F427331

General Info

Members Datasets Scaffolds Average Seq Length
376 257 322 129

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11602711|Ga0105245_116027111
Length 155
Sequence MQGLTSAISHVINALITTKQCSRERDAVPHFSIEYSANLDAKVDMGELCALVLRTVLDTGLFETGAVRVRAFRAEAYAIADNLPENAFLDMSFRVGTGRSAEDRKRTGEAVFKAVSEYLASLFETPHFALSLEIREIDPALSWKKNAIHPRLRGK

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
3 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
4 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
5 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
6 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
7 2534681786 Brucella suis 92/29 Isolate Unclassified
8 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
9 2643221557 Ensifer sp. Root558 Isolate Unclassified
10 2643221599 Rhizobium sp. Root708 Isolate Unclassified
11 2643221610 Ensifer sp. Root74 Isolate Unclassified
12 2643221618 Ensifer sp. Root231 Isolate Unclassified
13 2643221626 Ensifer sp. Root31 Isolate Unclassified
14 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
15 2643221655 Ensifer sp. Root1252 Isolate Unclassified
16 2643221659 Ensifer sp. Root127 Isolate Unclassified
17 2643221668 Ensifer sp. Root423 Isolate Unclassified
18 2643221675 Ensifer sp. Root1298 Isolate Unclassified
19 2643221680 Ensifer sp. Root1312 Isolate Unclassified
20 2643221698 Ensifer sp. Root142 Isolate Unclassified
21 2643221712 Ensifer sp. Root258 Isolate Unclassified
22 2643221723 Ensifer sp. Root278 Isolate Unclassified
23 2643221726 Ensifer sp. Root954 Isolate Unclassified
24 2791355266 Rhizobium sp. L43 Isolate Nodule
25 2802429634 Rhizobium anhuiense S10 Isolate Nodule
26 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
27 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
28 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
29 2844163670 Ensifer sp. 1H6 Isolate Unclassified
30 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
31 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
32 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
33 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
34 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
35 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
36 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
37 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
38 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
39 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
40 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
41 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
42 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
43 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
44 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
45 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
46 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
47 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
48 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
49 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
50 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
51 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
52 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
53 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
54 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
61 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
62 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
63 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
107 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
161 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
162 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
163 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
164 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
165 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
166 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
167 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
168 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
247 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
256 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
257 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.64
Metatranscriptomes 0
Isolates 14.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.21
Nodule 7.98
Rhizoplane 2.39
Rhizosphere 51.06
Stem 0
Stem Tuber 0
Unclassified 18.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000070 3300002705 Bacteria 80840
2 JGI25154J39366_1000092 3300002738 Bacteria 80685
3 JGI25158J39367_1002778 3300002739 Bacteria 2780
4 JGI25157J39369_1000087 3300002741 Bacteria 80840
5 JGI25157J39369_1000175 3300002741 Bacteria 54070
6 JGI25159J45721_1000030 3300002987 Bacteria 102429
7 JGI25151J46595_10012299 3300003187 Bacteria 3899
8 JGI25165J46597_1000237 3300003214 Bacteria 75663
9 JGI25165J46597_1000412 3300003214 Bacteria 44966
10 rootH2_10137668 3300003320 Bacteria 2145
11 rootL2_10029935 3300003322 Bacteria 1046
12 JGI25160J50197_1000075 3300003354 Bacteria 102429
13 JGI25161J50226_1000316 3300003374 Bacteria 26515
14 Ga0055526_1005688 3300003771 Bacteria 7073
15 Ga0055536_1003695 3300003781 Bacteria 8124
16 Ga0055536_1028822 3300003781 Bacteria 1505
17 Ga0055530_10017152 3300003791 Bacteria 2279
18 Ga0055540_1000131 3300003792 Bacteria 75615
19 Ga0055531_10011285 3300003794 Bacteria 4329
20 Ga0055531_10022230 3300003794 Bacteria 2425
21 Ga0055531_10106025 3300003794 Bacteria 569
22 Ga0055543_1000236 3300004625 Bacteria 42942
