F427301

General Info

Members Datasets Scaffolds Average Seq Length
376 210 752 171

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10830396|Ga0070717_108303961
Length 198
Sequence MKRPANRLLLGATHDGSCGREASYDKDDMNDELPCLDLLEATPAILRGLMSEISDEDARWKPAPNRFSIAEVLAHLSHSEGHCYHARVHRFMAEEMPEFEPDDAQMYLELYKNGDPEEDFGHFEDQRETNIELLRGLPADAGSRKAKHRAAGEITLSQMLHEWALHDLGHVRQIAELVRARKYLAGAGPLGEDYQLKP

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
3 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
150 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 2.93
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 35.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10830396 3300006028 Bacteria 841
2 JGI26133J50247_101714 3300003397 Unclassified 696
3 JGI26143J51219_1001754 3300003502 Bacteria 908
4 JGI26141J51220_1001468 3300003503 Bacteria 1427
5 Ga0065712_10379181 3300005290 Unclassified 754
6 Ga0065715_10092029 3300005293 Bacteria 5380
7 Ga0065715_10248986 3300005293 Bacteria 1165
8 Ga0065707_10256272 3300005295 Unclassified 1110
9 Ga0070658_10140947 3300005327 Unclassified 2014
10 Ga0070683_100104688 3300005329 Unclassified 2667
11 Ga0070683_100202106 3300005329 Archaea 1887
12 Ga0070683_100376175 3300005329 Bacteria 1353
13 Ga0070683_101615866 3300005329 Bacteria 623
14 Ga0070670_100863377 3300005331 Archaea 819
15 Ga0070670_101533175 3300005331 Unclassified 612
16 Ga0070660_100413943 3300005339 Unclassified 1116
17 Ga0070660_100615321 3300005339 Bacteria 909
18 Ga0070689_100614438 3300005340 Bacteria 943
19 Ga0070689_101053576 3300005340 Bacteria 725
20 Ga0070669_100243515 3300005353 Bacteria 1429
21 Ga0070675_100026832 3300005354 Bacteria 4624
22 Ga0070659_100180783 3300005366 Bacteria 1731
23 Ga0070703_10231412 3300005406 Unclassified 741
24 Ga0070709_10480507 3300005434 Unclassified 941
25 Ga0070713_100048565 3300005436 Bacteria 3495
26 Ga0070711_100496589 3300005439 Unclassified 1005
27 Ga0070711_101125809 3300005439 Unclassified 677
28 Ga0070705_100386487 3300005440 Unclassified 1032
29 Ga0070705_100762583 3300005440 Bacteria 766
30 Ga0070694_100945539 3300005444 Bacteria 713
31 Ga0070708_100023206 3300005445 Bacteria 5272
32 Ga0070708_100391500 3300005445 Unclassified 1310
33 Ga0070662_100412365 3300005457 Unclassified 1116
34 Ga0070706_100026373 3300005467 Bacteria 5347
35 Ga0070706_100093231 3300005467 Bacteria 2794
36 Ga0070706_100130056 3300005467 Bacteria 2349
37 Ga0070706_100273357 3300005467 Bacteria 1577
38 Ga0070707_100036226 3300005468 Bacteria 4707
39 Ga0070707_100416603 3300005468 Bacteria 1304
40 Ga0070707_100501564 3300005468 Unclassified 1175
41 Ga0070707_100792379 3300005468 Unclassified 911
42 Ga0070707_101167901 3300005468 Unclassified 736
43 Ga0070698_100018436 3300005471 Bacteria 7349
44 Ga0070698_100259641 3300005471 Bacteria 1669
45 Ga0070698_100330046 3300005471 Bacteria 1456
46 Ga0070699_100097474 3300005518 Bacteria 2576
