 3300013308 Bacteria 1525
191 Ga0157375_10487153 3300013308 Bacteria 1398
192 Ga0157375_11028411 3300013308 Bacteria 962
193 Ga0163163_11822623 3300014325 Unclassified 669
194 Ga0157380_10003975 3300014326 Bacteria 10204
195 Ga0157380_10152295 3300014326 Bacteria 2001
196 Ga0157380_10200740 3300014326 Bacteria 1769
197 Ga0157380_10300952 3300014326 Bacteria 1477
198 Ga0157380_10312274 3300014326 Bacteria 1453
199 Ga0157380_10356807 3300014326 Bacteria 1370
200 Ga0157380_13122545 3300014326 Bacteria 528
201 Ga0157379_10055081 3300014968 Bacteria 3553
202 Ga0157379_10456446 3300014968 Bacteria 1180
203 Ga0157379_11940874 3300014968 Bacteria 581
204 Ga0157376_10195202 3300014969 Bacteria 1859
205 Ga0157376_10600891 3300014969 Bacteria 1095
206 Ga0157376_10780200 3300014969 Bacteria 967
207 Ga0157376_12655695 3300014969 Unclassified 541
208 Ga0163161_10010153 3300017792 Bacteria 6518
209 Ga0163161_10160820 3300017792 Bacteria 1712
210 Ga0163161_10191861 3300017792 Unclassified 1571
211 Ga0163161_10324343 3300017792 Bacteria 1218
212 Ga0163161_10850777 3300017792 Unclassified 770
213 Ga0163161_10882564 3300017792 Bacteria 757
214 Ga0163161_11147088 3300017792 Bacteria 670
215 Ga0163161_11447189 3300017792 Bacteria 601
216 Ga0213876_10063707 3300021384 Bacteria 1946
217 Ga0207656_10171420 3300025321 Bacteria 1038
218 Ga0207656_10176660 3300025321 Bacteria 1023
219 Ga0207682_10044409 3300025893 Bacteria 1822
220 Ga0207642_10788458 3300025899 Bacteria 604
221 Ga0207710_10001117 3300025900 Bacteria 13680
222 Ga0207710_10134489 3300025900 Bacteria 1189
223 Ga0207680_10000214 3300025903 Bacteria 27910
224 Ga0207680_10599238 3300025903 Bacteria 788
225 Ga0207645_10267446 3300025907 Bacteria 1133
226 Ga0207643_10515827 3300025908 Bacteria 765
227 Ga0207705_10400814 3300025909 Bacteria 1061
228 Ga0207705_10913875 3300025909 Bacteria 680
229 Ga0207707_10113322 3300025912 Bacteria 2370
230 Ga0207707_11359150 3300025912 Bacteria 568
231 Ga0207671_10007281 3300025914 Bacteria 9626
232 Ga0207660_10242186 3300025917 Bacteria 1421
233 Ga0207660_10466890 3300025917 Unclassified 1022
234 Ga0207657_10002815 3300025919 Bacteria 18710
235 Ga0207649_10172679 3300025920 Bacteria 1507
236 Ga0207649_10897609 3300025920 Bacteria 695
237 Ga0207652_10246845 3300025921 Bacteria 1610
238 Ga0207652_10339381 3300025921 Bacteria 1356
239 Ga0207681_10195067 3300025923 Bacteria 1552
240 Ga0207650_10035793 3300025925 Bacteria 3608
241 Ga0207650_10154065 3300025925 Bacteria 1816
242 Ga0207650_10272661 3300025925 Bacteria 1375
243 Ga0207650_10305257 3300025925 Bacteria 1301
244 Ga0207650_10440399 3300025925 Bacteria 1083
245 Ga0207659_10287436 3300025926 Bacteria 1346
246 Ga0207659_10548140 3300025926 Bacteria 983
247 Ga0207644_10688455 3300025931 Bacteria 852
248 Ga0207644_10713259 3300025931 Bacteria 837
249 Ga0207644_10811224 3300025931 Bacteria 783
250 Ga0207644_11067180 3300025931 Bacteria 678
251 Ga0207644_11080250 3300025931 Bacteria 674
252 Ga0207690_10026496 3300025932 Bacteria 3650
253 Ga0207706_10003333 3300025933 Bacteria 15362
254 Ga0207686_10422882 3300025934 Bacteria 1019
255 Ga0207709_10675508 3300025935 Bacteria 824
256 Ga0207704_10303461 3300025938 Bacteria 1224
