F427344

General Info

Members Datasets Scaffolds Average Seq Length
376 222 752 146

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10294369|Ga0105242_102943692
Length 171
Sequence MVLLLSRFASYTARASAVPAGGDLYAPNMALVGMNHVALEVGSIDEALAFWEKLFGPLRLRGRSGAMAFVDMGDQFVALMRATGGAPDAHRHVGIVVDDKEAVRSAAVAAGIEVSRPPSLDLRDPWGNLLQVVDYREIQFTKTPEILAGMGLAGLEKTDAALAELRAKGLA

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
154 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 2.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 5.59
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10294369 3300009176 Bacteria 1479
2 JGI24743J22301_10036986 3300001991 Bacteria 972
3 JGI24744J21845_10015826 3300002077 Bacteria 1504
4 JGI25406J46586_10015794 3300003203 Bacteria 3170
5 Ga0070658_10074870 3300005327 Bacteria 2776
6 Ga0070676_10342528 3300005328 Bacteria 1026
7 Ga0070683_100006174 3300005329 Bacteria 10049
8 Ga0070683_100421268 3300005329 Unclassified 1274
9 Ga0070677_10098095 3300005333 Bacteria 1287
10 Ga0068869_100087311 3300005334 Bacteria 2339
11 Ga0070680_100008164 3300005336 Bacteria 7999
12 Ga0070680_100560457 3300005336 Bacteria 979
13 Ga0070680_100570013 3300005336 Bacteria 971
14 Ga0070682_100209783 3300005337 Bacteria 1379
15 Ga0068868_100584661 3300005338 Bacteria 987
16 Ga0070660_100153138 3300005339 Bacteria 1855
17 Ga0070660_100273951 3300005339 Bacteria 1380
18 Ga0070689_100053861 3300005340 Bacteria 3114
19 Ga0070661_100104770 3300005344 Bacteria 2107
20 Ga0070692_10044565 3300005345 Bacteria 2285
21 Ga0070668_100187728 3300005347 Bacteria 1691
22 Ga0070675_100657146 3300005354 Bacteria 953
23 Ga0070671_100039637 3300005355 Bacteria 3910
24 Ga0070674_100041887 3300005356 Bacteria 3107
25 Ga0070674_100094520 3300005356 Bacteria 2165
26 Ga0070673_100003902 3300005364 Bacteria 9369
27 Ga0070688_100342824 3300005365 Unclassified 1092
28 Ga0070714_100319547 3300005435 Bacteria 1451
29 Ga0070701_10004228 3300005438 Bacteria 5784
30 Ga0070700_100020653 3300005441 Bacteria 3819
31 Ga0070700_100090735 3300005441 Bacteria 1993
32 Ga0070663_100031783 3300005455 Bacteria 3631
33 Ga0070678_100111481 3300005456 Bacteria 2141
34 Ga0070678_100488671 3300005456 Bacteria 1084
35 Ga0070678_100523957 3300005456 Bacteria 1049
36 Ga0070662_100176865 3300005457 Bacteria 1680
37 Ga0070681_10013627 3300005458 Bacteria 8089
38 Ga0068867_100100446 3300005459 Bacteria 2209
39 Ga0070685_10007298 3300005466 Bacteria 5653
40 Ga0070685_10051803 3300005466 Bacteria 2374
41 Ga0070685_10780575 3300005466 Bacteria 703
42 Ga0070679_100197647 3300005530 Bacteria 1978
43 Ga0070684_100009137 3300005535 Bacteria 7794
44 Ga0070684_100245587 3300005535 Bacteria 1636
45 Ga0068853_100093855 3300005539 Bacteria 2642
46 Ga0070672_100048012 3300005543 Bacteria 3315
47 Ga0070686_100022149 3300005544 Bacteria 3782
48 Ga0070695_100791494 3300005545 Bacteria 759
49 Ga0070696_100255201 3300005546 Bacteria 1327
50 Ga0070665_100019660 3300005548 Bacteria 6779
51 Ga0070665_100130761 3300005548 Bacteria 2513
52 Ga0070704_100056096 3300005549 Bacteria 2796
53 Ga0068855_100017572 3300005563 Bacteria 8601
54 Ga0068855_100269259 3300005563 Bacteria 1895
55 Ga0070664_100204394 3300005564 Bacteria 1763
56 Ga0068854_100616207 3300005578 Bacteria 928
57 Ga0070702_100046106 3300005615 Bacteria 2469
58 Ga0068859_100071134 3300005617 Bacteria 3514
59 Ga0068864_100044536 3300005618 Bacteria 3804
60 Ga0068864_100470372 3300005618 Unclassified 1205
61 Ga0068861_100677711 3300005719 Bacteria 955
62 Ga0068870_10063977 3300005840 Bacteria 1985
