F427325

General Info

Members Datasets Scaffolds Average Seq Length
376 197 752 162

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000052|Ga0111539_1000005225
Length 164
Sequence MAQEFSFDVVSKSDMQEVTNAVVQAQKELAQRFDFKGSKSSIELTAEELVLVSDDEGKLVSVKDILETKLVKRKVSLKALDYGKIEQAAGGTVRQKAKIVQGIEIEKAKAIVKTIKDAKVKVQASIQADQVRVVGRSKDDLQKAMTLVRETDYGIPLQFTNYRG

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
120 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
121 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
126 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0
Rhizoplane 8.24
Rhizosphere 88.3
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10000052 3300009094 Bacteria 116307
2 JGI25407J50210_10023283 3300003373 Bacteria 1608
3 JGI25405J52794_10043448 3300003911 Bacteria 954
4 Ga0065715_10216869 3300005293 Bacteria 1289
5 Ga0065707_10101833 3300005295 Bacteria 2843
6 Ga0070690_100503412 3300005330 Bacteria 907
7 Ga0070691_10622167 3300005341 Bacteria 640
8 Ga0070674_101288056 3300005356 Bacteria 651
9 Ga0070673_100807314 3300005364 Bacteria 866
10 Ga0070688_100290532 3300005365 Bacteria 1178
11 Ga0070714_100036157 3300005435 Bacteria 4142
12 Ga0070705_100317604 3300005440 Bacteria 1123
13 Ga0070694_100537330 3300005444 Bacteria 935
14 Ga0070678_100249390 3300005456 Bacteria 1488
15 Ga0070678_101320266 3300005456 Bacteria 672
16 Ga0070681_10435696 3300005458 Bacteria 1223
17 Ga0070707_100943833 3300005468 Bacteria 827
18 Ga0070698_100256647 3300005471 Bacteria 1680
19 Ga0070699_100353705 3300005518 Bacteria 1323
20 Ga0070697_100193752 3300005536 Bacteria 1725
21 Ga0070672_100110692 3300005543 Bacteria 2238
22 Ga0070686_100347323 3300005544 Bacteria 1114
23 Ga0070686_100850646 3300005544 Bacteria 739
24 Ga0070695_100078961 3300005545 Bacteria 2171
25 Ga0070693_100250533 3300005547 Bacteria 1174
26 Ga0070665_101298412 3300005548 Bacteria 738
27 Ga0070704_100025208 3300005549 Bacteria 3913
28 Ga0068859_100712846 3300005617 Bacteria 1094
29 Ga0081455_10007492 3300005937 Bacteria 11485
30 Ga0081455_10027213 3300005937 Bacteria 5241
31 Ga0081455_10040891 3300005937 Bacteria 4085
32 Ga0081455_10058864 3300005937 Bacteria 3248
33 Ga0081455_10083341 3300005937 Bacteria 2613
34 Ga0081455_10417835 3300005937 Bacteria 926
35 Ga0081538_10001704 3300005981 Bacteria 22405
36 Ga0081538_10020143 3300005981 Bacteria 4926
37 Ga0081538_10079859 3300005981 Bacteria 1748
38 Ga0081540_1166742 3300005983 Bacteria 845
39 Ga0075363_100391316 3300006048 Bacteria 816
40 Ga0075364_10130157 3300006051 Bacteria 1689
41 Ga0075432_10037977 3300006058 Bacteria 1677
42 Ga0075367_10019849 3300006178 Bacteria 3733
43 Ga0075367_10100977 3300006178 Bacteria 1764
44 Ga0075428_100012291 3300006844 Bacteria 9521
45 Ga0075428_100016017 3300006844 Bacteria 8292
46 Ga0075428_100056338 3300006844 Bacteria 4306
47 Ga0075428_100073511 3300006844 Bacteria 3734
48 Ga0075428_100088383 3300006844 Bacteria 3380
49 Ga0075428_100217262 3300006844 Bacteria 2065
50 Ga0075428_100442935 3300006844 Bacteria 1391
51 Ga0075428_101239256 3300006844 Bacteria 786
52 Ga0075430_100003891 3300006846 Bacteria 12576
53 Ga0075430_100007074 3300006846 Bacteria 9460
54 Ga0075430_100042419 3300006846 Bacteria 3847
55 Ga0075430_100060657 3300006846 Bacteria 3179
56 Ga0075430_100248033 3300006846 Bacteria 1475
57 Ga0075430_100758873 3300006846 Bacteria 799
58 Ga0075430_101063611 3300006846 Bacteria 666
59 Ga0075431_100020602 3300006847 Bacteria 6739
60 Ga0075431_100029699 3300006847 Bacteria 5628
61 Ga0075431_100203437 3300006847 Bacteria 2025
62 Ga0075431_100235036 3300006847 Bacteria 1866