257 Ga0207704_10839976 3300025938 Bacteria 769
258 Ga0207691_10003925 3300025940 Bacteria 14448
259 Ga0207691_10195585 3300025940 Bacteria 1762
260 Ga0207691_10400829 3300025940 Bacteria 1170
261 Ga0207691_10406417 3300025940 Bacteria 1161
262 Ga0207691_11021716 3300025940 Bacteria 689
263 Ga0207689_10001732 3300025942 Bacteria 20608
264 Ga0207661_10207971 3300025944 Bacteria 1723
265 Ga0207679_10342642 3300025945 Bacteria 1300
266 Ga0207667_10096278 3300025949 Bacteria 3055
267 Ga0207667_10222960 3300025949 Bacteria 1931
268 Ga0207651_10108251 3300025960 Bacteria 2080
269 Ga0207651_10130905 3300025960 Bacteria 1920
270 Ga0207651_11050479 3300025960 Bacteria 729
271 Ga0207712_10061392 3300025961 Bacteria 2667
272 Ga0207668_10049564 3300025972 Bacteria 2888
273 Ga0207668_10111819 3300025972 Bacteria 2051
274 Ga0207668_10234641 3300025972 Bacteria 1481
275 Ga0207668_10358392 3300025972 Bacteria 1221
276 Ga0207640_10272537 3300025981 Bacteria 1325
277 Ga0207640_11575420 3300025981 Bacteria 591
278 Ga0207658_10031758 3300025986 Bacteria 3753
279 Ga0207658_11018512 3300025986 Bacteria 756
280 Ga0207658_11654647 3300025986 Bacteria 585
281 Ga0207677_10054015 3300026023 Bacteria 2739
282 Ga0207677_10188088 3300026023 Bacteria 1631
283 Ga0207703_10001715 3300026035 Bacteria 19686
284 Ga0207639_10032658 3300026041 Bacteria 3834
285 Ga0207702_10262886 3300026078 Bacteria 1625
286 Ga0207641_10000365 3300026088 Bacteria 53968
287 Ga0207641_10014598 3300026088 Bacteria 6440
288 Ga0207641_10396560 3300026088 Bacteria 1324
289 Ga0207641_12585088 3300026088 Bacteria 506
290 Ga0207648_10240825 3300026089 Bacteria 1611
291 Ga0207648_10271453 3300026089 Bacteria 1515
292 Ga0207648_10577784 3300026089 Bacteria 1034
293 Ga0207648_10643995 3300026089 Bacteria 979
294 Ga0207648_10682615 3300026089 Bacteria 951
295 Ga0207648_11020839 3300026089 Bacteria 775
296 Ga0207676_10013453 3300026095 Bacteria 5877
297 Ga0207676_10067403 3300026095 Bacteria 2859
298 Ga0207676_10673401 3300026095 Bacteria 1000
299 Ga0207674_10142602 3300026116 Bacteria 2355
300 Ga0207674_11208390 3300026116 Bacteria 726
301 Ga0207674_12273818 3300026116 Unclassified 505
302 Ga0207675_100212733 3300026118 Unclassified 1860
303 Ga0207683_10116708 3300026121 Bacteria 2393
304 Ga0207683_10643998 3300026121 Bacteria 982
305 Ga0207683_10945121 3300026121 Bacteria 800
306 Ga0207683_11724505 3300026121 Unclassified 576
307 Ga0207698_10114129 3300026142 Bacteria 2272
308 Ga0207698_10284030 3300026142 Bacteria 1532
309 Ga0207698_10317464 3300026142 Bacteria 1458
310 Ga0207698_11525916 3300026142 Bacteria 683
311 Ga0209968_1107630 3300027526 Bacteria 510
312 Ga0268266_10877674 3300028379 Bacteria 867
313 Ga0268264_10001639 3300028381 Bacteria 20666
314 Ga0265334_10106691 3300028573 Bacteria 1009
315 Ga0307515_10000001 3300028794 Bacteria 4259510
316 Ga0307515_10000190 3300028794 Bacteria 150300
317 Ga0307515_10670540 3300028794 Bacteria 651
318 Ga0265327_10000013 3300031251 Bacteria 519549
319 Ga0265327_10033061 3300031251 Bacteria 2887
320 Ga0307509_10129778 3300031507 Bacteria 2479
321 Ga0307405_10152930 3300031731 Bacteria 1625
322 Ga0307413_10143976 3300031824 Bacteria 1651