63 Ga0068863_100145238 3300005841 Bacteria 2269
64 Ga0068860_100050426 3300005843 Bacteria 3963
65 Ga0068860_100094624 3300005843 Bacteria 2847
66 Ga0081539_10000154 3300005985 Bacteria 159703
67 Ga0075365_10308001 3300006038 Archaea 1115
68 Ga0097621_100469661 3300006237 Bacteria 1136
69 Ga0075428_100057735 3300006844 Bacteria 4248
70 Ga0075430_100045021 3300006846 Bacteria 3730
71 Ga0075433_10009724 3300006852 Bacteria 7702
72 Ga0075434_100003918 3300006871 Bacteria 13330
73 Ga0075429_100273977 3300006880 Bacteria 1478
74 Ga0068865_100026818 3300006881 Bacteria 3801
75 Ga0075436_100088184 3300006914 Bacteria 2155
76 Ga0097620_100071136 3300006931 Bacteria 3514
77 Ga0075435_100025524 3300007076 Bacteria 4601
78 Ga0105240_10805269 3300009093 Bacteria 1017
79 Ga0111539_10032436 3300009094 Bacteria 6342
80 Ga0111539_10110914 3300009094 Bacteria 3219
81 Ga0111539_10708314 3300009094 Bacteria 1172
82 Ga0111539_10999822 3300009094 Bacteria 972
83 Ga0105247_10059931 3300009101 Bacteria 2357
84 Ga0114129_10064885 3300009147 Bacteria 5096
85 Ga0114129_10148769 3300009147 Bacteria 3206
86 Ga0105243_11225161 3300009148 Bacteria 765
87 Ga0105242_10122280 3300009176 Bacteria 2236
88 Ga0105242_12058029 3300009176 Bacteria 614
89 Ga0105248_10022124 3300009177 Bacteria 7046
90 Ga0105248_10100227 3300009177 Bacteria 3264
91 Ga0105238_11211371 3300009551 Archaea 779
92 Ga0105249_10483099 3300009553 Bacteria 1282
93 Ga0105239_10086796 3300010375 Bacteria 3449
94 Ga0105239_10193255 3300010375 Bacteria 2278
95 Ga0105246_10193724 3300011119 Bacteria 1575
96 Ga0157373_10152860 3300013100 Bacteria 1623
97 Ga0157373_10352160 3300013100 Bacteria 1050
98 Ga0157371_10050232 3300013102 Bacteria 2963
99 Ga0157371_11191953 3300013102 Archaea 587
100 Ga0157370_10165712 3300013104 Bacteria 2055
101 Ga0157378_10070529 3300013297 Bacteria 3138
102 Ga0163162_10230515 3300013306 Bacteria 1982
103 Ga0163162_10266027 3300013306 Bacteria 1846
104 Ga0163162_10641945 3300013306 Bacteria 1186
105 Ga0157372_10094386 3300013307 Bacteria 3406
106 Ga0157372_10729363 3300013307 Bacteria 1152
107 Ga0157372_11378873 3300013307 Bacteria 813
108 Ga0157375_10362914 3300013308 Bacteria 1615
109 Ga0157375_10661178 3300013308 Bacteria 1200
110 Ga0157375_13118887 3300013308 Bacteria 553
111 Ga0163163_10019989 3300014325 Bacteria 6300
112 Ga0157380_10020125 3300014326 Bacteria 4984
113 Ga0157380_10110012 3300014326 Bacteria 2313
114 Ga0157380_10170165 3300014326 Bacteria 1903
115 Ga0157377_10185108 3300014745 Bacteria 1312
116 Ga0157379_10060486 3300014968 Bacteria 3386
117 Ga0157379_10344985 3300014968 Bacteria 1362
118 Ga0157376_10176376 3300014969 Bacteria 1950
119 Ga0163161_10073001 3300017792 Bacteria 2514
120 Ga0197907_10138244 3300020069 Bacteria 1085
121 Ga0197907_10884300 3300020069 Unclassified 1053
122 Ga0206356_11035828 3300020070 Bacteria 1804
123 Ga0206350_10354121 3300020080 Bacteria 588
124 Ga0206350_10763354 3300020080 Bacteria 1385
125 Ga0206354_10663973 3300020081 Bacteria 2417
126 Ga0206354_11303673 3300020081 Bacteria 2124
127 Ga0206353_10286978 3300020082 Bacteria 2722
128 Ga0213871_10078717 3300021441 Bacteria 941
129 Ga0224712_10082538 3300022467 Bacteria 1330
130 Ga0207682_10012303 3300025893 Bacteria 3342
131 Ga0207682_10149275 3300025893 Bacteria 1053
132 Ga0207710_10060854 3300025900 Bacteria 1713
133 Ga0207688_10012687 3300025901 Bacteria 4586
134 Ga0207647_10021675 3300025904 Bacteria 4284
135 Ga0207645_10037764 3300025907 Bacteria 3099
136 Ga0207643_10073666 3300025908 Bacteria 1969
137 Ga0207643_10157109 3300025908 Bacteria 1366