63 Ga0075431_100265944 3300006847 Bacteria 1739
64 Ga0075431_100539542 3300006847 Bacteria 1154
65 Ga0075433_10001327 3300006852 Bacteria 18108
66 Ga0075433_10603594 3300006852 Bacteria 963
67 Ga0075429_100006787 3300006880 Bacteria 9927
68 Ga0075429_100020034 3300006880 Bacteria 5799
69 Ga0075429_100027171 3300006880 Bacteria 4967
70 Ga0075429_100111590 3300006880 Bacteria 2390
71 Ga0075429_100231216 3300006880 Bacteria 1619
72 Ga0075429_100308031 3300006880 Bacteria 1386
73 Ga0075429_101149679 3300006880 Bacteria 678
74 Ga0075436_100003175 3300006914 Bacteria 11273
75 Ga0097620_100712897 3300006931 Bacteria 1094
76 Ga0075435_100006706 3300007076 Bacteria 8165
77 Ga0075435_100186019 3300007076 Bacteria 1756
78 Ga0111539_10025340 3300009094 Bacteria 7270
79 Ga0111539_10055048 3300009094 Bacteria 4730
80 Ga0111539_10260810 3300009094 Bacteria 2017
81 Ga0111539_10379156 3300009094 Bacteria 1646
82 Ga0111539_10442554 3300009094 Bacteria 1513
83 Ga0111539_10846108 3300009094 Bacteria 1064
84 Ga0111539_11050921 3300009094 Bacteria 947
85 Ga0111539_11458263 3300009094 Bacteria 794
86 Ga0111539_11477535 3300009094 Bacteria 788
87 Ga0105245_10398954 3300009098 Bacteria 1374
88 Ga0105245_11709800 3300009098 Bacteria 681
89 Ga0105247_10435415 3300009101 Bacteria 942
90 Ga0114129_10007056 3300009147 Bacteria 15994
91 Ga0114129_10040449 3300009147 Bacteria 6572
92 Ga0114129_10079098 3300009147 Bacteria 4572
93 Ga0114129_10214618 3300009147 Bacteria 2599
94 Ga0114129_10428243 3300009147 Bacteria 1739
95 Ga0114129_10894703 3300009147 Bacteria 1125
96 Ga0114129_10985446 3300009147 Bacteria 1062
97 Ga0114129_11354589 3300009147 Bacteria 880
98 Ga0114129_13351246 3300009147 Bacteria 517
99 Ga0105243_10561771 3300009148 Bacteria 1092
100 Ga0105243_10850138 3300009148 Bacteria 903
101 Ga0105243_12193782 3300009148 Bacteria 589
102 Ga0105242_10687661 3300009176 Bacteria 999
103 Ga0105242_11053041 3300009176 Bacteria 825
104 Ga0105248_10738742 3300009177 Bacteria 1110
105 Ga0105238_11120262 3300009551 Bacteria 810
106 Ga0105239_12244768 3300010375 Bacteria 635
107 Ga0157369_10172697 3300013105 Bacteria 2277
108 Ga0157378_10352528 3300013297 Bacteria 1438
109 Ga0157378_10977669 3300013297 Bacteria 880
110 Ga0157378_11154074 3300013297 Bacteria 813
111 Ga0163162_10800388 3300013306 Bacteria 1060
112 Ga0163162_12108609 3300013306 Bacteria 647
113 Ga0157375_11101193 3300013308 Bacteria 930
114 Ga0163163_11017702 3300014325 Bacteria 892
115 Ga0163163_11356550 3300014325 Bacteria 773
116 Ga0157379_10519333 3300014968 Unclassified 1105
117 Ga0157376_12013136 3300014969 Bacteria 615
118 Ga0206353_10081431 3300020082 Bacteria 675
119 Ga0213875_10263917 3300021388 Bacteria 812
120 Ga0207710_10286045 3300025900 Bacteria 830
121 Ga0207685_10333553 3300025905 Bacteria 760
122 Ga0207695_11024539 3300025913 Bacteria 705
123 Ga0207646_10221902 3300025922 Bacteria 1707
124 Ga0207646_10298619 3300025922 Bacteria 1455
125 Ga0207694_11493458 3300025924 Bacteria 570
126 Ga0207687_10132655 3300025927 Bacteria 1880
127 Ga0207687_11261227 3300025927 Bacteria 635
128 Ga0207700_10909100 3300025928 Bacteria 788
129 Ga0207664_10068748 3300025929 Bacteria 2846
130 Ga0207644_11617695 3300025931 Bacteria 543
131 Ga0207706_10155628 3300025933 Bacteria 2010
132 Ga0207686_11455879 3300025934 Bacteria 564
133 Ga0207709_10652250 3300025935 Bacteria 838
134 Ga0207691_10217385 3300025940 Bacteria 1658
135 Ga0207667_10518841 3300025949 Bacteria 1207
136 Ga0207651_10962621 3300025960 Bacteria 762
137 Ga0207712_10159003 3300025961 Bacteria 1754
138 Ga0207677_10352256 3300026023 Bacteria 1234
139 Ga0207678_10236207 3300026067 Bacteria 1565