47 Ga0070699_100200642 3300005518 Unclassified 1774
48 Ga0070699_100688862 3300005518 Bacteria 933
49 Ga0070699_100741922 3300005518 Bacteria 898
50 Ga0070679_100806499 3300005530 Unclassified 882
51 Ga0070684_100035799 3300005535 Unclassified 4251
52 Ga0070697_100015474 3300005536 Bacteria 5989
53 Ga0070697_100016849 3300005536 Bacteria 5745
54 Ga0070697_100443871 3300005536 Unclassified 1130
55 Ga0070697_100498144 3300005536 Unclassified 1065
56 Ga0068853_100512852 3300005539 Unclassified 1133
57 Ga0070672_100422462 3300005543 Unclassified 1145
58 Ga0070696_100696303 3300005546 Bacteria 828
59 Ga0070665_101027818 3300005548 Unclassified 836
60 Ga0070704_100069715 3300005549 Bacteria 2548
61 Ga0070704_101135660 3300005549 Bacteria 711
62 Ga0068855_100137287 3300005563 Unclassified 2789
63 Ga0068855_100188256 3300005563 Bacteria 2330
64 Ga0068855_100704221 3300005563 Unclassified 1080
65 Ga0070664_100043876 3300005564 Bacteria 3775
66 Ga0070664_100056849 3300005564 Bacteria 3324
67 Ga0070664_101790637 3300005564 Unclassified 582
68 Ga0068857_100921182 3300005577 Unclassified 839
69 Ga0068857_101648801 3300005577 Bacteria 626
70 Ga0068854_100413553 3300005578 Unclassified 1119
71 Ga0068859_100140357 3300005617 Bacteria 2490
72 Ga0068859_100685412 3300005617 Unclassified 1116
73 Ga0068864_100713053 3300005618 Bacteria 981
74 Ga0068851_10031701 3300005834 Bacteria 2627
75 Ga0068858_100025298 3300005842 Bacteria 5524
76 Ga0068858_100213778 3300005842 Unclassified 1825
77 Ga0068858_100998482 3300005842 Unclassified 820
78 Ga0068860_100038391 3300005843 Bacteria 4580
79 Ga0068860_101310084 3300005843 Bacteria 745
80 Ga0068862_100195297 3300005844 Unclassified 1823
81 Ga0070717_10042247 3300006028 Unclassified 3718
82 Ga0070717_10066550 3300006028 Bacteria 2997
83 Ga0070717_10599192 3300006028 Unclassified 999
84 Ga0070717_10797464 3300006028 Unclassified 859
85 Ga0070715_10579411 3300006163 Bacteria 655
86 Ga0070716_100472351 3300006173 Bacteria 919
87 Ga0070716_100505047 3300006173 Unclassified 893
88 Ga0070716_100718777 3300006173 Bacteria 765
89 Ga0070716_100730619 3300006173 Unclassified 759
90 Ga0070712_100119735 3300006175 Bacteria 1979
91 Ga0070712_100188022 3300006175 Bacteria 1614
92 Ga0070712_101068533 3300006175 Unclassified 700
93 Ga0075367_10547556 3300006178 Unclassified 735
94 Ga0068871_101918439 3300006358 Unclassified 563
95 Ga0075428_100027051 3300006844 Bacteria 6350
96 Ga0075428_100066688 3300006844 Bacteria 3940
97 Ga0075428_100162618 3300006844 Bacteria 2423
98 Ga0075428_100328400 3300006844 Bacteria 1643
99 Ga0075428_100461441 3300006844 Unclassified 1360
100 Ga0075428_101080480 3300006844 Bacteria 848
101 Ga0075430_100029294 3300006846 Bacteria 4672
102 Ga0075430_100192288 3300006846 Bacteria 1696
103 Ga0075430_100193728 3300006846 Bacteria 1689
104 Ga0075430_100926614 3300006846 Unclassified 718