23 Ga0065165_1000206 3300005262 Bacteria 102467
24 Ga0070670_101707443 3300005331 Bacteria 579
25 Ga0068868_100634465 3300005338 Bacteria 950
26 Ga0068868_102288105 3300005338 Bacteria 515
27 Ga0070660_100832712 3300005339 Bacteria 777
28 Ga0070668_100119749 3300005347 Bacteria 2103
29 Ga0070674_100645431 3300005356 Bacteria 899
30 Ga0070663_100560423 3300005455 Bacteria 956
31 Ga0070663_100841896 3300005455 Bacteria 789
32 Ga0070662_100297648 3300005457 Bacteria 1310
33 Ga0068867_100218169 3300005459 Bacteria 1536
34 Ga0068853_100009540 3300005539 Bacteria 7820
35 Ga0068853_101545572 3300005539 Bacteria 643
36 Ga0068853_102131290 3300005539 Bacteria 544
37 Ga0070665_100014994 3300005548 Bacteria 7779
38 Ga0070665_100118898 3300005548 Bacteria 2645
39 Ga0070665_100119251 3300005548 Bacteria 2640
40 Ga0070665_100236352 3300005548 Bacteria 1828
41 Ga0070665_101025936 3300005548 Bacteria 837
42 Ga0070665_101450906 3300005548 Bacteria 695
43 Ga0068855_101601952 3300005563 Bacteria 666
44 Ga0068854_100222572 3300005578 Bacteria 1494
45 Ga0068856_100003888 3300005614 Bacteria 14981
46 Ga0068852_101112446 3300005616 Bacteria 810
47 Ga0075365_10030839 3300006038 Bacteria 3438
48 Ga0075363_100059954 3300006048 Bacteria 2048
49 Ga0075362_10126496 3300006177 Bacteria 1213
50 Ga0075369_10010853 3300006186 Bacteria 3570
51 Ga0075369_10074281 3300006186 Bacteria 1500
52 Ga0068865_101293507 3300006881 Bacteria 648
53 Ga0105240_10312061 3300009093 Bacteria 1795
54 Ga0105240_10359346 3300009093 Bacteria 1650
55 Ga0105240_10808720 3300009093 Bacteria 1015
56 Ga0105245_10318326 3300009098 Bacteria 1532
57 Ga0105245_11602711 3300009098 Bacteria 703
58 Ga0105243_10167324 3300009148 Bacteria 1901
59 Ga0105241_10119259 3300009174 Bacteria 2122
60 Ga0105241_10420712 3300009174 Bacteria 1176
61 Ga0105241_10589854 3300009174 Bacteria 1003
62 Ga0105237_10004427 3300009545 Bacteria 16284
63 Ga0105237_10754654 3300009545 Bacteria 979
64 Ga0105237_12344648 3300009545 Bacteria 544
65 Ga0105238_10026614 3300009551 Bacteria 5897
66 Ga0105238_10683000 3300009551 Bacteria 1038
67 Ga0105238_10702525 3300009551 Bacteria 1023
68 Ga0105249_11318577 3300009553 Bacteria 793
69 Ga0105239_10017021 3300010375 Bacteria 8036
70 Ga0105239_10060210 3300010375 Bacteria 4167
71 Ga0105239_10280560 3300010375 Bacteria 1875
72 Ga0105239_10295169 3300010375 Bacteria 1825
73 Ga0105239_10438688 3300010375 Bacteria 1481
74 Ga0157322_1000490 3300012490 Bacteria 1496
75 Ga0157373_10328377 3300013100 Bacteria 1089
76 Ga0157370_10108014 3300013104 Bacteria 2602
77 Ga0157372_10603404 3300013307 Bacteria 1279
78 Ga0182008_10006828 3300014497 Bacteria 6350
79 Ga0157379_11365468 3300014968 Bacteria 686
80 Ga0157376_10375834 3300014969 Bacteria 1367
81 Ga0182007_10023123 3300015262 Bacteria 2188
82 Ga0163161_10331025 3300017792 Bacteria 1206
83 Ga0209435_100059 3300025206 Bacteria 80744
84 Ga0209436_100823 3300025208 Bacteria 12589
85 Ga0209437_100042 3300025233 Bacteria 444095
86 Ga0209437_100062 3300025233 Bacteria 336900
87 Ga0209646_1000179 3300025246 Bacteria 80892
88 Ga0209646_1014321 3300025246 Bacteria 1195
89 Ga0209646_1021016 3300025246 Bacteria 939
90 Ga0209026_1000005 3300025250 Bacteria 731387
91 Ga0209026_1000212 3300025250 Bacteria 80892
92 Ga0209759_1000111 3300025256 Bacteria 143545
93 Ga0209759_1000246 3300025256 Bacteria 80892
94 Ga0209759_1059461 3300025256 Bacteria 543
95 Ga0209233_1000047 3300025261 Bacteria 459614
96 Ga0209233_1000054 3300025261 Bacteria 439669
97 Ga0209233_1000082 3300025261 Bacteria 336320
98 Ga0209233_1012438 3300025261 Bacteria 2470
99 Ga0209565_1018549 3300025263 Bacteria 1502
100 Ga0209455_1011805 3300025272 Bacteria 2130
101 Ga0209673_1000642 3300025273 Bacteria 52672
102 Ga0209130_1000154 3300025284 Bacteria 102645
103 Ga0209676_1004026 3300025292 Bacteria 8461
104 Ga0209676_1010679 3300025292 Bacteria 3788
105 Ga0209676_1059337 3300025292 Bacteria 961
106 Ga0209025_1000032 3300025294 Bacteria 416141
107 Ga0209025_1134349 3300025294 Bacteria 712
108 Ga0209564_1000025 3300025295 Bacteria 520535
109 Ga0209564_1055630 3300025295 Bacteria 925
110 Ga0209050_1004283 3300025298 Bacteria 9773
111 Ga0209050_1005957 3300025298 Bacteria 7411
112 Ga0209256_1000073 3300025299 Bacteria 237553
113 Ga0209256_1000907 3300025299 Bacteria 36321
114 Ga0207426_1000286 3300025302 Bacteria 102853
115 Ga0209051_1000038 3300025303 Bacteria 320926
116 Ga0209051_1002477 3300025303 Bacteria 13187
117 Ga0209257_1009764 3300025304 Bacteria 5037
118 Ga0209257_1010063 3300025304 Bacteria 4892
119 Ga0209257_1071145 3300025304 Bacteria 916
120 Ga0209257_1103235 3300025304 Bacteria 691
121 Ga0207680_10586373 3300025903 Bacteria 797
122 Ga0207705_10211123 3300025909 Bacteria 1472
123 Ga0207654_10224643 3300025911 Bacteria 1247
124 Ga0207654_10287311 3300025911 Bacteria 1114
125 Ga0207695_10287049 3300025913 Bacteria 1538
126 Ga0207695_10318687 3300025913 Bacteria 1444
127 Ga0207671_10015179 3300025914 Bacteria 6049
128 Ga0207671_10518970 3300025914 Bacteria 950
129 Ga0207657_10037123 3300025919 Bacteria 4356
130 Ga0207694_10007331 3300025924 Bacteria 8368
131 Ga0207694_11615222 3300025924 Bacteria 546
132 Ga0207687_10177818 3300025927 Bacteria 1646
133 Ga0207687_11314300 3300025927 Bacteria 622
134 Ga0207706_11051948 3300025933 Bacteria 682
135 Ga0207709_10166974 3300025935 Bacteria 1541
136 Ga0207669_10604542 3300025937 Bacteria 892
137 Ga0207669_10612034 3300025937 Bacteria 887
