F427314

General Info

Members Datasets Scaffolds Average Seq Length
376 227 752 242

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100011808|Ga0075430_1000118085
Length 249
Sequence VKTKLSASRALIDDLVAASRILAQHGVLDAYGHVSARSDRRPAHFIMSRSLAPALVAAADLMELDPDSEPLPGDKRKGFLERYIHGEIYRARPEVMAVVHSHSPSVIPFGVTRTKLRPIYHMGSFLWSGAPVFEIRNEKQDNDLLIRDRPLGKALAGTLGKCNCVLMRGHGMTVIGDGVPEAVFRAIYTEMNARLQLQAEQLEGPVEFLSDEEGRRSSRANRGTLERPWELWKRLSATPGAAARKRSKG

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 0
Rhizosphere 97.34
Stem 0
Stem Tuber 0
Unclassified 6.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100011808 3300006846 Bacteria 7434
2 Ga0065712_10139321 3300005290 Bacteria 1465
3 Ga0065707_10013199 3300005295 Unclassified 2331
4 Ga0070658_10563894 3300005327 Bacteria 986
5 Ga0070676_10031644 3300005328 Bacteria 3025
6 Ga0070683_100841018 3300005329 Unclassified 880
7 Ga0070690_100001124 3300005330 Bacteria 13751
8 Ga0070690_100251313 3300005330 Bacteria 1251
9 Ga0068869_100002534 3300005334 Bacteria 11030
10 Ga0068869_100315339 3300005334 Bacteria 1267
11 Ga0068869_100513709 3300005334 Bacteria 1002
12 Ga0070666_10070546 3300005335 Bacteria 2377
13 Ga0070680_100002028 3300005336 Bacteria 14950
14 Ga0070680_100031643 3300005336 Bacteria 4255
15 Ga0070680_100382858 3300005336 Bacteria 1198
16 Ga0070682_100006632 3300005337 Bacteria 6494
17 Ga0068868_100008911 3300005338 Bacteria 7193
18 Ga0070689_100001666 3300005340 Bacteria 14182
19 Ga0070689_100467268 3300005340 Bacteria 1076
20 Ga0070689_100473682 3300005340 Bacteria 1069
21 Ga0070691_10000212 3300005341 Bacteria 19641
22 Ga0070687_100000118 3300005343 Bacteria 26967
23 Ga0070687_100071844 3300005343 Bacteria 1861
24 Ga0070692_10001250 3300005345 Bacteria 9078
25 Ga0070692_10002381 3300005345 Bacteria 7275
26 Ga0070669_100007450 3300005353 Bacteria 7840
27 Ga0070675_100098126 3300005354 Bacteria 2464
28 Ga0070675_100220362 3300005354 Bacteria 1652
29 Ga0070674_100024652 3300005356 Bacteria 3906
30 Ga0070674_100125457 3300005356 Bacteria 1906
31 Ga0070673_100156980 3300005364 Bacteria 1931
32 Ga0070688_100324590 3300005365 Bacteria 1120
33 Ga0070659_100636275 3300005366 Bacteria 919
34 Ga0070714_100111052 3300005435 Bacteria 2427
35 Ga0070710_10067187 3300005437 Bacteria 2057
36 Ga0070701_10138358 3300005438 Bacteria 1390
37 Ga0070705_100000190 3300005440 Bacteria 35979
38 Ga0070705_100018557 3300005440 Bacteria 3648
39 Ga0070700_100001076 3300005441 Bacteria 13556
40 Ga0070700_100079008 3300005441 Unclassified 2119
41 Ga0070700_100191383 3300005441 Bacteria 1431
42 Ga0070694_100000267 3300005444 Bacteria 27580
43 Ga0070694_100117411 3300005444 Bacteria 1904
44 Ga0070681_10013501 3300005458 Bacteria 8119
45 Ga0070681_10020996 3300005458 Bacteria 6543
46 Ga0070681_10487950 3300005458 Bacteria 1145
47 Ga0070681_10538959 3300005458 Bacteria 1081
48 Ga0068867_100002498 3300005459 Bacteria 12924
49 Ga0068867_100022154 3300005459 Bacteria 4539
50 Ga0070699_100020368 3300005518 Bacteria 5720
51 Ga0070699_100267407 3300005518 Bacteria 1530
52 Ga0070699_100273903 3300005518 Unclassified 1511
53 Ga0070679_100006605 3300005530 Bacteria 10808
54 Ga0070697_100240829 3300005536 Bacteria 1545
55 Ga0068853_100100078 3300005539 Bacteria 2562
56 Ga0070672_100184987 3300005543 Bacteria 1737
57 Ga0070672_100372200 3300005543 Bacteria 1221
58 Ga0070686_100000380 3300005544 Bacteria 28368
59 Ga0070695_100001232 3300005545 Bacteria 14062
60 Ga0070695_100003903 3300005545 Bacteria 8706
61 Ga0070695_100022825 3300005545 Bacteria 3841
62 Ga0070696_100002433 3300005546 Bacteria 12341
63 Ga0070696_100007754 3300005546 Bacteria 7162