140 Ga0207708_10518610 3300026075 Bacteria 1001
141 Ga0207683_10488288 3300026121 Bacteria 1137
142 Ga0207428_10000003 3300027907 Bacteria 799783
143 Ga0207428_10027853 3300027907 Bacteria 4700
144 Ga0265326_10105469 3300028558 Bacteria 800
145 Ga0265334_10143867 3300028573 Bacteria 843
146 Ga0265336_10034560 3300028666 Bacteria 1562
147 Ga0265338_10002337 3300028800 Bacteria 28651
148 Ga0265338_10468165 3300028800 Unclassified 890
149 Ga0265330_10079186 3300031235 Bacteria 1417
150 Ga0265325_10005150 3300031241 Bacteria 8132
151 Ga0265339_10006324 3300031249 Bacteria 7786
152 Ga0265331_10184620 3300031250 Bacteria 941
153 Ga0265327_10003346 3300031251 Bacteria 15471
154 Ga0265327_10164982 3300031251 Bacteria 1021
155 Ga0265327_10195862 3300031251 Bacteria 917
156 Ga0265316_10053393 3300031344 Bacteria 3167
157 Ga0265313_10006704 3300031595 Bacteria 8063
158 Ga0265313_10225168 3300031595 Bacteria 772
159 Ga0265314_10048711 3300031711 Bacteria 2971
160 Ga0265314_10355725 3300031711 Bacteria 804
161 Ga0316576_10001293 3300031727 Bacteria 13302
162 Ga0316578_10061861 3300031728 Bacteria 2206
163 Ga0307413_10904522 3300031824 Bacteria 750
164 Ga0307406_11511403 3300031901 Bacteria 591
165 Ga0307407_10258497 3300031903 Bacteria 1197
166 Ga0307409_100074515 3300031995 Bacteria 2713
167 Ga0307409_100859009 3300031995 Bacteria 919
168 Ga0307416_100203841 3300032002 Bacteria 1880
169 Ga0307416_100707718 3300032002 Bacteria 1097
170 Ga0307416_101068898 3300032002 Bacteria 911
171 Ga0316583_10025211 3300032133 Bacteria 2124
172 Ga0316585_10067059 3300032137 Bacteria 1163
173 Ga0316580_10074094 3300032139 Bacteria 1042
174 Ga0373923_0053700 3300035111 Bacteria 1695
175 Ga0373936_0138464 3300035113 Bacteria 1050
176 Ga0373936_0178524 3300035113 Bacteria 931
177 Ga0373956_0235059 3300035119 Bacteria 871
178 Ga0373943_0030579 3300035170 Bacteria 2550
179 Ga0373955_0156696 3300035172 Bacteria 1342
180 Ga0316574_0004367 3300035398 Bacteria 7395
181 Ga0316574_0018872 3300035398 Bacteria 4061
182 Ga0316574_0306621 3300035398 Bacteria 1009
183 Ga0373935_0061503 3300035692 Bacteria 2404
184 Ga0373947_0202832 3300035725 Bacteria 1298
185 Ga0373937_0043564 3300036401 Bacteria 4098
186 Ga0316582_0030076 3300036647 Bacteria 3305
187 Ga0316584_0000507 3300036712 Bacteria 20573
188 Ga0373925_0594627 3300037068 Bacteria 911
189 Ga0436364_0575590 3300037853 Bacteria 895
190 Ga0400483_008911 3300039062 Bacteria 1747
191 Ga0400483_189129 3300039062 Bacteria 4186
192 Ga0451793_0327896 3300041452 Bacteria 593
193 Ga0451795_1408602 3300041456 Bacteria 950
194 Ga0451802_0325013 3300041460 Bacteria 1038
195 Ga0439463_007231 3300042016 Bacteria 2742
196 Ga0450915_007569 3300042119 Bacteria 712
197 Ga0450888_009866 3300042126 Bacteria 1098
198 Ga0439434_0032228 3300042435 Bacteria 1594
199 Ga0439444_0012674 3300042437 Bacteria 1385
200 Ga0439460_0037410 3300042461 Bacteria 1411
201 Ga0450901_009594 3300042533 Bacteria 1000
202 Ga0439440_0038747 3300042993 Bacteria 1154
203 Ga0466966_0101172 3300044684 Bacteria 1782
204 Ga0466966_0213118 3300044684 Bacteria 1167
205 Ga0466970_0918806 3300044765 Bacteria 515
206 Ga0466967_1095061 3300045976 Bacteria 794
207 Ga0495592_0272512 3300046454 Bacteria 1110
208 Ga0495592_0683110 3300046454 Bacteria 619
209 Ga0495629_0271868 3300046459 Bacteria 1164
210 Ga0495662_0128834 3300046476 Bacteria 1244
211 Ga0495665_0267647 3300046531 Bacteria 878
212 Ga0495588_0053777 3300046674 Bacteria 2077
213 Ga0495613_0209349 3300046689 Bacteria 1372
214 Ga0495581_0231952 3300047315 Bacteria 1080
215 Ga0495674_0671189 3300047319 Bacteria 816