105 Ga0075431_100003131 3300006847 Bacteria 16003
106 Ga0075431_100098707 3300006847 Bacteria 3015
107 Ga0075431_100383537 3300006847 Bacteria 1409
108 Ga0075431_100464788 3300006847 Bacteria 1260
109 Ga0075431_100552966 3300006847 Unclassified 1138
110 Ga0075431_101248544 3300006847 Archaea 705
111 Ga0075433_10071295 3300006852 Bacteria 3054
112 Ga0075433_10631266 3300006852 Bacteria 940
113 Ga0075433_10631353 3300006852 Bacteria 940
114 Ga0075434_100297062 3300006871 Bacteria 1635
115 Ga0075434_100874933 3300006871 Unclassified 914
116 Ga0075434_100997279 3300006871 Bacteria 851
117 Ga0075429_100069098 3300006880 Bacteria 3075
118 Ga0075429_100080276 3300006880 Bacteria 2844
119 Ga0075429_100272034 3300006880 Bacteria 1484
120 Ga0068865_100984423 3300006881 Archaea 738
121 Ga0075436_100000069 3300006914 Bacteria 62572
122 Ga0075436_100042839 3300006914 Unclassified 3121
123 Ga0075436_100055625 3300006914 Bacteria 2732
124 Ga0075436_100293975 3300006914 Bacteria 1163
125 Ga0097620_100140352 3300006931 Bacteria 2490
126 Ga0097620_100685476 3300006931 Unclassified 1116
127 Ga0075435_100116718 3300007076 Unclassified 2224
128 Ga0075435_100293687 3300007076 Unclassified 1389
129 Ga0075435_100946396 3300007076 Bacteria 752
130 Ga0105250_10021797 3300009092 Bacteria 2584
131 Ga0105240_10002806 3300009093 Bacteria 27515
132 Ga0105240_10015065 3300009093 Bacteria 10524
133 Ga0105240_10082623 3300009093 Unclassified 3944
134 Ga0105240_10181345 3300009093 Bacteria 2485
135 Ga0105240_10470817 3300009093 Unclassified 1402
136 Ga0111539_10787933 3300009094 Archaea 1106
137 Ga0111539_10934974 3300009094 Bacteria 1008
138 Ga0111539_11001437 3300009094 Archaea 971
139 Ga0111539_11250756 3300009094 Unclassified 862
140 Ga0111539_11303842 3300009094 Bacteria 843
141 Ga0111539_11729775 3300009094 Unclassified 725
142 Ga0105245_10495854 3300009098 Unclassified 1237
143 Ga0105247_10282722 3300009101 Bacteria 1145
144 Ga0114129_10046122 3300009147 Bacteria 6126
145 Ga0114129_10077817 3300009147 Bacteria 4613
146 Ga0114129_10303145 3300009147 Unclassified 2128
147 Ga0114129_10531047 3300009147 Unclassified 1533
148 Ga0114129_11360350 3300009147 Unclassified 878
149 Ga0114129_11789024 3300009147 Unclassified 747
150 Ga0114129_12246344 3300009147 Bacteria 656
151 Ga0105243_12284709 3300009148 Unclassified 578
152 Ga0105241_10200265 3300009174 Bacteria 1667
153 Ga0105241_10309915 3300009174 Unclassified 1357
154 Ga0105248_10047067 3300009177 Bacteria 4836
155 Ga0105248_10845322 3300009177 Bacteria 1033
156 Ga0105237_10006255 3300009545 Bacteria 13251
157 Ga0105237_10128234 3300009545 Bacteria 2531
158 Ga0105237_10328309 3300009545 Unclassified 1534
159 Ga0105237_10855446 3300009545 Bacteria 916
160 Ga0105237_10967846 3300009545 Unclassified 858
161 Ga0105238_10263810 3300009551 Bacteria 1702
162 Ga0105239_10063008 3300010375 Unclassified 4070