323 Ga0307412_10089451 3300031911 Bacteria 2150
324 Ga0307416_100023502 3300032002 Bacteria 4475
325 Ga0307414_10218934 3300032004 Bacteria 1562
326 Ga0307415_100008767 3300032126 Bacteria 5629
327 Ga0395899_0055864 3300037312 Bacteria 2919
328 Ga0395900_0065849 3300037418 Bacteria 3722
329 Ga0395898_0006045 3300037466 Bacteria 12994
330 Ga0395905_1234115 3300037471 Unclassified 651
331 Ga0395901_0006717 3300038443 Bacteria 11625
332 Ga0436365_1874674 3300039437 Bacteria 58580
333 Ga0439436_0130926 3300041404 Bacteria 703
334 Ga0439439_0036724 3300041406 Bacteria 1261
335 Ga0439465_0064923 3300041413 Bacteria 1215
336 Ga0451787_182273 3300041441 Bacteria 601
337 Ga0451793_0593802 3300041452 Unclassified 608
338 Ga0451807_0451910 3300041486 Bacteria 677
339 Ga0451847_0549744 3300041503 Unclassified 614
340 Ga0451843_1097244 3300041509 Bacteria 561
341 Ga0451853_1574119 3300041512 Bacteria 988
342 Ga0439442_011882 3300042002 Bacteria 1777
343 Ga0439449_0163117 3300042007 Bacteria 832
344 Ga0439462_0107505 3300042015 Bacteria 771
345 Ga0450897_001213 3300042128 Bacteria 1701
346 Ga0439446_0138041 3300042156 Bacteria 795
347 Ga0439434_0013510 3300042435 Bacteria 2425
348 Ga0451577_0041295 3300042876 Bacteria 4140
349 Ga0451577_0164265 3300042876 Bacteria 2000
350 Ga0453683_0015737 3300044673 Bacteria 4892
351 Ga0453684_0068920 3300044712 Bacteria 4489
352 Ga0453684_0248025 3300044712 Bacteria 2046
353 Ga0453684_1279702 3300044712 Bacteria 766
354 Ga0451576_0816779 3300045051 Bacteria 979
355 Ga0466967_0009108 3300045976 Bacteria 7342
356 Ga0466967_0220521 3300045976 Bacteria 1802
357 Ga0495650_0125095 3300046471 Bacteria 943
358 Ga0495650_0332633 3300046471 Bacteria 504
359 Ga0495606_0012935 3300046507 Bacteria 6642
360 Ga0495616_0065913 3300046513 Bacteria 1763
361 Ga0495643_0000538 3300046522 Bacteria 47114
362 Ga0495643_0038522 3300046522 Bacteria 2618
363 Ga0495625_0008321 3300046660 Bacteria 8860
364 Ga0495672_0071495 3300047320 Bacteria 1963
365 Ga0495672_0214060 3300047320 Bacteria 955
366 Ga0495686_0003981 3300047472 Bacteria 12369
367 Ga0501039_0956002 3300049575 Bacteria 666
368 Ga0501245_028329 3300049708 Bacteria 913
369 Ga0501273_018108 3300049770 Bacteria 935
370 Ga0501283_073194 3300049779 Bacteria 634
371 nmdc:mga0k408_265055_c1 3300050493 Bacteria 1026
372 nmdc:mga0qj67_297354_c1 3300050509 Bacteria 1308
373 nmdc:mga08y16_939753_c1 3300050511 Unclassified 848
374 nmdc:mga0rr50_515267_c1 3300050513 Unclassified 1017
375 Ga0500646_0050887 3300053090 Bacteria 1195
376 Ga0500622_0232849 3300053156 Unclassified 819
377 Ga0105242_10322516
378 JGI25406J46586_10001307
379 rootH2_10052178
380 rootH2_10063755
381 Ga0065704_10106367
382 Ga0065704_10323896
383 Ga0065712_10278972
384 Ga0065707_10179846
385 Ga0070658_10352272
386 Ga0070658_10909515
387 Ga0070676_10561952
388 Ga0070683_100162136
389 Ga0070683_100225585
390 Ga0070690_100270179
391 Ga0070690_100719321
392 Ga0070690_101252219
393 Ga0070670_100123100
394 Ga0070670_100137565
395 Ga0070670_100292910
396 Ga0070670_100338041
397 Ga0070670_101452685
398 Ga0070677_10013065
399 Ga0068869_100036820
400 Ga0068869_101041111
401 Ga0068869_101550953