216 Ga0495674_0687045 3300047319 Bacteria 804
217 Ga0495672_0009825 3300047320 Bacteria 6883
218 Ga0495684_0176546 3300047471 Bacteria 1586
219 Ga0496101_0951866 3300048904 Bacteria 676
220 Ga0496102_0583456 3300048905 Bacteria 1041
221 Ga0496102_0661209 3300048905 Bacteria 968
222 Ga0496102_0860510 3300048905 Bacteria 829
223 Ga0496104_0337182 3300048907 Bacteria 1421
224 Ga0496104_0620530 3300048907 Bacteria 991
225 Ga0496105_0427672 3300048908 Bacteria 1048
226 Ga0496105_0962815 3300048908 Bacteria 640
227 Ga0496108_0158265 3300048911 Bacteria 1957
228 Ga0496108_0465226 3300048911 Bacteria 1105
229 Ga0496108_1067932 3300048911 Bacteria 687
230 Ga0496108_1126320 3300048911 Bacteria 666
231 Ga0496109_0001750 3300048912 Bacteria 18101
232 Ga0496109_0192882 3300048912 Bacteria 1914
233 Ga0496109_0446262 3300048912 Bacteria 1222
234 Ga0496110_0055305 3300048913 Bacteria 3492
235 Ga0496110_0172957 3300048913 Bacteria 1960
236 Ga0496110_0261145 3300048913 Bacteria 1576
237 Ga0496110_0359914 3300048913 Bacteria 1326
238 Ga0496110_0695026 3300048913 Bacteria 918
239 Ga0496110_0773697 3300048913 Bacteria 864
240 Ga0496111_0055110 3300048914 Bacteria 2875
241 Ga0496112_0002507 3300048915 Bacteria 14816
242 Ga0496112_0103647 3300048915 Bacteria 2815
243 Ga0496112_0811751 3300048915 Bacteria 860
244 Ga0496113_0047989 3300048916 Bacteria 3176
245 Ga0496113_0613388 3300048916 Bacteria 871
246 Ga0496114_0232993 3300048917 Bacteria 1618
247 Ga0501033_0039835 3300049570 Bacteria 3509
248 Ga0501034_0000981 3300049571 Bacteria 41010
249 Ga0501034_0103958 3300049571 Bacteria 2834
250 Ga0501036_0113467 3300049572 Bacteria 2290
251 Ga0501037_0058693 3300049573 Unclassified 2807
252 Ga0501037_0095253 3300049573 Bacteria 2152
253 Ga0501038_0094747 3300049574 Bacteria 2495
254 Ga0501038_0099063 3300049574 Bacteria 2430
255 Ga0501039_0010882 3300049575 Bacteria 6933
256 Ga0501039_0226524 3300049575 Bacteria 1469
257 Ga0501040_0042425 3300049576 Bacteria 3098
258 Ga0501040_0271565 3300049576 Bacteria 1211
259 Ga0501041_0037881 3300049577 Bacteria 2923
260 Ga0501041_0248814 3300049577 Bacteria 1117
261 Ga0501042_0070327 3300049578 Bacteria 2503
262 Ga0501042_0082957 3300049578 Bacteria 2298
263 Ga0501046_0089613 3300049580 Bacteria 2367
264 Ga0501046_0185796 3300049580 Bacteria 1552
265 Ga0501047_0339000 3300049581 Bacteria 1341
266 Ga0501048_0509861 3300049582 Bacteria 863
267 Ga0501067_0082088 3300049583 Bacteria 1787
268 Ga0501068_0040001 3300049584 Bacteria 2813
269 Ga0501068_0049136 3300049584 Unclassified 2547
270 Ga0501069_0000507 3300049585 Bacteria 17772
271 Ga0501070_0000438 3300049586 Bacteria 37824
272 Ga0501070_0436099 3300049586 Bacteria 1057
273 Ga0501070_0756662 3300049586 Bacteria 765
274 Ga0501071_0026314 3300049587 Bacteria 4083
275 Ga0501071_0049292 3300049587 Bacteria 3031
276 Ga0501071_0108318 3300049587 Bacteria 2052
277 Ga0501072_0000715 3300049588 Bacteria 24088
278 Ga0501072_0032255 3300049588 Bacteria 4103
279 Ga0501072_0035704 3300049588 Bacteria 3895
280 Ga0501072_0403050 3300049588 Bacteria 1085
281 Ga0501072_1260966 3300049588 Bacteria 573
282 Ga0501073_0000123 3300049589 Bacteria 50179
283 Ga0501073_0145526 3300049589 Bacteria 1642
284 Ga0501073_0192663 3300049589 Bacteria 1411
285 Ga0501073_0214279 3300049589 Bacteria 1331
286 Ga0501073_0426062 3300049589 Bacteria 917
287 Ga0501074_0004568 3300049590 Bacteria 9909
288 Ga0501074_0021698 3300049590 Bacteria 4663
289 Ga0501074_0182451 3300049590 Bacteria 1497
290 Ga0501075_0047976 3300049591 Bacteria 3209
291 Ga0501075_0258129 3300049591 Bacteria 1328
292 Ga0501075_0650500 3300049591 Bacteria 804