138 Ga0207691_10341414 3300025940 Bacteria 1282
139 Ga0207640_10371277 3300025981 Bacteria 1156
140 Ga0207677_10502401 3300026023 Bacteria 1049
141 Ga0207639_10006277 3300026041 Bacteria 8071
142 Ga0207678_10172749 3300026067 Bacteria 1845
143 Ga0207678_10288565 3300026067 Bacteria 1409
144 Ga0207678_10600460 3300026067 Bacteria 965
145 Ga0207702_10019097 3300026078 Bacteria 5673
146 Ga0207648_10847885 3300026089 Bacteria 852
147 Ga0207674_10673650 3300026116 Bacteria 999
148 Ga0207698_10401779 3300026142 Bacteria 1309
149 Ga0268266_10011262 3300028379 Bacteria 7784
150 Ga0268266_10063276 3300028379 Bacteria 3194
151 Ga0268266_10811219 3300028379 Bacteria 904
152 Ga0268266_10889864 3300028379 Bacteria 861
153 Ga0307515_10000130 3300028794 Bacteria 179263
154 Ga0307515_10011208 3300028794 Bacteria 17036
155 Ga0265325_10053345 3300031241 Bacteria 2073
156 Ga0307513_10000335 3300031456 Bacteria 67961
157 Ga0307513_10020103 3300031456 Bacteria 7925
158 Ga0307513_10223629 3300031456 Bacteria 1701
159 Ga0307513_10563807 3300031456 Bacteria 850
160 Ga0307408_101395869 3300031548 Bacteria 659
161 Ga0307516_10105747 3300031730 Bacteria 2626
162 Ga0307412_10647357 3300031911 Bacteria 901
163 Ga0307411_10663644 3300032005 Bacteria 904
164 Ga0373927_0000177 3300035695 Bacteria 50406
165 Ga0373925_0000912 3300037068 Bacteria 26965
166 Ga0373925_1437652 3300037068 Bacteria 565
167 Ga0395900_0004780 3300037418 Bacteria 14275
168 Ga0395900_0095933 3300037418 Bacteria 3047
169 Ga0395900_0454062 3300037418 Bacteria 1237
170 Ga0395905_0002254 3300037471 Bacteria 21651
171 Ga0395905_0007474 3300037471 Bacteria 10868
172 Ga0395905_0176551 3300037471 Bacteria 2005
173 Ga0395905_0705334 3300037471 Bacteria 911
174 Ga0395905_0725110 3300037471 Bacteria 896
175 Ga0395905_0878737 3300037471 Bacteria 799
176 Ga0395901_0014425 3300038443 Bacteria 8041
177 Ga0395901_0734766 3300038443 Bacteria 981
178 Ga0439447_067327 3300041407 Bacteria 836
179 Ga0439465_0023387 3300041413 Bacteria 1944
180 Ga0451800_1534650 3300041459 Bacteria 674
181 Ga0451833_0369965 3300041491 Bacteria 43703
182 Ga0451837_0270537 3300041494 Bacteria 1509
183 Ga0451839_0063950 3300041496 Bacteria 43670
184 Ga0451839_0099676 3300041496 Bacteria 620
185 Ga0451841_0741888 3300041498 Bacteria 9298
186 Ga0451845_0249129 3300041501 Bacteria 20670
187 Ga0451847_0341155 3300041503 Bacteria 20211
188 Ga0451849_1508595 3300041505 Bacteria 810
189 Ga0451851_1180298 3300041507 Bacteria 43516
190 Ga0451843_0458898 3300041509 Bacteria 536
191 Ga0451843_1179278 3300041509 Bacteria 694
192 Ga0451855_1003632 3300041511 Bacteria 2746
193 Ga0451853_2474193 3300041512 Bacteria 23134
194 Ga0451853_3486518 3300041512 Bacteria 501
195 Ga0466963_0118145 3300044694 Bacteria 1823
196 Ga0466964_0033175 3300044706 Bacteria 2056
197 Ga0466970_0000134 3300044765 Bacteria 33918
198 Ga0466970_0399715 3300044765 Bacteria 784
199 Ga0466957_0023170 3300044842 Bacteria 3669
200 Ga0466958_0057997 3300045836 Bacteria 2354
201 Ga0466967_0385585 3300045976 Bacteria 1361
202 Ga0495638_0248486 3300046460 Bacteria 981
203 Ga0495583_0037579 3300046506 Bacteria 2294
204 Ga0495610_0040911 3300046512 Bacteria 2331
205 Ga0495620_0156113 3300046515 Bacteria 888
206 Ga0495631_0005680 3300046518 Bacteria 6509
207 Ga0495632_0151058 3300046519 Bacteria 1073
208 Ga0495648_0016603 3300046524 Bacteria 5301
209 Ga0495633_0060470 3300046558 Bacteria 1775
210 Ga0495633_0297827 3300046558 Bacteria 733
211 Ga0495611_0057457 3300046648 Bacteria 1763
212 Ga0495625_0068155 3300046660 Bacteria 2502
213 Ga0495625_0123196 3300046660 Bacteria 1762
214 Ga0495625_0278925 3300046660 Bacteria 1076
215 Ga0495588_0219388 3300046674 Bacteria 1004
216 Ga0495657_0037895 3300046675 Bacteria 3320
217 Ga0495600_0034731 3300046809 Bacteria 3274
218 Ga0495660_0041006 3300046810 Bacteria 2565
219 Ga0495681_0001771 3300047470 Bacteria 15902
220 Ga0495681_0193793 3300047470 Bacteria 828
221 Ga0495686_0021447 3300047472 Bacteria 4290
222 Ga0496102_0595396 3300048905 Bacteria 1029
223 Ga0496102_0689919 3300048905 Bacteria 944
224 Ga0496102_1163186 3300048905 Bacteria 691
225 Ga0496103_0087163 3300048906 Bacteria 1968
226 Ga0496108_0351980 3300048911 Bacteria 1285
227 Ga0496108_0355976 3300048911 Bacteria 1277
228 Ga0496115_0691951 3300048918 Bacteria 802
229 Ga0496116_0263872 3300048919 Bacteria 847
230 Ga0496119_0008841 3300048922 Bacteria 8759
231 Ga0496119_0225274 3300048922 Bacteria 957
232 Ga0496120_0001458 3300048923 Bacteria 28286
233 Ga0496120_0009210 3300048923 Bacteria 7032
234 Ga0496120_0047615 3300048923 Bacteria 2471
235 Ga0496121_0041666 3300048924 Bacteria 4010
236 Ga0496122_0060753 3300048925 Bacteria 2780
237 Ga0496123_0043835 3300048926 Bacteria 3067
238 Ga0496124_0172836 3300048927 Bacteria 1671
239 Ga0496125_0198444 3300048928 Bacteria 1316
240 Ga0496125_0217848 3300048928 Bacteria 1233
241 Ga0496126_0024496 3300048929 Bacteria 5826
242 Ga0501031_0000007 3300049568 Bacteria 166008
243 Ga0501031_0888706 3300049568 Bacteria 570
244 Ga0501032_0000007 3300049569 Bacteria 253881
245 Ga0501032_0003811 3300049569 Bacteria 11447
246 Ga0501033_0000040 3300049570 Bacteria 142586
247 Ga0501033_0000377 3300049570 Bacteria 42799
248 Ga0501033_0024192 3300049570 Bacteria 4582
249 Ga0501034_0000029 3300049571 Bacteria 253881
250 Ga0501034_0092769 3300049571 Bacteria 3016
251 Ga0501034_0182006 3300049571 Bacteria 2066
252 Ga0501034_0352790 3300049571 Bacteria 1399