138 Ga0207705_10181611 3300025909 Bacteria 1588
139 Ga0207707_10116885 3300025912 Bacteria 2331
140 Ga0207660_10054640 3300025917 Bacteria 2851
141 Ga0207660_10159709 3300025917 Bacteria 1738
142 Ga0207662_10015119 3300025918 Bacteria 4338
143 Ga0207657_10085881 3300025919 Bacteria 2635
144 Ga0207657_10243038 3300025919 Bacteria 1437
145 Ga0207652_10359962 3300025921 Bacteria 1313
146 Ga0207646_10496609 3300025922 Bacteria 1100
147 Ga0207650_10030362 3300025925 Bacteria 3892
148 Ga0207659_10729556 3300025926 Bacteria 849
149 Ga0207687_10232864 3300025927 Bacteria 1456
150 Ga0207687_10283326 3300025927 Bacteria 1329
151 Ga0207644_10774703 3300025931 Bacteria 802
152 Ga0207706_10098457 3300025933 Bacteria 2572
153 Ga0207706_10450276 3300025933 Bacteria 1113
154 Ga0207686_10100345 3300025934 Bacteria 1931
155 Ga0207709_10051387 3300025935 Bacteria 2527
156 Ga0207709_10127796 3300025935 Bacteria 1727
157 Ga0207670_10386192 3300025936 Bacteria 1116
158 Ga0207670_10719708 3300025936 Bacteria 827
159 Ga0207704_10443112 3300025938 Bacteria 1035
160 Ga0207691_10027612 3300025940 Bacteria 5321
161 Ga0207691_10092695 3300025940 Bacteria 2705
162 Ga0207711_10319113 3300025941 Unclassified 1435
163 Ga0207689_10088319 3300025942 Bacteria 2547
164 Ga0207661_10006459 3300025944 Bacteria 8291
165 Ga0207661_10153830 3300025944 Bacteria 1990
166 Ga0207661_10265946 3300025944 Unclassified 1529
167 Ga0207661_10487629 3300025944 Bacteria 1125
168 Ga0207667_10880425 3300025949 Bacteria 888
169 Ga0207651_10156608 3300025960 Bacteria 1780
170 Ga0207668_10507445 3300025972 Bacteria 1038
171 Ga0207658_10128552 3300025986 Bacteria 2032
172 Ga0207677_10113974 3300026023 Bacteria 2019
173 Ga0207639_10371964 3300026041 Bacteria 1281
174 Ga0207639_11029081 3300026041 Unclassified 772
175 Ga0207678_10064545 3300026067 Bacteria 3146
176 Ga0207708_10055840 3300026075 Bacteria 3011
177 Ga0207708_10102285 3300026075 Bacteria 2218
178 Ga0207641_11391778 3300026088 Bacteria 702
179 Ga0207648_10099579 3300026089 Bacteria 2546
180 Ga0207648_10304130 3300026089 Bacteria 1431
181 Ga0207648_10869242 3300026089 Bacteria 841
182 Ga0207676_10650443 3300026095 Unclassified 1017
183 Ga0207674_10080924 3300026116 Bacteria 3251
184 Ga0207675_100073723 3300026118 Bacteria 3194
185 Ga0207683_10261234 3300026121 Bacteria 1581
186 Ga0207683_10558384 3300026121 Bacteria 1059
187 Ga0207698_10560372 3300026142 Bacteria 1121
188 Ga0207428_10173825 3300027907 Bacteria 1630
189 Ga0268266_10419451 3300028379 Bacteria 1268
190 Ga0268265_10120039 3300028380 Bacteria 2164
191 Ga0268264_10182024 3300028381 Bacteria 1909
192 Ga0307409_100105227 3300031995 Bacteria 2352
193 Ga0307409_100384262 3300031995 Bacteria 1336
194 Ga0307409_101552632 3300031995 Bacteria 690
195 Ga0307409_101626647 3300031995 Bacteria 674
196 Ga0307414_11750045 3300032004 Bacteria 580
197 Ga0307415_100027835 3300032126 Bacteria 3587
198 Ga0307415_100077960 3300032126 Bacteria 2355
199 Ga0373951_0019514 3300035091 Bacteria 1546
200 Ga0373941_0140185 3300035115 Bacteria 879
201 Ga0373961_0038697 3300035241 Bacteria 1367
202 Ga0373962_0037124 3300035242 Bacteria 1359
203 Ga0373931_0324984 3300035691 Bacteria 956
204 Ga0395899_0027667 3300037312 Bacteria 4272
205 Ga0395899_0495991 3300037312 Unclassified 793
206 Ga0395900_0033250 3300037418 Bacteria 5308
207 Ga0395900_0034279 3300037418 Bacteria 5226
208 Ga0395900_1909910 3300037418 Unclassified 504
209 Ga0395898_0013295 3300037466 Bacteria 8477
210 Ga0395898_0022802 3300037466 Bacteria 6334
211 Ga0395898_0158917 3300037466 Bacteria 2162