402 Ga0070666_10000044
403 Ga0070666_10872903
404 Ga0070680_100329335
405 Ga0070682_100073374
406 Ga0068868_100007456
407 Ga0068868_100328582
408 Ga0070660_100022137
409 Ga0070687_100373269
410 Ga0070661_100115689
411 Ga0070692_10438843
412 Ga0070668_100128865
413 Ga0070668_100165901
414 Ga0070668_100438912
415 Ga0070668_100570174
416 Ga0070668_100907044
417 Ga0070668_101341281
418 Ga0070669_100077392
419 Ga0070669_100703518
420 Ga0070669_101917340
421 Ga0070675_100043759
422 Ga0070675_100126002
423 Ga0070675_101378481
424 Ga0070671_100032368
425 Ga0070671_100095721
426 Ga0070671_100173145
427 Ga0070671_100327671
428 Ga0070671_100404291
429 Ga0070671_100959565
430 Ga0070671_102053820
431 Ga0070674_100596640
432 Ga0070673_100032891
433 Ga0070673_100104543
434 Ga0070673_100513823
435 Ga0070673_100851163
436 Ga0070688_100213161
437 Ga0070688_100502322
438 Ga0070688_100550952
439 Ga0070688_101209061
440 Ga0070659_100077847
441 Ga0070659_100141055
442 Ga0070667_100002513
443 Ga0070667_100734274
444 Ga0070663_100167025
445 Ga0070678_100144583
446 Ga0070678_100201429
447 Ga0070678_100794530
448 Ga0070678_102022409
449 Ga0070662_100031721
450 Ga0070681_10050404
451 Ga0068867_100169254
452 Ga0068867_100240857
453 Ga0068867_100248574
454 Ga0068867_101158312
455 Ga0070685_10042150
456 Ga0070685_11370199
457 Ga0070679_100065836
458 Ga0070679_100287392
459 Ga0070684_100182855
460 Ga0070684_100794868
461 Ga0068853_100091891
462 Ga0070672_100093601
463 Ga0070672_100142456
464 Ga0070672_100900891
465 Ga0070672_101802824
466 Ga0068855_100000732
467 Ga0068855_100164581
468 Ga0070664_100113515
469 Ga0068857_100059546
470 Ga0068857_100498183
471 Ga0068857_101283942
472 Ga0068857_102043478
473 Ga0068854_100193489
474 Ga0068854_101193704
475 Ga0068856_100246523
476 Ga0068852_100096922
477 Ga0068852_100361912
478 Ga0068859_100000060
479 Ga0068859_100001975
480 Ga0068864_100001596
481 Ga0068864_100268293
482 Ga0068864_100726342
483 Ga0068866_10796858
484 Ga0068866_11014916
485 Ga0068861_100191252
486 Ga0068861_100572782
487 Ga0068851_10025916
488 Ga0068851_10094794
489 Ga0068851_10341353
490 Ga0068870_10487692
491 Ga0068870_10719992
492 Ga0068863_100016280
493 Ga0068863_100020337
494 Ga0068863_101903459
495 Ga0068863_101957963
496 Ga0068858_100002556
497 Ga0068858_100902507
498 Ga0068860_100001813
499 Ga0068862_100828802
500 Ga0081539_10000284
501 Ga0075366_10029011
502 Ga0097621_100055035
503 Ga0097621_100073882
504 Ga0097621_100395139
505 Ga0097621_100602160
506 Ga0097621_100788759
507 Ga0097621_102426906
508 Ga0068871_100005648
509 Ga0068871_100040996
510 Ga0068871_100255697
511 Ga0068871_100571934
512 Ga0068871_100667447
513 Ga0068871_101306907
514 Ga0068871_101901080
515 Ga0075428_100332988
516 Ga0068865_100405789
517 Ga0068865_101666821
518 Ga0097620_100000060
519 Ga0097620_100001975
520 Ga0075435_100555776
521 Ga0111539_10611141
522 Ga0105245_10069235
523 Ga0105245_11055535
524 Ga0105245_11784287
525 Ga0105247_10004188
526 Ga0105247_10005352
527 Ga0105243_10347337
528 Ga0105241_10001266
529 Ga0105242_10057465
530 Ga0105242_10622511
531 Ga0105237_10003602
532 Ga0105249_10010466
533 Ga0105249_10023023
534 Ga0105249_11781249
535 Ga0105239_10092579