253 Ga0501034_0531112 3300049571 Bacteria 1087
254 Ga0501036_0000004 3300049572 Bacteria 253881
255 Ga0501036_1109868 3300049572 Bacteria 646
256 Ga0501037_0000004 3300049573 Bacteria 253989
257 Ga0501037_0000198 3300049573 Bacteria 54028
258 Ga0501037_0925568 3300049573 Bacteria 570
259 Ga0501038_0000005 3300049574 Bacteria 253881
260 Ga0501038_0091769 3300049574 Bacteria 2544
261 Ga0501038_0345348 3300049574 Bacteria 1160
262 Ga0501039_0000009 3300049575 Bacteria 253881
263 Ga0501039_0661951 3300049575 Bacteria 817
264 Ga0501040_0000754 3300049576 Bacteria 20093
265 Ga0501043_0000100 3300049579 Bacteria 79167
266 Ga0501043_0000836 3300049579 Bacteria 27366
267 Ga0501043_0084612 3300049579 Bacteria 2493
268 Ga0501043_0984466 3300049579 Bacteria 601
269 Ga0501046_0014599 3300049580 Bacteria 6619
270 Ga0501047_0000895 3300049581 Bacteria 30440
271 Ga0501048_1246606 3300049582 Bacteria 535
272 Ga0501067_0546543 3300049583 Bacteria 649
273 Ga0501069_0000020 3300049585 Bacteria 122595
274 Ga0501070_0000174 3300049586 Bacteria 59663
275 Ga0501070_0011186 3300049586 Bacteria 7576
276 Ga0501070_0533728 3300049586 Bacteria 940
277 Ga0501072_1092685 3300049588 Bacteria 621
278 Ga0501074_0000015 3300049590 Bacteria 79939
279 Ga0501242_048663 3300049674 Bacteria 617
280 Ga0501080_0015259 3300049742 Bacteria 7081
281 Ga0501083_0001041 3300049744 Bacteria 18494
282 Ga0501280_004569 3300049776 Bacteria 2024
283 Ga0501035_0000014 3300049822 Bacteria 253874
284 Ga0501035_0000070 3300049822 Bacteria 127442
285 Ga0501035_0166764 3300049822 Bacteria 1904
286 Ga0501035_0255763 3300049822 Bacteria 1486
287 Ga0501044_0000012 3300049823 Bacteria 253881
288 Ga0501044_0000037 3300049823 Bacteria 161924
289 Ga0501044_0102592 3300049823 Bacteria 2876
290 Ga0501044_0134631 3300049823 Bacteria 2463
291 Ga0501044_0777720 3300049823 Bacteria 838
292 Ga0501044_1395507 3300049823 Bacteria 566
293 Ga0501044_1453584 3300049823 Unclassified 551
294 nmdc:mga03n38_147311_c1 3300050490 Bacteria 1181
295 nmdc:mga0yw44_153537_c1 3300050492 Bacteria 1503
296 nmdc:mga0yw44_34731_c1 3300050492 Bacteria 2957
297 nmdc:mga0yw44_913867_c1 3300050492 Bacteria 595
298 nmdc:mga0k408_706050_c1 3300050493 Bacteria 591
299 nmdc:mga07m45_355808_c1 3300050496 Bacteria 851
300 nmdc:mga0sz30_1713_c1 3300050516 Bacteria 7785
301 Ga0495601_0893068 3300053077 Bacteria 562
302 Ga0495655_0039798 3300053083 Bacteria 1194
303 Ga0500578_0672558 3300053086 Bacteria 560
304 Ga0500646_0096823 3300053090 Bacteria 921
305 Ga0500651_0382918 3300053093 Bacteria 793
306 Ga0500556_0151414 3300053104 Bacteria 914
307 Ga0500594_0142001 3300053118 Bacteria 767
308 Ga0500608_010188 3300053122 Bacteria 4026
309 Ga0500618_000334 3300053125 Bacteria 33962
310 Ga0500618_014708 3300053125 Bacteria 1993
311 Ga0500658_0062003 3300053134 Bacteria 1557
312 Ga0500590_000050 3300053148 Bacteria 28213
313 Ga0500604_0174989 3300053151 Bacteria 734
314 Ga0500616_0000210 3300053153 Bacteria 94120
315 Ga0500620_000042 3300053155 Bacteria 23446
316 Ga0500627_0099457 3300053158 Bacteria 1305
317 Ga0500634_0007978 3300053161 Bacteria 5263
318 Ga0500636_0046425 3300053177 Bacteria 2560
319 Ga0500636_0090064 3300053177 Bacteria 1758
320 Ga0500596_036142 3300053735 Bacteria 778
321 Ga0501082_0128523 3300060353 Bacteria 2198
322 Ga0501082_0184198 3300060353 Bacteria 1816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053161 Ga0500634_0007978 Ga0500634_0007978_714_1220 107
2 iso_pu_bacteria 2510917030 2511197975 124
3 iso_pu_bacteria 2513237162 2514024324 124
4 iso_pu_bacteria 2515154114 2515646150 124
5 iso_pu_bacteria 2515154116 2515654732 124
6 iso_pu_bacteria 2516653077 2517040515 124
7 iso_pu_bacteria 2517287029 2517411263 124
8 iso_pu_bacteria 2534681786 2535485962 124
9 iso_pu_bacteria 2599185352 2600193848 124
10 iso_pu_bacteria 2643221557 2643805293 124
11 iso_pu_bacteria 2643221599 2644005372 124
12 iso_pu_bacteria 2643221610 2644064137 124
13 iso_pu_bacteria 2643221618 2644105328 124
14 iso_pu_bacteria 2643221626 2644147295 124
15 iso_pu_bacteria 2643221636 2644200668 124
16 iso_pu_bacteria 2643221655 2644309815 124
17 iso_pu_bacteria 2643221659 2644333330 124
18 iso_pu_bacteria 2643221668 2644375743 124
19 iso_pu_bacteria 2643221675 2644415969 124
20 iso_pu_bacteria 2643221680 2644449010 124
21 iso_pu_bacteria 2643221698 2644543473 124
22 iso_pu_bacteria 2643221712 2644614388 124
23 iso_pu_bacteria 2643221723 2644674212 124
24 iso_pu_bacteria 2643221726 2644686466 124
25 iso_pu_bacteria 2791355266 2793360055 124
26 iso_pu_bacteria 2802429634 2806055856 124
27 iso_pu_bacteria 2802429635 2806061304 124
28 iso_pu_bacteria 2802429636 2806065767 124
29 iso_pu_bacteria 2844163670 2844166535 124
30 iso_pu_bacteria 2857516855 2857523885 124
31 iso_pu_bacteria 2937843397 2937845033 124
32 iso_pu_bacteria 2941499720 2941502594 124
33 iso_pu_bacteria 3005452660 3005457601 124
34 iso_pu_bacteria 8003570095 8003574889 124
35 3300005548 Ga0070665_100119251 Ga0070665_1001192514 125
36 3300005548 Ga0070665_101450906 Ga0070665_1014509061 125
37 3300005563 Ga0068855_101601952 Ga0068855_1016019522 125
38 3300005578 Ga0068854_100222572 Ga0068854_1002225722 125
39 3300006177 Ga0075362_10126496 Ga0075362_101264962 125
40 3300006186 Ga0075369_10010853 Ga0075369_100108533 125
41 3300009553 Ga0105249_11318577 Ga0105249_113185772 125
42 3300025261 Ga0209233_1000047 Ga0209233_100004754 125
43 3300025933 Ga0207706_11051948 Ga0207706_110519481 125
44 3300025937 Ga0207669_10604542 Ga0207669_106045422 125