293 Ga0501076_0045500 3300049592 Bacteria 3465
294 Ga0501076_0054211 3300049592 Bacteria 3177
295 Ga0501076_0198701 3300049592 Bacteria 1637
296 Ga0501077_0028845 3300049593 Bacteria 3527
297 Ga0501077_0052509 3300049593 Bacteria 2588
298 Ga0501079_0038745 3300049741 Bacteria 3675
299 Ga0501079_0106244 3300049741 Bacteria 2178
300 Ga0501079_0858694 3300049741 Bacteria 715
301 Ga0501080_0014723 3300049742 Bacteria 7202
302 Ga0501080_0111577 3300049742 Bacteria 2535
303 Ga0501080_0477981 3300049742 Bacteria 1115
304 Ga0501080_0683884 3300049742 Bacteria 906
305 Ga0501081_0073474 3300049743 Bacteria 2385
306 Ga0501083_0334939 3300049744 Bacteria 984
307 Ga0501083_0541518 3300049744 Bacteria 758
308 Ga0501035_0347201 3300049822 Bacteria 1242
309 Ga0501035_0456406 3300049822 Bacteria 1057
310 Ga0501045_0010469 3300049824 Bacteria 6495
311 Ga0501045_0407709 3300049824 Bacteria 1011
312 Ga0501045_0412428 3300049824 Bacteria 1005
313 nmdc:mga03n38_313500_c1 3300050490 Bacteria 845
314 nmdc:mga03n38_64640_c1 3300050490 Bacteria 1675
315 nmdc:mga0k408_827553_c1 3300050493 Bacteria 539
316 nmdc:mga06z11_471746_c1 3300050494 Bacteria 759
317 nmdc:mga06z11_590079_c1 3300050494 Bacteria 676
318 nmdc:mga05p37_110237_c1 3300050507 Bacteria 3386
319 nmdc:mga05p37_1319942_c1 3300050507 Bacteria 734
320 nmdc:mga05p37_14317_c2 3300050507 Bacteria 5672
321 nmdc:mga05p37_305731_c1 3300050507 Bacteria 1887
322 nmdc:mga05p37_3834_c1 3300050507 Bacteria 17590
323 nmdc:mga05p37_39851_c1 3300050507 Bacteria 5769
324 nmdc:mga05p37_463462_c1 3300050507 Bacteria 1177
325 nmdc:mga05p37_652695_c1 3300050507 Bacteria 1178
326 nmdc:mga05p37_776344_c1 3300050507 Bacteria 1052
327 nmdc:mga05p37_813056_c1 3300050507 Bacteria 1021
328 nmdc:mga09592_181498_c1 3300050508 Bacteria 1821
329 nmdc:mga09592_183_c1 3300050508 Bacteria 44709
330 nmdc:mga09592_18688_c1 3300050508 Bacteria 5685
331 nmdc:mga09592_204373_c1 3300050508 Bacteria 1711
332 nmdc:mga09592_256188_c1 3300050508 Bacteria 1517
333 nmdc:mga09592_296915_c1 3300050508 Bacteria 1401
334 nmdc:mga09592_486642_c1 3300050508 Bacteria 1063
335 nmdc:mga09592_51699_c1 3300050508 Bacteria 3467
336 nmdc:mga09592_955983_c1 3300050508 Bacteria 718
337 nmdc:mga0qj67_120891_c1 3300050509 Bacteria 2119
338 nmdc:mga0qj67_143368_c1 3300050509 Bacteria 1937
339 nmdc:mga0qj67_33837_c1 3300050509 Bacteria 3989
340 nmdc:mga0qj67_455960_c1 3300050509 Bacteria 1030
341 nmdc:mga0qj67_538913_c1 3300050509 Bacteria 937
342 nmdc:mga0qj67_55554_c1 3300050509 Bacteria 3137
343 nmdc:mga0qj67_6984_c1 3300050509 Bacteria 8316
344 nmdc:mga06r32_1141931_c1 3300050510 Bacteria 727
345 nmdc:mga06r32_120862_c1 3300050510 Bacteria 2584
346 nmdc:mga06r32_326879_c1 3300050510 Bacteria 1519
347 nmdc:mga06r32_33379_c1 3300050510 Bacteria 4848
348 nmdc:mga06r32_359670_c1 3300050510 Bacteria 1440
349 nmdc:mga06r32_54591_c1 3300050510 Bacteria 3832
350 nmdc:mga06r32_633751_c1 3300050510 Bacteria 1038
351 nmdc:mga06r32_651_c1 3300050510 Bacteria 30303
352 nmdc:mga06r32_88696_c1 3300050510 Bacteria 3019
353 nmdc:mga06r32_9213_c1 3300050510 Bacteria 8902
354 nmdc:mga08y16_242695_c1 3300050511 Bacteria 1862
355 nmdc:mga08y16_43891_c1 3300050511 Bacteria 4685
356 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
357 nmdc:mga08y16_83995_c1 3300050511 Bacteria 3319
358 nmdc:mga08y16_956396_c1 3300050511 Bacteria 839
359 nmdc:mga0n895_134920_c1 3300050512 Bacteria 2495
360 nmdc:mga0n895_46872_c1 3300050512 Bacteria 4224
361 nmdc:mga0rr50_4288_c1 3300050513 Bacteria 8350
362 nmdc:mga08x19_5120_c1 3300050514 Bacteria 7751
363 nmdc:mga08x19_604549_c1 3300050514 Bacteria 777