163 Ga0105239_10115400 3300010375 Archaea 2979
164 Ga0105239_10694209 3300010375 Bacteria 1163
165 Ga0105246_10874875 3300011119 Bacteria 804
166 Ga0157374_10174348 3300013296 Bacteria 2099
167 Ga0157378_10029806 3300013297 Bacteria 4819
168 Ga0157378_11077041 3300013297 Bacteria 840
169 Ga0157378_11838606 3300013297 Unclassified 654
170 Ga0163162_10061166 3300013306 Bacteria 3804
171 Ga0163162_11263762 3300013306 Unclassified 838
172 Ga0157372_10754908 3300013307 Unclassified 1131
173 Ga0163163_10171137 3300014325 Bacteria 2219
174 Ga0163163_10498337 3300014325 Bacteria 1280
175 Ga0157380_11176239 3300014326 Bacteria 809
176 Ga0157380_11381167 3300014326 Unclassified 754
177 Ga0182008_10258358 3300014497 Unclassified 900
178 Ga0157379_11551984 3300014968 Unclassified 645
179 Ga0182007_10047934 3300015262 Unclassified 1412
180 Ga0207710_10008269 3300025900 Bacteria 4392
181 Ga0207699_10031500 3300025906 Bacteria 2977
182 Ga0207645_10635280 3300025907 Unclassified 725
183 Ga0207684_10006461 3300025910 Bacteria 10690
184 Ga0207684_10016252 3300025910 Bacteria 6390
185 Ga0207684_10032141 3300025910 Bacteria 4463
186 Ga0207684_10244818 3300025910 Bacteria 1547
187 Ga0207684_10366296 3300025910 Bacteria 1240
188 Ga0207684_10558591 3300025910 Archaea 979
189 Ga0207654_10194527 3300025911 Unclassified 1331
190 Ga0207695_10027404 3300025913 Bacteria 6345
191 Ga0207695_10081592 3300025913 Archaea 3272
192 Ga0207671_10077032 3300025914 Unclassified 2496
193 Ga0207671_10943651 3300025914 Bacteria 681
194 Ga0207671_11145266 3300025914 Unclassified 610
195 Ga0207693_10646610 3300025915 Unclassified 822
196 Ga0207663_10862042 3300025916 Bacteria 723
197 Ga0207657_10035038 3300025919 Unclassified 4506
198 Ga0207649_10243301 3300025920 Bacteria 1292
199 Ga0207646_10005479 3300025922 Bacteria 13346
200 Ga0207646_10095280 3300025922 Bacteria 2666
201 Ga0207646_10135369 3300025922 Bacteria 2218
202 Ga0207646_10143636 3300025922 Bacteria 2150
203 Ga0207646_10485857 3300025922 Bacteria 1113
204 Ga0207646_10708225 3300025922 Bacteria 900
205 Ga0207694_10203811 3300025924 Bacteria 1610
206 Ga0207659_11127727 3300025926 Bacteria 675
207 Ga0207700_10080074 3300025928 Bacteria 2546
208 Ga0207700_10786000 3300025928 Unclassified 851
209 Ga0207664_10137913 3300025929 Bacteria 2060
210 Ga0207664_10225877 3300025929 Bacteria 1626
211 Ga0207690_10155270 3300025932 Bacteria 1700
212 Ga0207690_10438842 3300025932 Bacteria 1047
213 Ga0207670_10056377 3300025936 Bacteria 2660
214 Ga0207665_10353685 3300025939 Unclassified 1109
215 Ga0207665_10479925 3300025939 Unclassified 958
216 Ga0207691_10476200 3300025940 Unclassified 1061
217 Ga0207711_10035984 3300025941 Bacteria 4199
218 Ga0207689_10051885 3300025942 Unclassified 3381
219 Ga0207661_10070385 3300025944 Unclassified 2856
220 Ga0207661_10968549 3300025944 Unclassified 784
221 Ga0207679_10068642 3300025945 Bacteria 2664