45 3300025981 Ga0207640_10371277 Ga0207640_103712771 125
46 3300026067 Ga0207678_10288565 Ga0207678_102885651 125
47 3300026089 Ga0207648_10847885 Ga0207648_108478852 125
48 3300028379 Ga0268266_10063276 Ga0268266_100632763 125
49 3300028379 Ga0268266_10889864 Ga0268266_108898642 125
50 3300037418 Ga0395900_0004780 Ga0395900_0004780_10057_10434 125
51 3300037418 Ga0395900_0095933 Ga0395900_0095933_958_1335 125
52 3300037471 Ga0395905_0002254 Ga0395905_0002254_4591_4968 125
53 3300037471 Ga0395905_0705334 Ga0395905_0705334_40_417 125
54 3300037471 Ga0395905_0725110 Ga0395905_0725110_466_843 125
55 3300037471 Ga0395905_0878737 Ga0395905_0878737_136_513 125
56 3300038443 Ga0395901_0014425 Ga0395901_0014425_713_1090 125
57 3300038443 Ga0395901_0734766 Ga0395901_0734766_124_501 125
58 3300044765 Ga0466970_0399715 Ga0466970_0399715_57_434 125
59 3300046512 Ga0495610_0040911 Ga0495610_0040911_856_1233 125
60 3300046515 Ga0495620_0156113 Ga0495620_0156113_77_454 125
61 3300046660 Ga0495625_0278925 Ga0495625_0278925_573_950 125
62 3300046810 Ga0495660_0041006 Ga0495660_0041006_118_495 125
63 3300047470 Ga0495681_0193793 Ga0495681_0193793_350_727 125
64 3300048905 Ga0496102_1163186 Ga0496102_1163186_261_638 125
65 3300049568 Ga0501031_0000007 Ga0501031_0000007_128769_129146 125
66 3300049568 Ga0501031_0888706 Ga0501031_0888706_122_499 125
67 3300049569 Ga0501032_0000007 Ga0501032_0000007_36863_37240 125
68 3300049569 Ga0501032_0003811 Ga0501032_0003811_8333_8710 125
69 3300049570 Ga0501033_0000040 Ga0501033_0000040_105347_105724 125
70 3300049570 Ga0501033_0000377 Ga0501033_0000377_17617_17994 125
71 3300049570 Ga0501033_0024192 Ga0501033_0024192_2988_3365 125
72 3300049571 Ga0501034_0000029 Ga0501034_0000029_216642_217019 125
73 3300049571 Ga0501034_0092769 Ga0501034_0092769_1461_1838 125
74 3300049572 Ga0501036_0000004 Ga0501036_0000004_216642_217019 125
75 3300049572 Ga0501036_1109868 Ga0501036_1109868_12_389 125
76 3300049573 Ga0501037_0000004 Ga0501037_0000004_36863_37240 125
77 3300049573 Ga0501037_0000198 Ga0501037_0000198_41431_41808 125
78 3300049573 Ga0501037_0925568 Ga0501037_0925568_148_525 125
79 3300049574 Ga0501038_0000005 Ga0501038_0000005_216642_217019 125
80 3300049574 Ga0501038_0091769 Ga0501038_0091769_841_1218 125
81 3300049574 Ga0501038_0345348 Ga0501038_0345348_102_479 125
82 3300049575 Ga0501039_0000009 Ga0501039_0000009_216642_217019 125
83 3300049575 Ga0501039_0661951 Ga0501039_0661951_118_495 125
84 3300049576 Ga0501040_0000754 Ga0501040_0000754_4653_5030 125
85 3300049579 Ga0501043_0000100 Ga0501043_0000100_72538_72915 125
86 3300049579 Ga0501043_0000836 Ga0501043_0000836_13064_13441 125
87 3300049579 Ga0501043_0084612 Ga0501043_0084612_1414_1791 125
88 3300049580 Ga0501046_0014599 Ga0501046_0014599_1418_1795 125
89 3300049581 Ga0501047_0000895 Ga0501047_0000895_1523_1900 125
90 3300049582 Ga0501048_1246606 Ga0501048_1246606_71_448 125
91 3300049583 Ga0501067_0546543 Ga0501067_0546543_256_633 125
92 3300049585 Ga0501069_0000020 Ga0501069_0000020_35148_35525 125
93 3300049586 Ga0501070_0000174 Ga0501070_0000174_18595_18972 125
94 3300049586 Ga0501070_0011186 Ga0501070_0011186_6482_6859 125
95 3300049590 Ga0501074_0000015 Ga0501074_0000015_37303_37680 125
96 3300049742 Ga0501080_0015259 Ga0501080_0015259_5569_5946 125
97 3300049744 Ga0501083_0001041 Ga0501083_0001041_15572_15949 125
98 3300049822 Ga0501035_0000014 Ga0501035_0000014_216642_217019 125
99 3300049822 Ga0501035_0000070 Ga0501035_0000070_87071_87448 125
100 3300049822 Ga0501035_0166764 Ga0501035_0166764_1401_1778 125
101 3300049823 Ga0501044_0000012 Ga0501044_0000012_36863_37240 125
102 3300049823 Ga0501044_0000037 Ga0501044_0000037_79719_80096 125
103 3300049823 Ga0501044_0134631 Ga0501044_0134631_734_1111 125
104 3300049823 Ga0501044_0777720 Ga0501044_0777720_89_466 125
105 3300050492 nmdc:mga0yw44_34731_c1 nmdc:mga0yw44_34731_c1_1166_1543 125
106 3300050496 nmdc:mga07m45_355808_c1 nmdc:mga07m45_355808_c1_353_730 125
107 3300050516 nmdc:mga0sz30_1713_c1 nmdc:mga0sz30_1713_c1_3742_4119 125
108 3300053093 Ga0500651_0382918 Ga0500651_0382918_254_631 125
109 3300053118 Ga0500594_0142001 Ga0500594_0142001_78_455 125
110 3300053134 Ga0500658_0062003 Ga0500658_0062003_564_941 125
111 3300053151 Ga0500604_0174989 Ga0500604_0174989_114_491 125
112 3300053155 Ga0500620_000042 Ga0500620_000042_7118_7495 125
113 3300060353 Ga0501082_0128523 Ga0501082_0128523_1701_2078 125
114 3300003781 Ga0055536_1028822 Ga0055536_10288222 127
115 3300025292 Ga0209676_1010679 Ga0209676_10106792 127
116 3300002705 JGI25156J39149_1000070 JGI25156J39149_100007052 128
117 3300002738 JGI25154J39366_1000092 JGI25154J39366_100009226 128
118 3300002739 JGI25158J39367_1002778 JGI25158J39367_10027783 128
119 3300002741 JGI25157J39369_1000087 JGI25157J39369_100008727 128
120 3300002741 JGI25157J39369_1000175 JGI25157J39369_100017534 128
121 3300002987 JGI25159J45721_1000030 JGI25159J45721_100003055 128
122 3300003187 JGI25151J46595_10012299 JGI25151J46595_100122992 128
123 3300003214 JGI25165J46597_1000237 JGI25165J46597_100023758 128
124 3300003214 JGI25165J46597_1000412 JGI25165J46597_100041228 128
125 3300003320 rootH2_10137668 rootH2_101376682 128
126 3300003322 rootL2_10029935 rootL2_100299352 128
127 3300003354 JGI25160J50197_1000075 JGI25160J50197_100007555 128
128 3300003374 JGI25161J50226_1000316 JGI25161J50226_10003166 128
129 3300003771 Ga0055526_1005688 Ga0055526_10056884 128