364 nmdc:mga0a205_22551_c1 3300050515 Bacteria 5966
365 Ga0495601_0331386 3300053077 Bacteria 991
366 Ga0495612_0103526 3300053078 Bacteria 1214
367 Ga0495619_0088392 3300053085 Bacteria 2096
368 Ga0501084_0014588 3300054114 Bacteria 6514
369 Ga0501084_0074403 3300054114 Bacteria 2844
370 Ga0501084_0396448 3300054114 Bacteria 1166
371 Ga0501084_0416266 3300054114 Bacteria 1136
372 Ga0501082_0028660 3300060353 Bacteria 4796
373 Ga0501082_0149353 3300060353 Bacteria 2029
374 Ga0501082_0203041 3300060353 Bacteria 1725
375 Ga0501082_1715738 3300060353 Bacteria 548
376 Ga0530510_0003270 3300061734 Bacteria 11144
377 Ga0111539_10000052
378 JGI25407J50210_10023283
379 JGI25405J52794_10043448
380 Ga0065715_10216869
381 Ga0065707_10101833
382 Ga0070690_100503412
383 Ga0070691_10622167
384 Ga0070674_101288056
385 Ga0070673_100807314
386 Ga0070688_100290532
387 Ga0070714_100036157
388 Ga0070705_100317604
389 Ga0070694_100537330
390 Ga0070678_100249390
391 Ga0070678_101320266
392 Ga0070681_10435696
393 Ga0070707_100943833
394 Ga0070698_100256647
395 Ga0070699_100353705
396 Ga0070697_100193752
397 Ga0070672_100110692
398 Ga0070686_100347323
399 Ga0070686_100850646
400 Ga0070695_100078961
401 Ga0070693_100250533
402 Ga0070665_101298412
403 Ga0070704_100025208
404 Ga0068859_100712846
405 Ga0081455_10007492
406 Ga0081455_10027213
407 Ga0081455_10040891
408 Ga0081455_10058864
409 Ga0081455_10083341
410 Ga0081455_10417835
411 Ga0081538_10001704
412 Ga0081538_10020143
413 Ga0081538_10079859
414 Ga0081540_1166742
415 Ga0075363_100391316
416 Ga0075364_10130157
417 Ga0075432_10037977
418 Ga0075367_10019849
419 Ga0075367_10100977
420 Ga0075428_100012291
421 Ga0075428_100016017
422 Ga0075428_100056338
423 Ga0075428_100073511
424 Ga0075428_100088383
425 Ga0075428_100217262
426 Ga0075428_100442935
427 Ga0075428_101239256
428 Ga0075430_100003891
429 Ga0075430_100007074
430 Ga0075430_100042419
431 Ga0075430_100060657
432 Ga0075430_100248033
433 Ga0075430_100758873
434 Ga0075430_101063611
435 Ga0075431_100020602
436 Ga0075431_100029699
437 Ga0075431_100203437
438 Ga0075431_100235036
439 Ga0075431_100265944
440 Ga0075431_100539542
441 Ga0075433_10001327
442 Ga0075433_10603594
443 Ga0075429_100006787
444 Ga0075429_100020034
445 Ga0075429_100027171
446 Ga0075429_100111590
447 Ga0075429_100231216
448 Ga0075429_100308031
449 Ga0075429_101149679
450 Ga0075436_100003175
451 Ga0097620_100712897
452 Ga0075435_100006706
453 Ga0075435_100186019
454 Ga0111539_10025340
455 Ga0111539_10055048
456 Ga0111539_10260810
457 Ga0111539_10379156
458 Ga0111539_10442554
459 Ga0111539_10846108
460 Ga0111539_11050921
461 Ga0111539_11458263
462 Ga0111539_11477535
463 Ga0105245_10398954
464 Ga0105245_11709800
465 Ga0105247_10435415
466 Ga0114129_10007056
467 Ga0114129_10040449
468 Ga0114129_10079098
469 Ga0114129_10214618
470 Ga0114129_10428243
471 Ga0114129_10894703
472 Ga0114129_10985446
473 Ga0114129_11354589
474 Ga0114129_13351246
475 Ga0105243_10561771
476 Ga0105243_10850138
477 Ga0105243_12193782
478 Ga0105242_10687661
479 Ga0105242_11053041
480 Ga0105248_10738742
481 Ga0105238_11120262
482 Ga0105239_12244768
483 Ga0157369_10172697
484 Ga0157378_10352528
485 Ga0157378_10977669
486 Ga0157378_11154074
487 Ga0163162_10800388
488 Ga0163162_12108609
489 Ga0157375_11101193
490 Ga0163163_11017702
491 Ga0163163_11356550
492 Ga0157379_10519333
493 Ga0157376_12013136
494 Ga0206353_10081431
495 Ga0213875_10263917
496 Ga0207710_10286045
497 Ga0207685_10333553
498 Ga0207695_11024539
499 Ga0207646_10221902
500 Ga0207646_10298619
501 Ga0207694_11493458
502 Ga0207687_10132655
503 Ga0207687_11261227
504 Ga0207700_10909100