64 Ga0070696_100107035 3300005546 Bacteria 2010
65 Ga0070696_100208308 3300005546 Bacteria 1463
66 Ga0070693_100000192 3300005547 Bacteria 28451
67 Ga0070704_100000221 3300005549 Bacteria 23974
68 Ga0070704_100003469 3300005549 Bacteria 9048
69 Ga0070704_100019332 3300005549 Bacteria 4375
70 Ga0068855_100001857 3300005563 Bacteria 26268
71 Ga0070664_100675889 3300005564 Bacteria 961
72 Ga0068857_100607824 3300005577 Bacteria 1034
73 Ga0068854_100188443 3300005578 Bacteria 1615
74 Ga0068856_100708982 3300005614 Bacteria 1026
75 Ga0070702_100000025 3300005615 Bacteria 43492
76 Ga0068852_100937425 3300005616 Bacteria 884
77 Ga0068859_100004099 3300005617 Bacteria 14861
78 Ga0068859_100073932 3300005617 Bacteria 3447
79 Ga0068864_100095604 3300005618 Bacteria 2628
80 Ga0068866_10000697 3300005718 Bacteria 15289
81 Ga0068866_10582855 3300005718 Bacteria 752
82 Ga0068861_100000170 3300005719 Bacteria 34422
83 Ga0068861_100058875 3300005719 Bacteria 2939
84 Ga0068861_100204677 3300005719 Unclassified 1659
85 Ga0068870_10358658 3300005840 Bacteria 937
86 Ga0068858_100159529 3300005842 Bacteria 2123
87 Ga0068860_100009615 3300005843 Bacteria 9607
88 Ga0068862_100004429 3300005844 Bacteria 11854
89 Ga0081539_10012172 3300005985 Bacteria 6676
90 Ga0075365_10121758 3300006038 Bacteria 1800
91 Ga0075366_10088278 3300006195 Bacteria 1857
92 Ga0075366_10094904 3300006195 Bacteria 1788
93 Ga0075366_10312144 3300006195 Bacteria 962
94 Ga0097621_100000438 3300006237 Bacteria 29060
95 Ga0097621_100336320 3300006237 Bacteria 1340
96 Ga0068871_100000608 3300006358 Bacteria 24623
97 Ga0068871_100037379 3300006358 Bacteria 3871
98 Ga0068871_100170330 3300006358 Bacteria 1866
99 Ga0075428_100020113 3300006844 Bacteria 7392
100 Ga0075430_100002668 3300006846 Bacteria 14883
101 Ga0075430_100052581 3300006846 Bacteria 3431
102 Ga0075430_100053767 3300006846 Bacteria 3390
103 Ga0075430_100532560 3300006846 Bacteria 969
104 Ga0075431_100623818 3300006847 Bacteria 1060
105 Ga0075434_100000277 3300006871 Bacteria 36475
106 Ga0075434_100007163 3300006871 Bacteria 10309
107 Ga0075434_100168555 3300006871 Bacteria 2210
108 Ga0075429_100012525 3300006880 Bacteria 7358
109 Ga0075429_100024772 3300006880 Bacteria 5208
110 Ga0068865_100001765 3300006881 Bacteria 12695
111 Ga0068865_100006161 3300006881 Bacteria 7310
112 Ga0068865_100402256 3300006881 Bacteria 1122
113 Ga0075436_100000628 3300006914 Bacteria 23202
114 Ga0075436_100004664 3300006914 Bacteria 9392
115 Ga0075436_100011869 3300006914 Bacteria 5979
116 Ga0075436_100044704 3300006914 Bacteria 3055
117 Ga0075436_100132915 3300006914 Bacteria 1746
118 Ga0097620_100004099 3300006931 Bacteria 14861
119 Ga0097620_100073933 3300006931 Bacteria 3447
120 Ga0075435_100003736 3300007076 Bacteria 10375
121 Ga0075435_100022075 3300007076 Bacteria 4907
122 Ga0111539_10019073 3300009094 Bacteria 8475
123 Ga0111539_10053506 3300009094 Bacteria 4805
124 Ga0111539_10087491 3300009094 Bacteria 3660
125 Ga0111539_10197191 3300009094 Bacteria 2348
126 Ga0105245_10001918 3300009098 Bacteria 18878
127 Ga0114129_10006239 3300009147 Bacteria 16899
128 Ga0114129_10161388 3300009147 Bacteria 3061
129 Ga0105243_10003304 3300009148 Bacteria 13095
130 Ga0105241_10060595 3300009174 Bacteria 2912
131 Ga0105241_10718945 3300009174 Bacteria 913
132 Ga0105242_10022155 3300009176 Bacteria 4992
133 Ga0105242_10199292 3300009176 Bacteria 1777
134 Ga0105248_10417452 3300009177 Bacteria 1511
135 Ga0105249_10001336 3300009553 Bacteria 21576
136 Ga0105249_10927649 3300009553 Bacteria 938
137 Ga0099796_10183694 3300010159 Bacteria 840