212 Ga0395905_0006445 3300037471 Bacteria 11816
213 Ga0395905_0856057 3300037471 Archaea 812
214 Ga0395905_1010379 3300037471 Bacteria 735
215 Ga0395901_0021853 3300038443 Bacteria 6556
216 Ga0395901_0082367 3300038443 Bacteria 3362
217 Ga0395901_0240576 3300038443 Bacteria 1888
218 Ga0436365_1515776 3300039437 Archaea 663
219 Ga0436360_0664656 3300039438 Bacteria 3916
220 Ga0439461_0034715 3300041410 Bacteria 1067
221 Ga0450906_012582 3300042145 Bacteria 1567
222 Ga0466972_0205227 3300044658 Bacteria 923
223 Ga0466964_0026575 3300044706 Unclassified 2267
224 Ga0466964_0781745 3300044706 Unclassified 538
225 Ga0466960_0075128 3300044901 Bacteria 1690
226 Ga0466960_0170379 3300044901 Archaea 1175
227 Ga0466967_0002181 3300045976 Bacteria 12048
228 Ga0466967_0911562 3300045976 Bacteria 874
229 Ga0495582_0450594 3300046473 Bacteria 743
230 Ga0495584_0471987 3300046491 Unclassified 639
231 Ga0495594_0682086 3300046499 Bacteria 581
232 Ga0495656_0304217 3300046615 Bacteria 818
233 Ga0495588_0179191 3300046674 Bacteria 1120
234 Ga0495660_0123100 3300046810 Bacteria 1310
235 Ga0496100_0025701 3300048903 Bacteria 3602
236 Ga0496101_0057915 3300048904 Bacteria 2804
237 Ga0496102_0879462 3300048905 Bacteria 818
238 Ga0496104_0034845 3300048907 Bacteria 4696
239 Ga0496104_0237275 3300048907 Bacteria 1735
240 Ga0496105_0037951 3300048908 Bacteria 3968
241 Ga0496106_0084224 3300048909 Bacteria 2446
242 Ga0496107_0033515 3300048910 Bacteria 3675
243 Ga0496108_0013589 3300048911 Bacteria 6644
244 Ga0496108_0473024 3300048911 Bacteria 1095
245 Ga0496109_0109690 3300048912 Unclassified 2566
246 Ga0496109_0205947 3300048912 Bacteria 1849
247 Ga0496109_0375518 3300048912 Bacteria 1343
248 Ga0496110_0009085 3300048913 Bacteria 8022
249 Ga0496110_0378689 3300048913 Bacteria 1289
250 Ga0496111_0006760 3300048914 Bacteria 7473
251 Ga0496111_0101274 3300048914 Bacteria 2116
252 Ga0496111_0321136 3300048914 Bacteria 1147
253 Ga0496112_0343843 3300048915 Bacteria 1435
254 Ga0496113_0330189 3300048916 Bacteria 1223
255 Ga0496114_0019286 3300048917 Bacteria 5525
256 Ga0501031_0011294 3300049568 Bacteria 5819
257 Ga0501031_0030502 3300049568 Bacteria 3517
258 Ga0501031_0384398 3300049568 Bacteria 908
259 Ga0501032_0109555 3300049569 Bacteria 1828
260 Ga0501032_0488747 3300049569 Bacteria 787
261 Ga0501033_0070377 3300049570 Bacteria 2570
262 Ga0501034_0518783 3300049571 Bacteria 1104
263 Ga0501036_0049740 3300049572 Bacteria 3550
264 Ga0501036_0064825 3300049572 Bacteria 3092
265 Ga0501036_0097607 3300049572 Bacteria 2483
266 Ga0501036_0297325 3300049572 Bacteria 1350
267 Ga0501036_0685379 3300049572 Bacteria 847
268 Ga0501037_0081265 3300049573 Bacteria 2350
269 Ga0501037_0147669 3300049573 Bacteria 1681
270 Ga0501037_0315892 3300049573 Bacteria 1082
271 Ga0501038_0032171 3300049574 Bacteria 4629
272 Ga0501038_0034402 3300049574 Bacteria 4455
273 Ga0501038_0062212 3300049574 Bacteria 3189
274 Ga0501038_1163060 3300049574 Bacteria 561
275 Ga0501039_0009255 3300049575 Bacteria 7504
276 Ga0501039_0013501 3300049575 Bacteria 6246
277 Ga0501039_0048316 3300049575 Bacteria 3290
278 Ga0501039_0816499 3300049575 Bacteria 727
279 Ga0501040_0029093 3300049576 Bacteria 3728
280 Ga0501040_0879896 3300049576 Bacteria 649
281 Ga0501041_0003119 3300049577 Bacteria 9530
282 Ga0501041_0191677 3300049577 Bacteria 1280
283 Ga0501042_0012533 3300049578 Bacteria 5745
284 Ga0501042_0019925 3300049578 Bacteria 4664
285 Ga0501042_0289275 3300049578 Bacteria 1183
286 Ga0501042_0341089 3300049578 Bacteria 1083
287 Ga0501042_0376061 3300049578 Bacteria 1028