505 Ga0207664_10068748
506 Ga0207644_11617695
507 Ga0207706_10155628
508 Ga0207686_11455879
509 Ga0207709_10652250
510 Ga0207691_10217385
511 Ga0207667_10518841
512 Ga0207651_10962621
513 Ga0207712_10159003
514 Ga0207677_10352256
515 Ga0207678_10236207
516 Ga0207708_10518610
517 Ga0207683_10488288
518 Ga0207428_10000003
519 Ga0207428_10027853
520 Ga0265326_10105469
521 Ga0265334_10143867
522 Ga0265336_10034560
523 Ga0265338_10002337
524 Ga0265338_10468165
525 Ga0265330_10079186
526 Ga0265325_10005150
527 Ga0265339_10006324
528 Ga0265331_10184620
529 Ga0265327_10003346
530 Ga0265327_10164982
531 Ga0265327_10195862
532 Ga0265316_10053393
533 Ga0265313_10006704
534 Ga0265313_10225168
535 Ga0265314_10048711
536 Ga0265314_10355725
537 Ga0316576_10001293
538 Ga0316578_10061861
539 Ga0307413_10904522
540 Ga0307406_11511403
541 Ga0307407_10258497
542 Ga0307409_100074515
543 Ga0307409_100859009
544 Ga0307416_100203841
545 Ga0307416_100707718
546 Ga0307416_101068898
547 Ga0316583_10025211
548 Ga0316585_10067059
549 Ga0316580_10074094
550 Ga0373923_0053700
551 Ga0373936_0138464
552 Ga0373936_0178524
553 Ga0373956_0235059
554 Ga0373943_0030579
555 Ga0373955_0156696
556 Ga0316574_0004367
557 Ga0316574_0018872
558 Ga0316574_0306621
559 Ga0373935_0061503
560 Ga0373947_0202832
561 Ga0373937_0043564
562 Ga0316582_0030076
563 Ga0316584_0000507
564 Ga0373925_0594627
565 Ga0436364_0575590
566 Ga0400483_008911
567 Ga0400483_189129
568 Ga0451793_0327896
569 Ga0451795_1408602
570 Ga0451802_0325013
571 Ga0439463_007231
572 Ga0450915_007569
573 Ga0450888_009866
574 Ga0439434_0032228
575 Ga0439444_0012674
576 Ga0439460_0037410
577 Ga0450901_009594
578 Ga0439440_0038747
579 Ga0466966_0101172
580 Ga0466966_0213118
581 Ga0466970_0918806
582 Ga0466967_1095061
583 Ga0495592_0272512
584 Ga0495592_0683110
585 Ga0495629_0271868
586 Ga0495662_0128834
587 Ga0495665_0267647
588 Ga0495588_0053777
589 Ga0495613_0209349
590 Ga0495581_0231952
591 Ga0495674_0671189
592 Ga0495674_0687045
593 Ga0495672_0009825
594 Ga0495684_0176546
595 Ga0496101_0951866
596 Ga0496102_0583456
597 Ga0496102_0661209
598 Ga0496102_0860510
599 Ga0496104_0337182
600 Ga0496104_0620530
601 Ga0496105_0427672
602 Ga0496105_0962815
603 Ga0496108_0158265
604 Ga0496108_0465226
605 Ga0496108_1067932
606 Ga0496108_1126320
607 Ga0496109_0001750
608 Ga0496109_0192882
609 Ga0496109_0446262
610 Ga0496110_0055305
611 Ga0496110_0172957
612 Ga0496110_0261145
613 Ga0496110_0359914
614 Ga0496110_0695026
615 Ga0496110_0773697
616 Ga0496111_0055110
617 Ga0496112_0002507
618 Ga0496112_0103647
619 Ga0496112_0811751
620 Ga0496113_0047989
621 Ga0496113_0613388
622 Ga0496114_0232993
623 Ga0501033_0039835
624 Ga0501034_0000981
625 Ga0501034_0103958
626 Ga0501036_0113467
627 Ga0501037_0058693
628 Ga0501037_0095253
629 Ga0501038_0094747
630 Ga0501038_0099063
631 Ga0501039_0010882
632 Ga0501039_0226524
633 Ga0501040_0042425
634 Ga0501040_0271565
635 Ga0501041_0037881
636 Ga0501041_0248814
637 Ga0501042_0070327
638 Ga0501042_0082957
639 Ga0501046_0089613
640 Ga0501046_0185796
641 Ga0501047_0339000
642 Ga0501048_0509861
643 Ga0501067_0082088
644 Ga0501068_0040001
645 Ga0501068_0049136
646 Ga0501069_0000507
647 Ga0501070_0000438
648 Ga0501070_0436099
649 Ga0501070_0756662
650 Ga0501071_0026314
651 Ga0501071_0049292
652 Ga0501071_0108318
653 Ga0501072_0000715
654 Ga0501072_0032255
655 Ga0501072_0035704
656 Ga0501072_0403050
657 Ga0501072_1260966
658 Ga0501073_0000123
659 Ga0501073_0145526
660 Ga0501073_0192663
661 Ga0501073_0214279
662 Ga0501073_0426062
663 Ga0501074_0004568
664 Ga0501074_0021698
665 Ga0501074_0182451
666 Ga0501075_0047976
667 Ga0501075_0258129