138 Ga0105239_10044689 3300010375 Bacteria 4855
139 Ga0105246_10853570 3300011119 Bacteria 812
140 Ga0157378_10000348 3300013297 Bacteria 45594
141 Ga0157378_10041156 3300013297 Bacteria 4098
142 Ga0163162_10273473 3300013306 Bacteria 1821
143 Ga0163162_10424907 3300013306 Bacteria 1461
144 Ga0163162_10771759 3300013306 Bacteria 1080
145 Ga0163163_10107402 3300014325 Bacteria 2818
146 Ga0157380_10018154 3300014326 Bacteria 5219
147 Ga0157380_10024034 3300014326 Bacteria 4606
148 Ga0182008_10228775 3300014497 Bacteria 953
149 Ga0157377_10196966 3300014745 Bacteria 1277
150 Ga0157377_10430940 3300014745 Bacteria 906
151 Ga0157379_10384548 3300014968 Bacteria 1288
152 Ga0157376_10025893 3300014969 Bacteria 4627
153 Ga0182006_1037532 3300015261 Bacteria 1920
154 Ga0209758_1017595 3300025297 Bacteria 3549
155 Ga0207642_10000441 3300025899 Bacteria 12562
156 Ga0207710_10059018 3300025900 Bacteria 1736
157 Ga0207643_10075778 3300025908 Bacteria 1942
158 Ga0207707_10050556 3300025912 Bacteria 3620
159 Ga0207707_10079534 3300025912 Bacteria 2862
160 Ga0207707_10465188 3300025912 Bacteria 1081
161 Ga0207707_10819310 3300025912 Bacteria 774
162 Ga0207660_10003257 3300025917 Bacteria 10633
163 Ga0207660_10029759 3300025917 Bacteria 3750
164 Ga0207662_10000161 3300025918 Bacteria 31987
165 Ga0207652_10021171 3300025921 Bacteria 5366
166 Ga0207652_10193541 3300025921 Bacteria 1829
167 Ga0207681_10006527 3300025923 Bacteria 7157
168 Ga0207694_10408234 3300025924 Bacteria 1130
169 Ga0207659_10017603 3300025926 Bacteria 4670
170 Ga0207659_10043125 3300025926 Bacteria 3167
171 Ga0207659_10095184 3300025926 Bacteria 2233
172 Ga0207687_10003990 3300025927 Bacteria 9891
173 Ga0207664_10064073 3300025929 Bacteria 2938
174 Ga0207644_10301191 3300025931 Bacteria 1292
175 Ga0207709_10000593 3300025935 Bacteria 30249
176 Ga0207709_10004994 3300025935 Bacteria 7586
177 Ga0207670_10002238 3300025936 Bacteria 10119
178 Ga0207670_10188653 3300025936 Bacteria 1559
179 Ga0207670_10351817 3300025936 Bacteria 1167
180 Ga0207669_10072036 3300025937 Bacteria 2174
181 Ga0207704_10001872 3300025938 Bacteria 9421
182 Ga0207704_10008801 3300025938 Bacteria 4846
183 Ga0207704_10071838 3300025938 Bacteria 2198
184 Ga0207691_10055962 3300025940 Bacteria 3594
185 Ga0207691_10195425 3300025940 Bacteria 1763
186 Ga0207689_10000189 3300025942 Bacteria 53499
187 Ga0207689_10057855 3300025942 Bacteria 3188
188 Ga0207689_10465356 3300025942 Bacteria 1058
189 Ga0207679_10553096 3300025945 Bacteria 1033
190 Ga0207651_10182675 3300025960 Bacteria 1665
191 Ga0207712_10010664 3300025961 Bacteria 5836
192 Ga0207640_10085238 3300025981 Unclassified 2172
193 Ga0207677_10001086 3300026023 Bacteria 14802
194 Ga0207708_10000549 3300026075 Bacteria 28986
195 Ga0207708_10004331 3300026075 Bacteria 10454
196 Ga0207702_10162555 3300026078 Bacteria 2040
197 Ga0207641_10215998 3300026088 Bacteria 1776
198 Ga0207641_10286581 3300026088 Unclassified 1551
199 Ga0207648_10000301 3300026089 Bacteria 53771
200 Ga0207648_10000443 3300026089 Bacteria 45890
201 Ga0207675_100000161 3300026118 Bacteria 59262
202 Ga0207675_100001158 3300026118 Bacteria 26211
203 Ga0207683_10148252 3300026121 Bacteria 2117
204 Ga0209967_1007229 3300027364 Bacteria 1516
205 Ga0209981_1005274 3300027378 Bacteria 1712
206 Ga0209996_1018545 3300027395 Bacteria 967
207 Ga0209995_1007530 3300027471 Unclassified 1755
208 Ga0209966_1003683 3300027695 Bacteria 2586
209 Ga0209974_10104444 3300027876 Bacteria 992
210 Ga0207428_10001184 3300027907 Bacteria 28094
211 Ga0268265_10003357 3300028380 Bacteria 11562
212 Ga0268265_10096474 3300028380 Bacteria 2376