130 3300003781 Ga0055536_1003695 Ga0055536_10036956 128
131 3300003791 Ga0055530_10017152 Ga0055530_100171521 128
132 3300003792 Ga0055540_1000131 Ga0055540_100013135 128
133 3300003794 Ga0055531_10011285 Ga0055531_100112856 128
134 3300003794 Ga0055531_10022230 Ga0055531_100222302 128
135 3300003794 Ga0055531_10106025 Ga0055531_101060251 128
136 3300004625 Ga0055543_1000236 Ga0055543_10002362 128
137 3300005262 Ga0065165_1000206 Ga0065165_100020655 128
138 3300005331 Ga0070670_101707443 Ga0070670_1017074431 128
139 3300005338 Ga0068868_100634465 Ga0068868_1006344652 128
140 3300005338 Ga0068868_102288105 Ga0068868_1022881051 128
141 3300005339 Ga0070660_100832712 Ga0070660_1008327121 128
142 3300005347 Ga0070668_100119749 Ga0070668_1001197493 128
143 3300005356 Ga0070674_100645431 Ga0070674_1006454312 128
144 3300005455 Ga0070663_100560423 Ga0070663_1005604232 128
145 3300005455 Ga0070663_100841896 Ga0070663_1008418961 128
146 3300005457 Ga0070662_100297648 Ga0070662_1002976482 128
147 3300005459 Ga0068867_100218169 Ga0068867_1002181692 128
148 3300005539 Ga0068853_100009540 Ga0068853_1000095406 128
149 3300005539 Ga0068853_101545572 Ga0068853_1015455721 128
150 3300005539 Ga0068853_102131290 Ga0068853_1021312901 128
151 3300005548 Ga0070665_100014994 Ga0070665_1000149943 128
152 3300005548 Ga0070665_100118898 Ga0070665_1001188982 128
153 3300005548 Ga0070665_100236352 Ga0070665_1002363522 128
154 3300005548 Ga0070665_101025936 Ga0070665_1010259362 128
155 3300005614 Ga0068856_100003888 Ga0068856_10000388811 128
156 3300005616 Ga0068852_101112446 Ga0068852_1011124462 128
157 3300006038 Ga0075365_10030839 Ga0075365_100308392 128
158 3300006048 Ga0075363_100059954 Ga0075363_1000599542 128
159 3300006186 Ga0075369_10074281 Ga0075369_100742812 128
160 3300006881 Ga0068865_101293507 Ga0068865_1012935072 128
161 3300009093 Ga0105240_10312061 Ga0105240_103120612 128
162 3300009093 Ga0105240_10359346 Ga0105240_103593462 128
163 3300009093 Ga0105240_10808720 Ga0105240_108087202 128
164 3300009098 Ga0105245_10318326 Ga0105245_103183262 128
165 3300009098 Ga0105245_11602711 Ga0105245_116027111 128
166 3300009148 Ga0105243_10167324 Ga0105243_101673242 128
167 3300009174 Ga0105241_10119259 Ga0105241_101192592 128
168 3300009174 Ga0105241_10420712 Ga0105241_104207122 128
169 3300009174 Ga0105241_10589854 Ga0105241_105898541 128
170 3300009545 Ga0105237_10004427 Ga0105237_1000442712 128
171 3300009545 Ga0105237_10754654 Ga0105237_107546541 128
172 3300009545 Ga0105237_12344648 Ga0105237_123446481 128
173 3300009551 Ga0105238_10026614 Ga0105238_100266142 128
174 3300009551 Ga0105238_10683000 Ga0105238_106830002 128
175 3300009551 Ga0105238_10702525 Ga0105238_107025252 128
176 3300010375 Ga0105239_10017021 Ga0105239_100170216 128
177 3300010375 Ga0105239_10060210 Ga0105239_100602102 128
178 3300010375 Ga0105239_10280560 Ga0105239_102805602 128
179 3300010375 Ga0105239_10295169 Ga0105239_102951692 128
180 3300010375 Ga0105239_10438688 Ga0105239_104386882 128
181 3300012490 Ga0157322_1000490 Ga0157322_10004902 128
182 3300013100 Ga0157373_10328377 Ga0157373_103283772 128
183 3300013104 Ga0157370_10108014 Ga0157370_101080142 128
184 3300013307 Ga0157372_10603404 Ga0157372_106034043 128
185 3300014497 Ga0182008_10006828 Ga0182008_100068284 128
186 3300014968 Ga0157379_11365468 Ga0157379_113654682 128
187 3300014969 Ga0157376_10375834 Ga0157376_103758342 128
188 3300015262 Ga0182007_10023123 Ga0182007_100231232 128
189 3300017792 Ga0163161_10331025 Ga0163161_103310252 128
190 3300025206 Ga0209435_100059 Ga0209435_10005952 128
191 3300025208 Ga0209436_100823 Ga0209436_1008237 128
192 3300025233 Ga0209437_100042 Ga0209437_100042367 128
193 3300025233 Ga0209437_100062 Ga0209437_10006248 128
194 3300025246 Ga0209646_1000179 Ga0209646_100017926 128
195 3300025246 Ga0209646_1014321 Ga0209646_10143212 128
196 3300025246 Ga0209646_1021016 Ga0209646_10210162 128
197 3300025250 Ga0209026_1000005 Ga0209026_1000005548 128
198 3300025250 Ga0209026_1000212 Ga0209026_100021226 128
199 3300025256 Ga0209759_1000111 Ga0209759_100011185 128
200 3300025256 Ga0209759_1000246 Ga0209759_100024626 128
201 3300025256 Ga0209759_1059461 Ga0209759_10594611 128
202 3300025261 Ga0209233_1000054 Ga0209233_1000054294 128
203 3300025261 Ga0209233_1000082 Ga0209233_100008248 128
204 3300025261 Ga0209233_1012438 Ga0209233_10124384 128
205 3300025263 Ga0209565_1018549 Ga0209565_10185492 128
206 3300025272 Ga0209455_1011805 Ga0209455_10118053 128
207 3300025273 Ga0209673_1000642 Ga0209673_100064226 128
208 3300025284 Ga0209130_1000154 Ga0209130_100015457 128
209 3300025292 Ga0209676_1004026 Ga0209676_10040264 128
210 3300025292 Ga0209676_1059337 Ga0209676_10593372 128
211 3300025294 Ga0209025_1000032 Ga0209025_1000032343 128
212 3300025294 Ga0209025_1134349 Ga0209025_11343491 128
213 3300025295 Ga0209564_1000025 Ga0209564_1000025436 128
214 3300025295 Ga0209564_1055630 Ga0209564_10556302 128
215 3300025298 Ga0209050_1004283 Ga0209050_10042838 128
216 3300025298 Ga0209050_1005957 Ga0209050_10059577 128
217 3300025299 Ga0209256_1000073 Ga0209256_1000073202 128
218 3300025299 Ga0209256_1000907 Ga0209256_100090713 128
219 3300025302 Ga0207426_1000286 Ga0207426_100028657 128
220 3300025303 Ga0209051_1000038 Ga0209051_1000038264 128
221 3300025303 Ga0209051_1002477 Ga0209051_100247714 128
222 3300025304 Ga0209257_1009764 Ga0209257_10097642 128
223 3300025304 Ga0209257_1010063 Ga0209257_10100634 128