668 Ga0501075_0650500
669 Ga0501076_0045500
670 Ga0501076_0054211
671 Ga0501076_0198701
672 Ga0501077_0028845
673 Ga0501077_0052509
674 Ga0501079_0038745
675 Ga0501079_0106244
676 Ga0501079_0858694
677 Ga0501080_0014723
678 Ga0501080_0111577
679 Ga0501080_0477981
680 Ga0501080_0683884
681 Ga0501081_0073474
682 Ga0501083_0334939
683 Ga0501083_0541518
684 Ga0501035_0347201
685 Ga0501035_0456406
686 Ga0501045_0010469
687 Ga0501045_0407709
688 Ga0501045_0412428
689 nmdc:mga03n38_313500_c1
690 nmdc:mga03n38_64640_c1
691 nmdc:mga0k408_827553_c1
692 nmdc:mga06z11_471746_c1
693 nmdc:mga06z11_590079_c1
694 nmdc:mga05p37_110237_c1
695 nmdc:mga05p37_1319942_c1
696 nmdc:mga05p37_14317_c2
697 nmdc:mga05p37_305731_c1
698 nmdc:mga05p37_3834_c1
699 nmdc:mga05p37_39851_c1
700 nmdc:mga05p37_463462_c1
701 nmdc:mga05p37_652695_c1
702 nmdc:mga05p37_776344_c1
703 nmdc:mga05p37_813056_c1
704 nmdc:mga09592_181498_c1
705 nmdc:mga09592_183_c1
706 nmdc:mga09592_18688_c1
707 nmdc:mga09592_204373_c1
708 nmdc:mga09592_256188_c1
709 nmdc:mga09592_296915_c1
710 nmdc:mga09592_486642_c1
711 nmdc:mga09592_51699_c1
712 nmdc:mga09592_955983_c1
713 nmdc:mga0qj67_120891_c1
714 nmdc:mga0qj67_143368_c1
715 nmdc:mga0qj67_33837_c1
716 nmdc:mga0qj67_455960_c1
717 nmdc:mga0qj67_538913_c1
718 nmdc:mga0qj67_55554_c1
719 nmdc:mga0qj67_6984_c1
720 nmdc:mga06r32_1141931_c1
721 nmdc:mga06r32_120862_c1
722 nmdc:mga06r32_326879_c1
723 nmdc:mga06r32_33379_c1
724 nmdc:mga06r32_359670_c1
725 nmdc:mga06r32_54591_c1
726 nmdc:mga06r32_633751_c1
727 nmdc:mga06r32_651_c1
728 nmdc:mga06r32_88696_c1
729 nmdc:mga06r32_9213_c1
730 nmdc:mga08y16_242695_c1
731 nmdc:mga08y16_43891_c1
732 nmdc:mga08y16_4_c1
733 nmdc:mga08y16_83995_c1
734 nmdc:mga08y16_956396_c1
735 nmdc:mga0n895_134920_c1
736 nmdc:mga0n895_46872_c1
737 nmdc:mga0rr50_4288_c1
738 nmdc:mga08x19_5120_c1
739 nmdc:mga08x19_604549_c1
740 nmdc:mga0a205_22551_c1
741 Ga0495601_0331386
742 Ga0495612_0103526
743 Ga0495619_0088392
744 Ga0501084_0014588
745 Ga0501084_0074403
746 Ga0501084_0396448
747 Ga0501084_0416266
748 Ga0501082_0028660
749 Ga0501082_0149353
750 Ga0501082_0203041
751 Ga0501082_1715738
752 Ga0530510_0003270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

5

163

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v6w-assembly1.cif.gz_Az structure of the d. melanogaster 80s ribosome 0.6637 102 159
1c0t-assembly1.cif.gz_A crystal structure of hiv-1 reverse transcriptase in complex with bm+21.1326 0.6355 106 156
7r08-assembly2.cif.gz_F abortive infection dna polymerase abi-p2 0.6349 104 158
3ofe-assembly2.cif.gz_B structured domain of drosophila melanogaster boca p41 2 2 crystal form 0.6345 99 159
5lj5-assembly1.cif.gz_C overall structure of the yeast spliceosome immediately after branching. 0.6311 89 160
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9577 99 162 3.30.70.860
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9206 9 97 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9146 9 93 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9076 9 96 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9014 9 97 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A7K0NUN1-F1-model_v4 DUF520 family protein 0.9748 99 162 GO:0000166
GO:0005829
AF-A0A537XNU2-F1-model_v4 DUF520 family protein 0.9666 99 162 GO:0000166
GO:0005829
AF-A0A094Q3A2-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9619 7 73 GO:0000166
GO:0005829
AF-A0A2V7YHM7-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9559 7 74 GO:0000166
GO:0005829
AF-A0A2V6XXA1-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9555 9 82 GO:0000166
GO:0005829

Map