213 Ga0268264_10001088 3300028381 Bacteria 26886
214 Ga0265325_10000300 3300031241 Bacteria 34777
215 Ga0265325_10043811 3300031241 Bacteria 2333
216 Ga0265340_10037357 3300031247 Bacteria 2406
217 Ga0265316_10147779 3300031344 Bacteria 1762
218 Ga0265313_10152386 3300031595 Bacteria 987
219 Ga0307410_10716379 3300031852 Bacteria 845
220 Ga0307406_10284631 3300031901 Bacteria 1263
221 Ga0307412_10581306 3300031911 Bacteria 946
222 Ga0307409_100466823 3300031995 Unclassified 1222
223 Ga0307416_100080405 3300032002 Bacteria 2751
224 Ga0307411_10066972 3300032005 Bacteria 2415
225 Ga0373948_0011608 3300034817 Unclassified 1561
226 Ga0373959_0018498 3300034820 Unclassified 1311
227 Ga0373938_0008997 3300034957 Unclassified 1797
228 Ga0373926_0011917 3300035083 Bacteria 2933
229 Ga0373926_0093198 3300035083 Bacteria 1121
230 Ga0373951_0012100 3300035091 Bacteria 1941
231 Ga0373952_0004689 3300035092 Unclassified 2485
232 Ga0373923_0085826 3300035111 Bacteria 1371
233 Ga0373923_0097403 3300035111 Bacteria 1294
234 Ga0373939_0027749 3300035114 Unclassified 1606
235 Ga0373941_0032195 3300035115 Bacteria 1568
236 Ga0373945_0010482 3300035116 Bacteria 3051
237 Ga0373957_0044581 3300035120 Bacteria 1679
238 Ga0373943_0002053 3300035170 Bacteria 9139
239 Ga0373955_0048165 3300035172 Bacteria 2310
240 Ga0373931_0000304 3300035691 Bacteria 20670
241 Ga0373931_0251986 3300035691 Bacteria 1074
242 Ga0373927_0141675 3300035695 Bacteria 1573
243 Ga0373933_0032084 3300035724 Bacteria 3051
244 Ga0373947_0004966 3300035725 Bacteria 7783
245 Ga0373937_0011268 3300036401 Bacteria 7839
246 Ga0373937_0031019 3300036401 Bacteria 4840
247 Ga0373925_0007129 3300037068 Bacteria 8169
248 Ga0373925_0083735 3300037068 Bacteria 2430
249 Ga0439456_019361 3300042013 Bacteria 1432
250 Ga0439434_0041456 3300042435 Bacteria 1414
251 Ga0439460_0011809 3300042461 Unclassified 2257
252 Ga0451577_0021456 3300042876 Bacteria 5911
253 Ga0451577_0142448 3300042876 Bacteria 2155
254 Ga0451576_0001999 3300045051 Bacteria 32284
255 Ga0451576_0013392 3300045051 Bacteria 9176
256 Ga0466967_0081092 3300045976 Bacteria 2930
257 Ga0495603_0030307 3300046455 Bacteria 3258
258 Ga0495580_0001886 3300046472 Bacteria 18463
259 Ga0495639_0012857 3300046475 Bacteria 3611
260 Ga0495628_0231837 3300046516 Bacteria 1384
261 Ga0495666_0043602 3300046526 Bacteria 2167
262 Ga0495586_0024408 3300046535 Bacteria 3232
263 Ga0495667_0033941 3300046559 Bacteria 3413
264 Ga0495588_0044233 3300046674 Bacteria 2280
265 Ga0495647_0000104 3300046681 Bacteria 20841
266 Ga0495669_0053150 3300046684 Bacteria 1821
267 Ga0495604_0175568 3300047317 Bacteria 1503
268 Ga0495674_0507482 3300047319 Bacteria 964
269 Ga0495676_0112751 3300047321 Bacteria 1992
270 Ga0495680_0139761 3300047322 Bacteria 1773
271 Ga0501031_0248533 3300049568 Bacteria 1156
272 Ga0501032_0010182 3300049569 Bacteria 6786
273 Ga0501032_0125204 3300049569 Bacteria 1698
274 Ga0501033_0494574 3300049570 Bacteria 846
275 Ga0501034_0225830 3300049571 Bacteria 1823
276 Ga0501034_0823580 3300049571 Bacteria 820
277 Ga0501036_0003351 3300049572 Bacteria 12792
278 Ga0501036_0007419 3300049572 Bacteria 8936
279 Ga0501036_0048263 3300049572 Bacteria 3605
280 Ga0501037_0293526 3300049573 Bacteria 1130
281 Ga0501038_0003096 3300049574 Bacteria 15503
282 Ga0501038_0016689 3300049574 Bacteria 6653
283 Ga0501039_0043365 3300049575 Bacteria 3475
284 Ga0501039_0111909 3300049575 Bacteria 2134
285 Ga0501039_0406528 3300049575 Bacteria 1069
286 Ga0501040_0002114 3300049576 Bacteria 12804
287 Ga0501040_0039148 3300049576 Bacteria 3224
288 Ga0501040_0045652 3300049576 Bacteria 2989