288 Ga0501043_0021116 3300049579 Bacteria 5104
289 Ga0501046_0014243 3300049580 Bacteria 6717
290 Ga0501046_0068608 3300049580 Bacteria 2759
291 Ga0501047_0203135 3300049581 Bacteria 1842
292 Ga0501048_0003275 3300049582 Bacteria 12338
293 Ga0501048_0021145 3300049582 Bacteria 4765
294 Ga0501048_0423237 3300049582 Bacteria 953
295 Ga0501067_0035357 3300049583 Bacteria 2774
296 Ga0501067_0052753 3300049583 Bacteria 2253
297 Ga0501068_0161012 3300049584 Bacteria 1414
298 Ga0501068_0219790 3300049584 Bacteria 1207
299 Ga0501068_0386149 3300049584 Bacteria 902
300 Ga0501069_0010651 3300049585 Bacteria 4873
301 Ga0501069_0225422 3300049585 Bacteria 1090
302 Ga0501069_0258080 3300049585 Bacteria 1017
303 Ga0501070_0014309 3300049586 Bacteria 6677
304 Ga0501070_0189588 3300049586 Bacteria 1690
305 Ga0501071_0004920 3300049587 Bacteria 8525
306 Ga0501071_0019793 3300049587 Bacteria 4673
307 Ga0501071_0034343 3300049587 Bacteria 3609
308 Ga0501071_0673809 3300049587 Bacteria 796
309 Ga0501072_0009670 3300049588 Bacteria 7333
310 Ga0501072_0045542 3300049588 Bacteria 3450
311 Ga0501072_0078279 3300049588 Bacteria 2617
312 Ga0501072_0182423 3300049588 Unclassified 1674
313 Ga0501072_0309370 3300049588 Bacteria 1256
314 Ga0501072_0397696 3300049588 Unclassified 1093
315 Ga0501073_0127783 3300049589 Bacteria 1762
316 Ga0501073_0243588 3300049589 Bacteria 1241
317 Ga0501074_0001496 3300049590 Bacteria 15734
318 Ga0501074_0102371 3300049590 Bacteria 2050
319 Ga0501074_0114453 3300049590 Bacteria 1930
320 Ga0501074_0198415 3300049590 Bacteria 1430
321 Ga0501074_0233973 3300049590 Bacteria 1308
322 Ga0501074_0366930 3300049590 Bacteria 1021
323 Ga0501075_0008204 3300049591 Bacteria 7274
324 Ga0501075_0055633 3300049591 Bacteria 2977
325 Ga0501075_0055961 3300049591 Bacteria 2969
326 Ga0501075_0092938 3300049591 Bacteria 2290
327 Ga0501076_0011039 3300049592 Bacteria 6716
328 Ga0501076_0070872 3300049592 Bacteria 2787
329 Ga0501076_0084893 3300049592 Bacteria 2543
330 Ga0501076_0119574 3300049592 Bacteria 2133
331 Ga0501076_0338271 3300049592 Bacteria 1235
332 Ga0501077_0001253 3300049593 Bacteria 15335
333 Ga0501077_0332753 3300049593 Bacteria 968
334 Ga0501077_0427396 3300049593 Bacteria 847
335 Ga0501079_0039847 3300049741 Bacteria 3625
336 Ga0501079_0100060 3300049741 Bacteria 2247
337 Ga0501079_0178134 3300049741 Bacteria 1658
338 Ga0501079_0703582 3300049741 Bacteria 795
339 Ga0501080_0003665 3300049742 Bacteria 13556
340 Ga0501080_0071052 3300049742 Bacteria 3237
341 Ga0501080_0073421 3300049742 Bacteria 3183
342 Ga0501080_0203381 3300049742 Bacteria 1817
343 Ga0501081_0009237 3300049743 Bacteria 6422
344 Ga0501081_0026519 3300049743 Bacteria 3908
345 Ga0501081_0260903 3300049743 Bacteria 1266
346 Ga0501081_0667930 3300049743 Bacteria 779
347 Ga0501083_0064621 3300049744 Bacteria 2438
348 Ga0501035_0558083 3300049822 Bacteria 937
349 Ga0501045_0008918 3300049824 Bacteria 7003
350 Ga0501045_0040999 3300049824 Bacteria 3368
351 Ga0501045_0145091 3300049824 Bacteria 1765
352 nmdc:mga05p37_281764_c1 3300050507 Unclassified 1982
353 nmdc:mga05p37_3346_c1 3300050507 Bacteria 18695
354 nmdc:mga09592_335194_c1 3300050508 Bacteria 1310
355 nmdc:mga0qj67_33094_c1 3300050509 Bacteria 4033
356 nmdc:mga06r32_1434769_c1 3300050510 Bacteria 631
357 nmdc:mga08y16_1598296_c1 3300050511 Bacteria 610
358 nmdc:mga08y16_676667_c1 3300050511 Bacteria 1034
359 nmdc:mga0n895_44248_c1 3300050512 Bacteria 4342
360 nmdc:mga0rr50_34937_c1 3300050513 Bacteria 3605
361 nmdc:mga08x19_411584_c1 3300050514 Bacteria 949