224 3300025304 Ga0209257_1071145 Ga0209257_10711452 128
225 3300025304 Ga0209257_1103235 Ga0209257_11032351 128
226 3300025903 Ga0207680_10586373 Ga0207680_105863732 128
227 3300025909 Ga0207705_10211123 Ga0207705_102111232 128
228 3300025911 Ga0207654_10224643 Ga0207654_102246432 128
229 3300025911 Ga0207654_10287311 Ga0207654_102873112 128
230 3300025913 Ga0207695_10287049 Ga0207695_102870492 128
231 3300025913 Ga0207695_10318687 Ga0207695_103186872 128
232 3300025914 Ga0207671_10015179 Ga0207671_100151792 128
233 3300025914 Ga0207671_10518970 Ga0207671_105189701 128
234 3300025919 Ga0207657_10037123 Ga0207657_100371235 128
235 3300025924 Ga0207694_10007331 Ga0207694_100073312 128
236 3300025924 Ga0207694_11615222 Ga0207694_116152221 128
237 3300025927 Ga0207687_10177818 Ga0207687_101778182 128
238 3300025927 Ga0207687_11314300 Ga0207687_113143001 128
239 3300025935 Ga0207709_10166974 Ga0207709_101669742 128
240 3300025937 Ga0207669_10612034 Ga0207669_106120342 128
241 3300025940 Ga0207691_10341414 Ga0207691_103414142 128
242 3300026023 Ga0207677_10502401 Ga0207677_105024012 128
243 3300026041 Ga0207639_10006277 Ga0207639_100062775 128
244 3300026067 Ga0207678_10172749 Ga0207678_101727493 128
245 3300026067 Ga0207678_10600460 Ga0207678_106004602 128
246 3300026078 Ga0207702_10019097 Ga0207702_100190974 128
247 3300026116 Ga0207674_10673650 Ga0207674_106736502 128
248 3300026142 Ga0207698_10401779 Ga0207698_104017792 128
249 3300028379 Ga0268266_10011262 Ga0268266_100112626 128
250 3300028379 Ga0268266_10811219 Ga0268266_108112191 128
251 3300028794 Ga0307515_10000130 Ga0307515_1000013051 128
252 3300028794 Ga0307515_10011208 Ga0307515_1001120812 128
253 3300031241 Ga0265325_10053345 Ga0265325_100533452 128
254 3300031456 Ga0307513_10000335 Ga0307513_1000033514 128
255 3300031456 Ga0307513_10020103 Ga0307513_100201034 128
256 3300031456 Ga0307513_10223629 Ga0307513_102236293 128
257 3300031456 Ga0307513_10563807 Ga0307513_105638072 128
258 3300031548 Ga0307408_101395869 Ga0307408_1013958691 128
259 3300031730 Ga0307516_10105747 Ga0307516_101057472 128
260 3300031911 Ga0307412_10647357 Ga0307412_106473571 128
261 3300032005 Ga0307411_10663644 Ga0307411_106636442 128
262 3300035695 Ga0373927_0000177 Ga0373927_0000177_40485_40871 128
263 3300037068 Ga0373925_0000912 Ga0373925_0000912_22650_23036 128
264 3300037068 Ga0373925_1437652 Ga0373925_1437652_131_517 128
265 3300037418 Ga0395900_0454062 Ga0395900_0454062_382_786 128
266 3300037471 Ga0395905_0007474 Ga0395905_0007474_969_1361 128
267 3300037471 Ga0395905_0176551 Ga0395905_0176551_25_417 128
268 3300041407 Ga0439447_067327 Ga0439447_067327_431_817 128
269 3300041413 Ga0439465_0023387 Ga0439465_0023387_1523_1909 128
270 3300041459 Ga0451800_1534650 Ga0451800_1534650_46_438 128
271 3300041491 Ga0451833_0369965 Ga0451833_0369965_16583_16975 128
272 3300041494 Ga0451837_0270537 Ga0451837_0270537_622_1014 128
273 3300041496 Ga0451839_0063950 Ga0451839_0063950_16599_16991 128
274 3300041496 Ga0451839_0099676 Ga0451839_0099676_196_582 128
275 3300041498 Ga0451841_0741888 Ga0451841_0741888_6645_7037 128
276 3300041501 Ga0451845_0249129 Ga0451845_0249129_16599_16991 128
277 3300041503 Ga0451847_0341155 Ga0451847_0341155_16599_16991 128
278 3300041505 Ga0451849_1508595 Ga0451849_1508595_200_586 128
279 3300041507 Ga0451851_1180298 Ga0451851_1180298_16502_16894 128
280 3300041509 Ga0451843_0458898 Ga0451843_0458898_18_404 128
281 3300041509 Ga0451843_1179278 Ga0451843_1179278_286_678 128
282 3300041511 Ga0451855_1003632 Ga0451855_1003632_1417_1809 128
283 3300041512 Ga0451853_2474193 Ga0451853_2474193_5559_5951 128
284 3300041512 Ga0451853_3486518 Ga0451853_3486518_36_422 128
285 3300044694 Ga0466963_0118145 Ga0466963_0118145_544_930 128
286 3300044706 Ga0466964_0033175 Ga0466964_0033175_326_712 128
287 3300044765 Ga0466970_0000134 Ga0466970_0000134_9718_10104 128
288 3300044842 Ga0466957_0023170 Ga0466957_0023170_1122_1508 128
289 3300045836 Ga0466958_0057997 Ga0466958_0057997_1679_2065 128
290 3300045976 Ga0466967_0385585 Ga0466967_0385585_651_1037 128
291 3300046460 Ga0495638_0248486 Ga0495638_0248486_474_866 128
292 3300046506 Ga0495583_0037579 Ga0495583_0037579_1185_1577 128
293 3300046518 Ga0495631_0005680 Ga0495631_0005680_5973_6365 128
294 3300046519 Ga0495632_0151058 Ga0495632_0151058_365_757 128
295 3300046524 Ga0495648_0016603 Ga0495648_0016603_3435_3827 128
296 3300046558 Ga0495633_0060470 Ga0495633_0060470_380_772 128
297 3300046558 Ga0495633_0297827 Ga0495633_0297827_26_418 128
298 3300046648 Ga0495611_0057457 Ga0495611_0057457_120_512 128
299 3300046660 Ga0495625_0068155 Ga0495625_0068155_599_991 128
300 3300046660 Ga0495625_0123196 Ga0495625_0123196_277_669 128
301 3300046674 Ga0495588_0219388 Ga0495588_0219388_57_449 128
302 3300046675 Ga0495657_0037895 Ga0495657_0037895_128_520 128
303 3300046809 Ga0495600_0034731 Ga0495600_0034731_2738_3130 128
304 3300047470 Ga0495681_0001771 Ga0495681_0001771_5967_6359 128
305 3300047472 Ga0495686_0021447 Ga0495686_0021447_2960_3346 128
306 3300048905 Ga0496102_0595396 Ga0496102_0595396_58_444 128
307 3300048905 Ga0496102_0689919 Ga0496102_0689919_23_427 128
308 3300048906 Ga0496103_0087163 Ga0496103_0087163_946_1350 128
309 3300048911 Ga0496108_0351980 Ga0496108_0351980_884_1270 128
310 3300048911 Ga0496108_0355976 Ga0496108_0355976_191_598 128
311 3300048918 Ga0496115_0691951 Ga0496115_0691951_151_555 128
312 3300048919 Ga0496116_0263872 Ga0496116_0263872_54_440 128