289 Ga0501040_0068981 3300049576 Bacteria 2438
290 Ga0501041_0001464 3300049577 Bacteria 13039
291 Ga0501041_0005337 3300049577 Bacteria 7521
292 Ga0501041_0009514 3300049577 Bacteria 5729
293 Ga0501041_0162860 3300049577 Unclassified 1395
294 Ga0501042_0000424 3300049578 Bacteria 21414
295 Ga0501042_0017981 3300049578 Bacteria 4889
296 Ga0501042_0161606 3300049578 Bacteria 1616
297 Ga0501042_0279211 3300049578 Bacteria 1206
298 Ga0501043_0051669 3300049579 Bacteria 3229
299 Ga0501043_0052138 3300049579 Unclassified 3214
300 Ga0501043_0074309 3300049579 Bacteria 2670
301 Ga0501046_0004214 3300049580 Bacteria 13095
302 Ga0501046_0016534 3300049580 Bacteria 6173
303 Ga0501046_0073519 3300049580 Bacteria 2653
304 Ga0501047_0314200 3300049581 Bacteria 1407
305 Ga0501047_0887638 3300049581 Bacteria 705
306 Ga0501048_0001854 3300049582 Bacteria 16045
307 Ga0501048_0008452 3300049582 Bacteria 7788
308 Ga0501048_0073188 3300049582 Bacteria 2419
309 Ga0501048_0339318 3300049582 Bacteria 1071
310 Ga0501067_0017010 3300049583 Bacteria 4018
311 Ga0501068_0022596 3300049584 Bacteria 3678
312 Ga0501068_0107213 3300049584 Bacteria 1735
313 Ga0501070_0057658 3300049586 Unclassified 3220
314 Ga0501071_0077602 3300049587 Bacteria 2426
315 Ga0501072_0003779 3300049588 Bacteria 11432
316 Ga0501072_0006415 3300049588 Bacteria 8963
317 Ga0501072_0067230 3300049588 Bacteria 2828
318 Ga0501072_0096898 3300049588 Bacteria 2344
319 Ga0501072_0347720 3300049588 Bacteria 1177
320 Ga0501074_0064677 3300049590 Unclassified 2633
321 Ga0501075_0016995 3300049591 Bacteria 5248
322 Ga0501075_0077913 3300049591 Unclassified 2508
323 Ga0501075_0182788 3300049591 Unclassified 1599
324 Ga0501076_0000852 3300049592 Bacteria 19768
325 Ga0501076_0147357 3300049592 Bacteria 1914
326 Ga0501077_0001623 3300049593 Bacteria 13514
327 Ga0501079_0001915 3300049741 Bacteria 14922
328 Ga0501079_0021831 3300049741 Bacteria 4901
329 Ga0501080_0060692 3300049742 Bacteria 3520
330 Ga0501080_0349668 3300049742 Bacteria 1335
331 Ga0501081_0003302 3300049743 Bacteria 10256
332 Ga0501035_0016790 3300049822 Bacteria 6749
333 Ga0501044_0013172 3300049823 Bacteria 8953
334 Ga0501044_0037135 3300049823 Bacteria 5092
335 Ga0501044_0114782 3300049823 Bacteria 2698
336 Ga0501045_0002765 3300049824 Bacteria 11976
337 Ga0501045_0004847 3300049824 Bacteria 9310
338 Ga0501045_0021694 3300049824 Bacteria 4597
339 nmdc:mga00v17_277225_c1 3300050491 Bacteria 1088
340 nmdc:mga04h51_35286_c1 3300050495 Bacteria 1603
341 nmdc:mga05p37_18252_c1 3300050507 Bacteria 8475
342 nmdc:mga05p37_73033_c1 3300050507 Bacteria 4221
343 nmdc:mga09592_193035_c1 3300050508 Bacteria 1763
344 nmdc:mga09592_3179_c1 3300050508 Bacteria 13330
345 nmdc:mga0qj67_1053_c1 3300050509 Bacteria 19086
346 nmdc:mga0qj67_659855_c1 3300050509 Bacteria 834
347 nmdc:mga06r32_444393_c1 3300050510 Bacteria 1277
348 nmdc:mga06r32_829165_c1 3300050510 Unclassified 884
349 nmdc:mga08y16_22765_c1 3300050511 Bacteria 6615
350 nmdc:mga08y16_36847_c1 3300050511 Bacteria 5136
351 nmdc:mga08y16_42612_c1 3300050511 Bacteria 4753
352 nmdc:mga0n895_1535_c1 3300050512 Bacteria 17350
353 nmdc:mga0n895_56420_c1 3300050512 Bacteria 3870
354 nmdc:mga0rr50_19294_c1 3300050513 Bacteria 4599
355 nmdc:mga0rr50_4733_c1 3300050513 Bacteria 8025
356 nmdc:mga0rr50_74836_c1 3300050513 Bacteria 2594
357 nmdc:mga08x19_113223_c1 3300050514 Bacteria 1811
358 nmdc:mga08x19_12586_c1 3300050514 Bacteria 5101
359 nmdc:mga08x19_2710_c1 3300050514 Bacteria 10713
360 nmdc:mga08x19_46446_c1 3300050514 Bacteria 2777
361 nmdc:mga0a205_17000_c1 3300050515 Bacteria 6809