362 nmdc:mga0a205_191892_c1 3300050515 Unclassified 1935
363 Ga0501084_0046551 3300054114 Bacteria 3634
364 Ga0501084_0101004 3300054114 Bacteria 2422
365 Ga0501084_0190709 3300054114 Bacteria 1729
366 Ga0501084_0273852 3300054114 Bacteria 1425
367 Ga0501084_0320827 3300054114 Bacteria 1308
368 Ga0501084_0523570 3300054114 Bacteria 1002
369 Ga0501084_0682768 3300054114 Bacteria 866
370 Ga0501082_0012124 3300060353 Bacteria 7407
371 Ga0501082_0047321 3300060353 Bacteria 3706
372 Ga0501082_0227395 3300060353 Bacteria 1624
373 Ga0501082_0364918 3300060353 Bacteria 1260
374 Ga0501082_0475308 3300060353 Bacteria 1092
375 Ga0530510_0415109 3300061734 Bacteria 1015
376 Ga0530510_0540344 3300061734 Bacteria 885
377 Ga0105242_10294369
378 JGI24743J22301_10036986
379 JGI24744J21845_10015826
380 JGI25406J46586_10015794
381 Ga0070658_10074870
382 Ga0070676_10342528
383 Ga0070683_100006174
384 Ga0070683_100421268
385 Ga0070677_10098095
386 Ga0068869_100087311
387 Ga0070680_100008164
388 Ga0070680_100560457
389 Ga0070680_100570013
390 Ga0070682_100209783
391 Ga0068868_100584661
392 Ga0070660_100153138
393 Ga0070660_100273951
394 Ga0070689_100053861
395 Ga0070661_100104770
396 Ga0070692_10044565
397 Ga0070668_100187728
398 Ga0070675_100657146
399 Ga0070671_100039637
400 Ga0070674_100041887
401 Ga0070674_100094520
402 Ga0070673_100003902
403 Ga0070688_100342824
404 Ga0070714_100319547
405 Ga0070701_10004228
406 Ga0070700_100020653
407 Ga0070700_100090735
408 Ga0070663_100031783
409 Ga0070678_100111481
410 Ga0070678_100488671
411 Ga0070678_100523957
412 Ga0070662_100176865
413 Ga0070681_10013627
414 Ga0068867_100100446
415 Ga0070685_10007298
416 Ga0070685_10051803
417 Ga0070685_10780575
418 Ga0070679_100197647
419 Ga0070684_100009137
420 Ga0070684_100245587
421 Ga0068853_100093855
422 Ga0070672_100048012
423 Ga0070686_100022149
424 Ga0070695_100791494
425 Ga0070696_100255201
426 Ga0070665_100019660
427 Ga0070665_100130761
428 Ga0070704_100056096
429 Ga0068855_100017572
430 Ga0068855_100269259
431 Ga0070664_100204394
432 Ga0068854_100616207
433 Ga0070702_100046106
434 Ga0068859_100071134
435 Ga0068864_100044536
436 Ga0068864_100470372
437 Ga0068861_100677711
438 Ga0068870_10063977
439 Ga0068863_100145238
440 Ga0068860_100050426
441 Ga0068860_100094624
442 Ga0081539_10000154
443 Ga0075365_10308001
444 Ga0097621_100469661
445 Ga0075428_100057735
446 Ga0075430_100045021
447 Ga0075433_10009724
448 Ga0075434_100003918
449 Ga0075429_100273977
450 Ga0068865_100026818
451 Ga0075436_100088184
452 Ga0097620_100071136
453 Ga0075435_100025524
454 Ga0105240_10805269
455 Ga0111539_10032436
456 Ga0111539_10110914
457 Ga0111539_10708314
458 Ga0111539_10999822
459 Ga0105247_10059931
460 Ga0114129_10064885
461 Ga0114129_10148769
462 Ga0105243_11225161
463 Ga0105242_10122280
464 Ga0105242_12058029
465 Ga0105248_10022124
466 Ga0105248_10100227
467 Ga0105238_11211371
468 Ga0105249_10483099
469 Ga0105239_10086796
470 Ga0105239_10193255
471 Ga0105246_10193724
472 Ga0157373_10152860
473 Ga0157373_10352160
474 Ga0157371_10050232
475 Ga0157371_11191953
476 Ga0157370_10165712
477 Ga0157378_10070529
478 Ga0163162_10230515
479 Ga0163162_10266027
480 Ga0163162_10641945
481 Ga0157372_10094386
482 Ga0157372_10729363
483 Ga0157372_11378873
484 Ga0157375_10362914
485 Ga0157375_10661178
486 Ga0157375_13118887
487 Ga0163163_10019989
488 Ga0157380_10020125
489 Ga0157380_10110012
490 Ga0157380_10170165
491 Ga0157377_10185108
492 Ga0157379_10060486
493 Ga0157379_10344985
494 Ga0157376_10176376
495 Ga0163161_10073001
496 Ga0197907_10138244
497 Ga0197907_10884300