536 Ga0105246_10157319
537 Ga0157373_10832546
538 Ga0157371_10002222
539 Ga0157371_10030237
540 Ga0157371_10522166
541 Ga0157370_10000252
542 Ga0157370_10006351
543 Ga0157370_11354558
544 Ga0157369_10310606
545 Ga0157374_10028059
546 Ga0157374_10105083
547 Ga0157374_10132778
548 Ga0157374_10221863
549 Ga0157374_10249746
550 Ga0157374_11291337
551 Ga0157378_10049240
552 Ga0157378_10057597
553 Ga0157378_10084700
554 Ga0157378_10239733
555 Ga0157378_10308694
556 Ga0157378_12474598
557 Ga0163162_10000676
558 Ga0163162_10001875
559 Ga0163162_10020979
560 Ga0163162_10290786
561 Ga0157372_10013934
562 Ga0157372_10175357
563 Ga0157372_11412430
564 Ga0157372_12005805
565 Ga0157375_10370939
566 Ga0157375_10408055
567 Ga0157375_10487153
568 Ga0157375_11028411
569 Ga0163163_11822623
570 Ga0157380_10003975
571 Ga0157380_10152295
572 Ga0157380_10200740
573 Ga0157380_10300952
574 Ga0157380_10312274
575 Ga0157380_10356807
576 Ga0157380_13122545
577 Ga0157379_10055081
578 Ga0157379_10456446
579 Ga0157379_11940874
580 Ga0157376_10195202
581 Ga0157376_10600891
582 Ga0157376_10780200
583 Ga0157376_12655695
584 Ga0163161_10010153
585 Ga0163161_10160820
586 Ga0163161_10191861
587 Ga0163161_10324343
588 Ga0163161_10850777
589 Ga0163161_10882564
590 Ga0163161_11147088
591 Ga0163161_11447189
592 Ga0213876_10063707
593 Ga0207656_10171420
594 Ga0207656_10176660
595 Ga0207682_10044409
596 Ga0207642_10788458
597 Ga0207710_10001117
598 Ga0207710_10134489
599 Ga0207680_10000214
600 Ga0207680_10599238
601 Ga0207645_10267446
602 Ga0207643_10515827
603 Ga0207705_10400814
604 Ga0207705_10913875
605 Ga0207707_10113322
606 Ga0207707_11359150
607 Ga0207671_10007281
608 Ga0207660_10242186
609 Ga0207660_10466890
610 Ga0207657_10002815
611 Ga0207649_10172679
612 Ga0207649_10897609
613 Ga0207652_10246845
614 Ga0207652_10339381
615 Ga0207681_10195067
616 Ga0207650_10035793
617 Ga0207650_10154065
618 Ga0207650_10272661
619 Ga0207650_10305257
620 Ga0207650_10440399
621 Ga0207659_10287436
622 Ga0207659_10548140
623 Ga0207644_10688455
624 Ga0207644_10713259
625 Ga0207644_10811224
626 Ga0207644_11067180
627 Ga0207644_11080250
628 Ga0207690_10026496
629 Ga0207706_10003333
630 Ga0207686_10422882
631 Ga0207709_10675508
632 Ga0207704_10303461
633 Ga0207704_10839976
634 Ga0207691_10003925
635 Ga0207691_10195585
636 Ga0207691_10400829
637 Ga0207691_10406417
638 Ga0207691_11021716
639 Ga0207689_10001732
640 Ga0207661_10207971
641 Ga0207679_10342642
642 Ga0207667_10096278
643 Ga0207667_10222960
644 Ga0207651_10108251
645 Ga0207651_10130905
646 Ga0207651_11050479
647 Ga0207712_10061392
648 Ga0207668_10049564
649 Ga0207668_10111819
650 Ga0207668_10234641
651 Ga0207668_10358392
652 Ga0207640_10272537
653 Ga0207640_11575420
654 Ga0207658_10031758
655 Ga0207658_11018512
656 Ga0207658_11654647
657 Ga0207677_10054015
658 Ga0207677_10188088
659 Ga0207703_10001715
660 Ga0207639_10032658
661 Ga0207702_10262886
662 Ga0207641_10000365
663 Ga0207641_10014598
664 Ga0207641_10396560
665 Ga0207641_12585088
666 Ga0207648_10240825
667 Ga0207648_10271453
668 Ga0207648_10577784
669 Ga0207648_10643995
670 Ga0207648_10682615
671 Ga0207648_11020839
672 Ga0207676_10013453
673 Ga0207676_10067403