362 nmdc:mga0a205_207731_c1 3300050515 Bacteria 1495
363 nmdc:mga0a205_877_c1 3300050515 Bacteria 24657
364 nmdc:mga0sz30_95114_c1 3300050516 Bacteria 1299
365 Ga0495612_0105311 3300053078 Bacteria 1204
366 Ga0495619_0236829 3300053085 Bacteria 1265
367 Ga0500641_0102918 3300053096 Bacteria 1226
368 Ga0500595_030821 3300053119 Bacteria 1803
369 Ga0501084_0024611 3300054114 Bacteria 5024
370 Ga0501084_0105843 3300054114 Bacteria 2363
371 Ga0501084_0113789 3300054114 Unclassified 2274
372 Ga0590071_012342 3300059421 Bacteria 2002
373 Ga0501082_0006080 3300060353 Bacteria 10478
374 Ga0501082_0009980 3300060353 Bacteria 8186
375 Ga0530510_0013287 3300061734 Bacteria 5788
376 Ga0530510_0046119 3300061734 Unclassified 3148
377 Ga0075430_100011808
378 Ga0065712_10139321
379 Ga0065707_10013199
380 Ga0070658_10563894
381 Ga0070676_10031644
382 Ga0070683_100841018
383 Ga0070690_100001124
384 Ga0070690_100251313
385 Ga0068869_100002534
386 Ga0068869_100315339
387 Ga0068869_100513709
388 Ga0070666_10070546
389 Ga0070680_100002028
390 Ga0070680_100031643
391 Ga0070680_100382858
392 Ga0070682_100006632
393 Ga0068868_100008911
394 Ga0070689_100001666
395 Ga0070689_100467268
396 Ga0070689_100473682
397 Ga0070691_10000212
398 Ga0070687_100000118
399 Ga0070687_100071844
400 Ga0070692_10001250
401 Ga0070692_10002381
402 Ga0070669_100007450
403 Ga0070675_100098126
404 Ga0070675_100220362
405 Ga0070674_100024652
406 Ga0070674_100125457
407 Ga0070673_100156980
408 Ga0070688_100324590
409 Ga0070659_100636275
410 Ga0070714_100111052
411 Ga0070710_10067187
412 Ga0070701_10138358
413 Ga0070705_100000190
414 Ga0070705_100018557
415 Ga0070700_100001076
416 Ga0070700_100079008
417 Ga0070700_100191383
418 Ga0070694_100000267
419 Ga0070694_100117411
420 Ga0070681_10013501
421 Ga0070681_10020996
422 Ga0070681_10487950
423 Ga0070681_10538959
424 Ga0068867_100002498
425 Ga0068867_100022154
426 Ga0070699_100020368
427 Ga0070699_100267407
428 Ga0070699_100273903
429 Ga0070679_100006605
430 Ga0070697_100240829
431 Ga0068853_100100078
432 Ga0070672_100184987
433 Ga0070672_100372200
434 Ga0070686_100000380
435 Ga0070695_100001232
436 Ga0070695_100003903
437 Ga0070695_100022825
438 Ga0070696_100002433
439 Ga0070696_100007754
440 Ga0070696_100107035
441 Ga0070696_100208308
442 Ga0070693_100000192
443 Ga0070704_100000221
444 Ga0070704_100003469
445 Ga0070704_100019332
446 Ga0068855_100001857
447 Ga0070664_100675889
448 Ga0068857_100607824
449 Ga0068854_100188443
450 Ga0068856_100708982
451 Ga0070702_100000025
452 Ga0068852_100937425
453 Ga0068859_100004099
454 Ga0068859_100073932
455 Ga0068864_100095604
456 Ga0068866_10000697
457 Ga0068866_10582855
458 Ga0068861_100000170
459 Ga0068861_100058875
460 Ga0068861_100204677
461 Ga0068870_10358658
462 Ga0068858_100159529
463 Ga0068860_100009615
464 Ga0068862_100004429
465 Ga0081539_10012172
466 Ga0075365_10121758
467 Ga0075366_10088278
468 Ga0075366_10094904
469 Ga0075366_10312144
470 Ga0097621_100000438
471 Ga0097621_100336320
472 Ga0068871_100000608
473 Ga0068871_100037379
474 Ga0068871_100170330
475 Ga0075428_100020113
476 Ga0075430_100002668
477 Ga0075430_100052581
478 Ga0075430_100053767
479 Ga0075430_100532560
480 Ga0075431_100623818
481 Ga0075434_100000277
482 Ga0075434_100007163
483 Ga0075434_100168555
484 Ga0075429_100012525
485 Ga0075429_100024772
486 Ga0068865_100001765
487 Ga0068865_100006161
488 Ga0068865_100402256
489 Ga0075436_100000628
490 Ga0075436_100004664
491 Ga0075436_100011869
492 Ga0075436_100044704
493 Ga0075436_100132915
494 Ga0097620_100004099
495 Ga0097620_100073933
496 Ga0075435_100003736
497 Ga0075435_100022075
498 Ga0111539_10019073