498 Ga0206356_11035828
499 Ga0206350_10354121
500 Ga0206350_10763354
501 Ga0206354_10663973
502 Ga0206354_11303673
503 Ga0206353_10286978
504 Ga0213871_10078717
505 Ga0224712_10082538
506 Ga0207682_10012303
507 Ga0207682_10149275
508 Ga0207710_10060854
509 Ga0207688_10012687
510 Ga0207647_10021675
511 Ga0207645_10037764
512 Ga0207643_10073666
513 Ga0207643_10157109
514 Ga0207705_10181611
515 Ga0207707_10116885
516 Ga0207660_10054640
517 Ga0207660_10159709
518 Ga0207662_10015119
519 Ga0207657_10085881
520 Ga0207657_10243038
521 Ga0207652_10359962
522 Ga0207646_10496609
523 Ga0207650_10030362
524 Ga0207659_10729556
525 Ga0207687_10232864
526 Ga0207687_10283326
527 Ga0207644_10774703
528 Ga0207706_10098457
529 Ga0207706_10450276
530 Ga0207686_10100345
531 Ga0207709_10051387
532 Ga0207709_10127796
533 Ga0207670_10386192
534 Ga0207670_10719708
535 Ga0207704_10443112
536 Ga0207691_10027612
537 Ga0207691_10092695
538 Ga0207711_10319113
539 Ga0207689_10088319
540 Ga0207661_10006459
541 Ga0207661_10153830
542 Ga0207661_10265946
543 Ga0207661_10487629
544 Ga0207667_10880425
545 Ga0207651_10156608
546 Ga0207668_10507445
547 Ga0207658_10128552
548 Ga0207677_10113974
549 Ga0207639_10371964
550 Ga0207639_11029081
551 Ga0207678_10064545
552 Ga0207708_10055840
553 Ga0207708_10102285
554 Ga0207641_11391778
555 Ga0207648_10099579
556 Ga0207648_10304130
557 Ga0207648_10869242
558 Ga0207676_10650443
559 Ga0207674_10080924
560 Ga0207675_100073723
561 Ga0207683_10261234
562 Ga0207683_10558384
563 Ga0207698_10560372
564 Ga0207428_10173825
565 Ga0268266_10419451
566 Ga0268265_10120039
567 Ga0268264_10182024
568 Ga0307409_100105227
569 Ga0307409_100384262
570 Ga0307409_101552632
571 Ga0307409_101626647
572 Ga0307414_11750045
573 Ga0307415_100027835
574 Ga0307415_100077960
575 Ga0373951_0019514
576 Ga0373941_0140185
577 Ga0373961_0038697
578 Ga0373962_0037124
579 Ga0373931_0324984
580 Ga0395899_0027667
581 Ga0395899_0495991
582 Ga0395900_0033250
583 Ga0395900_0034279
584 Ga0395900_1909910
585 Ga0395898_0013295
586 Ga0395898_0022802
587 Ga0395898_0158917
588 Ga0395905_0006445
589 Ga0395905_0856057
590 Ga0395905_1010379
591 Ga0395901_0021853
592 Ga0395901_0082367
593 Ga0395901_0240576
594 Ga0436365_1515776
595 Ga0436360_0664656
596 Ga0439461_0034715
597 Ga0450906_012582
598 Ga0466972_0205227
599 Ga0466964_0026575
600 Ga0466964_0781745
601 Ga0466960_0075128
602 Ga0466960_0170379
603 Ga0466967_0002181
604 Ga0466967_0911562
605 Ga0495582_0450594
606 Ga0495584_0471987
607 Ga0495594_0682086
608 Ga0495656_0304217
609 Ga0495588_0179191
610 Ga0495660_0123100
611 Ga0496100_0025701
612 Ga0496101_0057915
613 Ga0496102_0879462
614 Ga0496104_0034845
615 Ga0496104_0237275
616 Ga0496105_0037951
617 Ga0496106_0084224
618 Ga0496107_0033515
619 Ga0496108_0013589
620 Ga0496108_0473024
621 Ga0496109_0109690
622 Ga0496109_0205947
623 Ga0496109_0375518
624 Ga0496110_0009085
625 Ga0496110_0378689
626 Ga0496111_0006760
627 Ga0496111_0101274
628 Ga0496111_0321136
629 Ga0496112_0343843
630 Ga0496113_0330189
631 Ga0496114_0019286
632 Ga0501031_0011294
633 Ga0501031_0030502
634 Ga0501031_0384398
635 Ga0501032_0109555
636 Ga0501032_0488747
637 Ga0501033_0070377
638 Ga0501034_0518783
639 Ga0501036_0049740
640 Ga0501036_0064825
641 Ga0501036_0097607
642 Ga0501036_0297325
643 Ga0501036_0685379
644 Ga0501037_0081265
645 Ga0501037_0147669
646 Ga0501037_0315892
647 Ga0501038_0032171
648 Ga0501038_0034402
649 Ga0501038_0062212
650 Ga0501038_1163060
651 Ga0501039_0009255
652 Ga0501039_0013501
653 Ga0501039_0048316
654 Ga0501039_0816499