313 3300048922 Ga0496119_0008841 Ga0496119_0008841_1846_2232 128
314 3300048922 Ga0496119_0225274 Ga0496119_0225274_219_608 128
315 3300048923 Ga0496120_0001458 Ga0496120_0001458_24019_24444 128
316 3300048923 Ga0496120_0009210 Ga0496120_0009210_2934_3323 128
317 3300048923 Ga0496120_0047615 Ga0496120_0047615_971_1357 128
318 3300048924 Ga0496121_0041666 Ga0496121_0041666_915_1319 128
319 3300048925 Ga0496122_0060753 Ga0496122_0060753_2360_2746 128
320 3300048926 Ga0496123_0043835 Ga0496123_0043835_862_1248 128
321 3300048927 Ga0496124_0172836 Ga0496124_0172836_75_461 128
322 3300048928 Ga0496125_0198444 Ga0496125_0198444_773_1159 128
323 3300048928 Ga0496125_0217848 Ga0496125_0217848_746_1138 128
324 3300048929 Ga0496126_0024496 Ga0496126_0024496_2778_3182 128
325 3300049571 Ga0501034_0182006 Ga0501034_0182006_151_537 128
326 3300049571 Ga0501034_0352790 Ga0501034_0352790_757_1149 128
327 3300049571 Ga0501034_0531112 Ga0501034_0531112_220_612 128
328 3300049579 Ga0501043_0984466 Ga0501043_0984466_10_396 128
329 3300049586 Ga0501070_0533728 Ga0501070_0533728_387_779 128
330 3300049588 Ga0501072_1092685 Ga0501072_1092685_202_588 128
331 3300049674 Ga0501242_048663 Ga0501242_048663_22_411 128
332 3300049776 Ga0501280_004569 Ga0501280_004569_1591_1983 128
333 3300049822 Ga0501035_0255763 Ga0501035_0255763_696_1088 128
334 3300049823 Ga0501044_0102592 Ga0501044_0102592_2109_2501 128
335 3300049823 Ga0501044_1395507 Ga0501044_1395507_74_460 128
336 3300049823 Ga0501044_1453584 Ga0501044_1453584_137_523 128
337 3300050490 nmdc:mga03n38_147311_c1 nmdc:mga03n38_147311_c1_235_621 128
338 3300050492 nmdc:mga0yw44_153537_c1 nmdc:mga0yw44_153537_c1_758_1165 128
339 3300050492 nmdc:mga0yw44_913867_c1 nmdc:mga0yw44_913867_c1_12_398 128
340 3300050493 nmdc:mga0k408_706050_c1 nmdc:mga0k408_706050_c1_47_436 128
341 3300053077 Ga0495601_0893068 Ga0495601_0893068_124_510 128
342 3300053083 Ga0495655_0039798 Ga0495655_0039798_431_817 128
343 3300053086 Ga0500578_0672558 Ga0500578_0672558_87_479 128
344 3300053090 Ga0500646_0096823 Ga0500646_0096823_484_876 128
345 3300053104 Ga0500556_0151414 Ga0500556_0151414_68_460 128
346 3300053122 Ga0500608_010188 Ga0500608_010188_1536_1928 128
347 3300053125 Ga0500618_000334 Ga0500618_000334_11686_12072 128
348 3300053125 Ga0500618_014708 Ga0500618_014708_1003_1395 128
349 3300053148 Ga0500590_000050 Ga0500590_000050_3335_3727 128
350 3300053153 Ga0500616_0000210 Ga0500616_0000210_46346_46741 128
351 3300053158 Ga0500627_0099457 Ga0500627_0099457_371_763 128
352 3300053177 Ga0500636_0046425 Ga0500636_0046425_2097_2489 128
353 3300053177 Ga0500636_0090064 Ga0500636_0090064_184_570 128
354 3300053735 Ga0500596_036142 Ga0500596_036142_257_643 128
355 3300060353 Ga0501082_0184198 Ga0501082_0184198_649_1041 128
356 iso_pu_bacteria 2844002411 2844008705 128
357 iso_pu_bacteria 2869285874 2869287018 128
358 iso_pu_bacteria 2871429161 2871434324 128
359 iso_pu_bacteria 2874146452 2874147459 128
360 iso_pu_bacteria 2874155637 2874156465 128
361 iso_pu_bacteria 2876413966 2876414653 128
362 iso_pu_bacteria 2878738818 2878745846 128
363 iso_pu_bacteria 2878745973 2878747199 128
364 iso_pu_bacteria 2906308376 2906309371 128
365 iso_pu_bacteria 2906321335 2906327021 128
366 iso_pu_bacteria 2924776078 2924784245 128
367 iso_pu_bacteria 2937813078 2937813730 128
368 iso_pu_bacteria 2958041894 2958042002 128
369 iso_pu_bacteria 2958130278 2958131417 128
370 iso_pu_bacteria 2958144490 2958146974 128
371 iso_pu_bacteria 2958179912 2958181242 128
372 iso_pu_bacteria 2961077736 2961079080 128
373 iso_pu_bacteria 2970593180 2970599353 128
374 iso_pu_bacteria 2977843712 2977843878 128
375 iso_pu_bacteria 8004387939 8004390436 128
376 iso_pu_bacteria 8004714634 8004715629 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02962

CHMI

5-carboxymethyl-2-hydroxymuconate isomerase

29

152

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.9179 3 119
4jcu-assembly1.cif.gz_A crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from deinococcus radiodurans r1 0.8989 2 126
4jj9-assembly1.cif.gz_B crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase 0.8931 1 120
4jcu-assembly1.cif.gz_A crystal structure of a 5-carboxymethyl-2-hydroxymuconate isomerase from deinococcus radiodurans r1 0.8728 2 126
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.8562 3 119
ID Description Score Start End Superfamily
1otgC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.9179 3 119 3.30.429.10
4jcuB00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8971 2 121 3.30.429.10
4jj9C00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8656 2 120 3.30.429.10
1otgC00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.8562 3 119 3.30.429.10
4nwpH00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.811 3 120 3.30.429.10
ID Description Score Start End GO Terms
AF-K0WHQ6-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9871 1 78 GO:0008704
GO:0009056
AF-A0A529P083-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9765 1 109 GO:0008704
GO:0009056
AF-A0A3S1ELA3-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9757 1 66 GO:0008704
GO:0009056
AF-A0A529P083-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9678 1 109 GO:0008704
GO:0009056
AF-A0A357LUY5-F1-model_v4 Uncharacterized protein 0.9632 1 83 GO:0008704
GO:0009056

Feature Viewer

pLDDT pTM Quality
91.17 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map