499 Ga0111539_10053506
500 Ga0111539_10087491
501 Ga0111539_10197191
502 Ga0105245_10001918
503 Ga0114129_10006239
504 Ga0114129_10161388
505 Ga0105243_10003304
506 Ga0105241_10060595
507 Ga0105241_10718945
508 Ga0105242_10022155
509 Ga0105242_10199292
510 Ga0105248_10417452
511 Ga0105249_10001336
512 Ga0105249_10927649
513 Ga0099796_10183694
514 Ga0105239_10044689
515 Ga0105246_10853570
516 Ga0157378_10000348
517 Ga0157378_10041156
518 Ga0163162_10273473
519 Ga0163162_10424907
520 Ga0163162_10771759
521 Ga0163163_10107402
522 Ga0157380_10018154
523 Ga0157380_10024034
524 Ga0182008_10228775
525 Ga0157377_10196966
526 Ga0157377_10430940
527 Ga0157379_10384548
528 Ga0157376_10025893
529 Ga0182006_1037532
530 Ga0209758_1017595
531 Ga0207642_10000441
532 Ga0207710_10059018
533 Ga0207643_10075778
534 Ga0207707_10050556
535 Ga0207707_10079534
536 Ga0207707_10465188
537 Ga0207707_10819310
538 Ga0207660_10003257
539 Ga0207660_10029759
540 Ga0207662_10000161
541 Ga0207652_10021171
542 Ga0207652_10193541
543 Ga0207681_10006527
544 Ga0207694_10408234
545 Ga0207659_10017603
546 Ga0207659_10043125
547 Ga0207659_10095184
548 Ga0207687_10003990
549 Ga0207664_10064073
550 Ga0207644_10301191
551 Ga0207709_10000593
552 Ga0207709_10004994
553 Ga0207670_10002238
554 Ga0207670_10188653
555 Ga0207670_10351817
556 Ga0207669_10072036
557 Ga0207704_10001872
558 Ga0207704_10008801
559 Ga0207704_10071838
560 Ga0207691_10055962
561 Ga0207691_10195425
562 Ga0207689_10000189
563 Ga0207689_10057855
564 Ga0207689_10465356
565 Ga0207679_10553096
566 Ga0207651_10182675
567 Ga0207712_10010664
568 Ga0207640_10085238
569 Ga0207677_10001086
570 Ga0207708_10000549
571 Ga0207708_10004331
572 Ga0207702_10162555
573 Ga0207641_10215998
574 Ga0207641_10286581
575 Ga0207648_10000301
576 Ga0207648_10000443
577 Ga0207675_100000161
578 Ga0207675_100001158
579 Ga0207683_10148252
580 Ga0209967_1007229
581 Ga0209981_1005274
582 Ga0209996_1018545
583 Ga0209995_1007530
584 Ga0209966_1003683
585 Ga0209974_10104444
586 Ga0207428_10001184
587 Ga0268265_10003357
588 Ga0268265_10096474
589 Ga0268264_10001088
590 Ga0265325_10000300
591 Ga0265325_10043811
592 Ga0265340_10037357
593 Ga0265316_10147779
594 Ga0265313_10152386
595 Ga0307410_10716379
596 Ga0307406_10284631
597 Ga0307412_10581306
598 Ga0307409_100466823
599 Ga0307416_100080405
600 Ga0307411_10066972
601 Ga0373948_0011608
602 Ga0373959_0018498
603 Ga0373938_0008997
604 Ga0373926_0011917
605 Ga0373926_0093198
606 Ga0373951_0012100
607 Ga0373952_0004689
608 Ga0373923_0085826
609 Ga0373923_0097403
610 Ga0373939_0027749
611 Ga0373941_0032195
612 Ga0373945_0010482
613 Ga0373957_0044581
614 Ga0373943_0002053
615 Ga0373955_0048165
616 Ga0373931_0000304
617 Ga0373931_0251986
618 Ga0373927_0141675
619 Ga0373933_0032084
620 Ga0373947_0004966
621 Ga0373937_0011268
622 Ga0373937_0031019
623 Ga0373925_0007129
624 Ga0373925_0083735
625 Ga0439456_019361
626 Ga0439434_0041456
627 Ga0439460_0011809
628 Ga0451577_0021456
629 Ga0451577_0142448
630 Ga0451576_0001999
631 Ga0451576_0013392
632 Ga0466967_0081092
633 Ga0495603_0030307
634 Ga0495580_0001886
635 Ga0495639_0012857
636 Ga0495628_0231837
637 Ga0495666_0043602
638 Ga0495586_0024408
639 Ga0495667_0033941
640 Ga0495588_0044233
641 Ga0495647_0000104
642 Ga0495669_0053150
643 Ga0495604_0175568
644 Ga0495674_0507482
645 Ga0495676_0112751
646 Ga0495680_0139761
647 Ga0501031_0248533
648 Ga0501032_0010182
649 Ga0501032_0125204
650 Ga0501033_0494574
651 Ga0501034_0225830
652 Ga0501034_0823580
653 Ga0501036_0003351
654 Ga0501036_0007419
655 Ga0501036_0048263
656 Ga0501037_0293526
657 Ga0501038_0003096