655 Ga0501040_0029093
656 Ga0501040_0879896
657 Ga0501041_0003119
658 Ga0501041_0191677
659 Ga0501042_0012533
660 Ga0501042_0019925
661 Ga0501042_0289275
662 Ga0501042_0341089
663 Ga0501042_0376061
664 Ga0501043_0021116
665 Ga0501046_0014243
666 Ga0501046_0068608
667 Ga0501047_0203135
668 Ga0501048_0003275
669 Ga0501048_0021145
670 Ga0501048_0423237
671 Ga0501067_0035357
672 Ga0501067_0052753
673 Ga0501068_0161012
674 Ga0501068_0219790
675 Ga0501068_0386149
676 Ga0501069_0010651
677 Ga0501069_0225422
678 Ga0501069_0258080
679 Ga0501070_0014309
680 Ga0501070_0189588
681 Ga0501071_0004920
682 Ga0501071_0019793
683 Ga0501071_0034343
684 Ga0501071_0673809
685 Ga0501072_0009670
686 Ga0501072_0045542
687 Ga0501072_0078279
688 Ga0501072_0182423
689 Ga0501072_0309370
690 Ga0501072_0397696
691 Ga0501073_0127783
692 Ga0501073_0243588
693 Ga0501074_0001496
694 Ga0501074_0102371
695 Ga0501074_0114453
696 Ga0501074_0198415
697 Ga0501074_0233973
698 Ga0501074_0366930
699 Ga0501075_0008204
700 Ga0501075_0055633
701 Ga0501075_0055961
702 Ga0501075_0092938
703 Ga0501076_0011039
704 Ga0501076_0070872
705 Ga0501076_0084893
706 Ga0501076_0119574
707 Ga0501076_0338271
708 Ga0501077_0001253
709 Ga0501077_0332753
710 Ga0501077_0427396
711 Ga0501079_0039847
712 Ga0501079_0100060
713 Ga0501079_0178134
714 Ga0501079_0703582
715 Ga0501080_0003665
716 Ga0501080_0071052
717 Ga0501080_0073421
718 Ga0501080_0203381
719 Ga0501081_0009237
720 Ga0501081_0026519
721 Ga0501081_0260903
722 Ga0501081_0667930
723 Ga0501083_0064621
724 Ga0501035_0558083
725 Ga0501045_0008918
726 Ga0501045_0040999
727 Ga0501045_0145091
728 nmdc:mga05p37_281764_c1
729 nmdc:mga05p37_3346_c1
730 nmdc:mga09592_335194_c1
731 nmdc:mga0qj67_33094_c1
732 nmdc:mga06r32_1434769_c1
733 nmdc:mga08y16_1598296_c1
734 nmdc:mga08y16_676667_c1
735 nmdc:mga0n895_44248_c1
736 nmdc:mga0rr50_34937_c1
737 nmdc:mga08x19_411584_c1
738 nmdc:mga0a205_191892_c1
739 Ga0501084_0046551
740 Ga0501084_0101004
741 Ga0501084_0190709
742 Ga0501084_0273852
743 Ga0501084_0320827
744 Ga0501084_0523570
745 Ga0501084_0682768
746 Ga0501082_0012124
747 Ga0501082_0047321
748 Ga0501082_0227395
749 Ga0501082_0364918
750 Ga0501082_0475308
751 Ga0530510_0415109
752 Ga0530510_0540344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

33

132

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kol-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/dioxygenase from nostoc punctiforme 0.8191 4 106
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.813 3 104
4mts-assembly1.cif.gz_B ni- and zn-bound gloa2 at high resolution 0.8098 4 106
6a4x-assembly1.cif.gz_A-2 oxidase chap-h2 0.8093 2 104
2zw7-assembly1.cif.gz_B crystal structure of bleomycin n-acetyltransferase complexed with bleomycin a2 and coenzyme a 0.8076 1 106
ID Description Score Start End Superfamily
af_Q0D8H0_68_188_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8421 4 106 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8395 61 104 3.30.720.110
af_C6KSP5_186_307_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8349 7 106 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8205 63 105 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.817 61 104 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A5C5SI64-F1-model_v4 VOC family protein 0.9125 1 107
AF-A0A6B7LH09-F1-model_v4 Putative 3-hydroxyanthranilate 3,4-dioxygenase 0.8847 1 131 GO:0051213
AF-A0A7W0S4D1-F1-model_v4 VOC family protein 0.8738 65 143
AF-A0A7W0N0F1-F1-model_v4 VOC family protein 0.8737 1 105
AF-A0A538G9I9-F1-model_v4 VOC family protein 0.8723 1 142

Map