674 Ga0207676_10673401
675 Ga0207674_10142602
676 Ga0207674_11208390
677 Ga0207674_12273818
678 Ga0207675_100212733
679 Ga0207683_10116708
680 Ga0207683_10643998
681 Ga0207683_10945121
682 Ga0207683_11724505
683 Ga0207698_10114129
684 Ga0207698_10284030
685 Ga0207698_10317464
686 Ga0207698_11525916
687 Ga0209968_1107630
688 Ga0268266_10877674
689 Ga0268264_10001639
690 Ga0265334_10106691
691 Ga0307515_10000001
692 Ga0307515_10000190
693 Ga0307515_10670540
694 Ga0265327_10000013
695 Ga0265327_10033061
696 Ga0307509_10129778
697 Ga0307405_10152930
698 Ga0307413_10143976
699 Ga0307412_10089451
700 Ga0307416_100023502
701 Ga0307414_10218934
702 Ga0307415_100008767
703 Ga0395899_0055864
704 Ga0395900_0065849
705 Ga0395898_0006045
706 Ga0395905_1234115
707 Ga0395901_0006717
708 Ga0436365_1874674
709 Ga0439436_0130926
710 Ga0439439_0036724
711 Ga0439465_0064923
712 Ga0451787_182273
713 Ga0451793_0593802
714 Ga0451807_0451910
715 Ga0451847_0549744
716 Ga0451843_1097244
717 Ga0451853_1574119
718 Ga0439442_011882
719 Ga0439449_0163117
720 Ga0439462_0107505
721 Ga0450897_001213
722 Ga0439446_0138041
723 Ga0439434_0013510
724 Ga0451577_0041295
725 Ga0451577_0164265
726 Ga0453683_0015737
727 Ga0453684_0068920
728 Ga0453684_0248025
729 Ga0453684_1279702
730 Ga0451576_0816779
731 Ga0466967_0009108
732 Ga0466967_0220521
733 Ga0495650_0125095
734 Ga0495650_0332633
735 Ga0495606_0012935
736 Ga0495616_0065913
737 Ga0495643_0000538
738 Ga0495643_0038522
739 Ga0495625_0008321
740 Ga0495672_0071495
741 Ga0495672_0214060
742 Ga0495686_0003981
743 Ga0501039_0956002
744 Ga0501245_028329
745 Ga0501273_018108
746 Ga0501283_073194
747 nmdc:mga0k408_265055_c1
748 nmdc:mga0qj67_297354_c1
749 nmdc:mga08y16_939753_c1
750 nmdc:mga0rr50_515267_c1
751 Ga0500646_0050887
752 Ga0500622_0232849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

21

139

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wb4-assembly1.cif.gz_B activated diguanylate cyclase pled in complex with c-di-gmp 0.9241 2 123
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9154 2 123
1xhf-assembly1.cif.gz_A crystal structure of the bef3-activated receiver domain of redox response regulator arca 0.9139 2 122
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9134 2 123
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9116 1 123
ID Description Score Start End Superfamily
2wb4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9241 2 123 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9189 2 123 3.40.50.2300
1xhfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9154 2 123 3.40.50.2300
2v0nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9082 2 123 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9061 2 123 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2A4T3L2-F1-model_v4 Response regulator 0.9584 1 123 GO:0000160
AF-A0A1Y5FDA8-F1-model_v4 Response regulatory domain-containing protein 0.9541 1 122 GO:0000160
AF-A0A2A4T3L2-F1-model_v4 Response regulator 0.9433 1 123 GO:0000160
AF-A0A7Y4T0B2-F1-model_v4 Response regulator 0.932 2 124 GO:0000160
AF-A0A1Y5FDA8-F1-model_v4 Response regulatory domain-containing protein 0.9317 1 122 GO:0000160

Map