658 Ga0501038_0016689
659 Ga0501039_0043365
660 Ga0501039_0111909
661 Ga0501039_0406528
662 Ga0501040_0002114
663 Ga0501040_0039148
664 Ga0501040_0045652
665 Ga0501040_0068981
666 Ga0501041_0001464
667 Ga0501041_0005337
668 Ga0501041_0009514
669 Ga0501041_0162860
670 Ga0501042_0000424
671 Ga0501042_0017981
672 Ga0501042_0161606
673 Ga0501042_0279211
674 Ga0501043_0051669
675 Ga0501043_0052138
676 Ga0501043_0074309
677 Ga0501046_0004214
678 Ga0501046_0016534
679 Ga0501046_0073519
680 Ga0501047_0314200
681 Ga0501047_0887638
682 Ga0501048_0001854
683 Ga0501048_0008452
684 Ga0501048_0073188
685 Ga0501048_0339318
686 Ga0501067_0017010
687 Ga0501068_0022596
688 Ga0501068_0107213
689 Ga0501070_0057658
690 Ga0501071_0077602
691 Ga0501072_0003779
692 Ga0501072_0006415
693 Ga0501072_0067230
694 Ga0501072_0096898
695 Ga0501072_0347720
696 Ga0501074_0064677
697 Ga0501075_0016995
698 Ga0501075_0077913
699 Ga0501075_0182788
700 Ga0501076_0000852
701 Ga0501076_0147357
702 Ga0501077_0001623
703 Ga0501079_0001915
704 Ga0501079_0021831
705 Ga0501080_0060692
706 Ga0501080_0349668
707 Ga0501081_0003302
708 Ga0501035_0016790
709 Ga0501044_0013172
710 Ga0501044_0037135
711 Ga0501044_0114782
712 Ga0501045_0002765
713 Ga0501045_0004847
714 Ga0501045_0021694
715 nmdc:mga00v17_277225_c1
716 nmdc:mga04h51_35286_c1
717 nmdc:mga05p37_18252_c1
718 nmdc:mga05p37_73033_c1
719 nmdc:mga09592_193035_c1
720 nmdc:mga09592_3179_c1
721 nmdc:mga0qj67_1053_c1
722 nmdc:mga0qj67_659855_c1
723 nmdc:mga06r32_444393_c1
724 nmdc:mga06r32_829165_c1
725 nmdc:mga08y16_22765_c1
726 nmdc:mga08y16_36847_c1
727 nmdc:mga08y16_42612_c1
728 nmdc:mga0n895_1535_c1
729 nmdc:mga0n895_56420_c1
730 nmdc:mga0rr50_19294_c1
731 nmdc:mga0rr50_4733_c1
732 nmdc:mga0rr50_74836_c1
733 nmdc:mga08x19_113223_c1
734 nmdc:mga08x19_12586_c1
735 nmdc:mga08x19_2710_c1
736 nmdc:mga08x19_46446_c1
737 nmdc:mga0a205_17000_c1
738 nmdc:mga0a205_207731_c1
739 nmdc:mga0a205_877_c1
740 nmdc:mga0sz30_95114_c1
741 Ga0495612_0105311
742 Ga0495619_0236829
743 Ga0500641_0102918
744 Ga0500595_030821
745 Ga0501084_0024611
746 Ga0501084_0105843
747 Ga0501084_0113789
748 Ga0590071_012342
749 Ga0501082_0006080
750 Ga0501082_0009980
751 Ga0530510_0013287
752 Ga0530510_0046119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

13

197

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.7872 2 211
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.7607 2 211
1e47-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant e73q 0.7383 2 189
1e4a-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant del(27) 0.7325 2 189
4xxf-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase from glaciozyma antarctica pi12 0.7262 2 192
ID Description Score Start End Superfamily
2z7bA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.7864 2 211 3.40.225.10
2z7bA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.7499 2 211 3.40.225.10
4xxfA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.7262 2 192 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.7198 2 187 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.7187 3 177 3.40.225.10
ID Description Score Start End GO Terms
AF-K8X410-F1-model_v4 3,4-dihydroxyphthalate decarboxylase 0.8213 121 191
AF-A0A3D2BP95-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.8041 2 214 GO:0005829
GO:0009086
GO:0016832
GO:0019323
AF-A0A1F4CU10-F1-model_v4 Aldolase 0.8006 1 216 GO:0005856
GO:0051015
AF-A0A0F9VGG5-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.7984 2 214 GO:0005829
GO:0016832
GO:0019323
AF-A0A2D7FKJ8-F1-model_v4 Aldolase 0.7983 2 214 GO:0005829
GO:0009086
GO:0016832
GO:0019323

Map