222 Ga0207667_10249176 3300025949 Bacteria 1817
223 Ga0207703_10058606 3300026035 Bacteria 3143
224 Ga0207641_10610529 3300026088 Unclassified 1069
225 Ga0207676_10533836 3300026095 Bacteria 1119
226 Ga0207674_10737418 3300026116 Unclassified 951
227 Ga0207675_100874347 3300026118 Unclassified 914
228 Ga0209973_1008860 3300027252 Bacteria 1159
229 Ga0209967_1002415 3300027364 Bacteria 2422
230 Ga0209984_1013886 3300027424 Bacteria 1059
231 Ga0209995_1007799 3300027471 Bacteria 1726
232 Ga0209968_1001587 3300027526 Bacteria 3440
233 Ga0209982_1012365 3300027552 Bacteria 1280
234 Ga0209970_1000718 3300027614 Bacteria 5748
235 Ga0210002_1000613 3300027617 Bacteria 4866
236 Ga0209983_1003862 3300027665 Bacteria 3171
237 Ga0209971_1000317 3300027682 Bacteria 13417
238 Ga0209971_1002898 3300027682 Unclassified 4095
239 Ga0209966_1016614 3300027695 Bacteria 1394
240 Ga0209998_10004085 3300027717 Bacteria 3117
241 Ga0209974_10000287 3300027876 Bacteria 16478
242 Ga0268266_10892654 3300028379 Unclassified 859
243 Ga0268266_11470602 3300028379 Unclassified 657
244 Ga0268265_10143890 3300028380 Unclassified 2000
245 Ga0268265_10415544 3300028380 Bacteria 1247
246 Ga0268265_10537351 3300028380 Bacteria 1108
247 Ga0268264_10012417 3300028381 Bacteria 7011
248 Ga0265760_10011442 3300031090 Bacteria 2534
249 Ga0265332_10331172 3300031238 Bacteria 628
250 Ga0265325_10182420 3300031241 Unclassified 977
251 Ga0265340_10151532 3300031247 Unclassified 1056
252 Ga0265339_10159763 3300031249 Unclassified 1135
253 Ga0265339_10165101 3300031249 Bacteria 1112
254 Ga0265339_10295252 3300031249 Bacteria 774
255 Ga0265331_10011482 3300031250 Bacteria 4847
256 Ga0265316_10251522 3300031344 Unclassified 1297
257 Ga0265314_10131112 3300031711 Bacteria 1564
258 Ga0265314_10216029 3300031711 Bacteria 1122
259 Ga0265342_10008266 3300031712 Bacteria 7493
260 Ga0265342_10063136 3300031712 Bacteria 2178
261 Ga0316576_10228909 3300031727 Bacteria 1398
262 Ga0307416_100558989 3300032002 Unclassified 1219
263 Ga0373926_0373157 3300035083 Bacteria 561
264 Ga0373944_0303914 3300035089 Bacteria 599
265 Ga0373923_0248328 3300035111 Bacteria 832
266 Ga0373943_0551764 3300035170 Bacteria 676
267 Ga0373927_0394318 3300035695 Bacteria 913
268 Ga0373947_0223258 3300035725 Bacteria 1239
269 Ga0436364_0167295 3300037853 Bacteria 1567
270 Ga0436362_0374081 3300039453 Unclassified 545
271 Ga0439436_0221049 3300041404 Unclassified 545
272 Ga0451845_0384636 3300041501 Unclassified 846
273 Ga0439456_026185 3300042013 Archaea 1240
274 Ga0439460_0072708 3300042461 Archaea 1068
275 Ga0439460_0089281 3300042461 Unclassified 978
276 Ga0450893_0095142 3300042532 Archaea 602
277 Ga0451577_0027696 3300042876 Bacteria 5129
278 Ga0451577_0092265 3300042876 Bacteria 2703
279 Ga0453684_0173914 3300044712 Bacteria 2535
280 Ga0453684_0826765 3300044712 Bacteria 997
281 Ga0453684_2019297 3300044712 Unclassified 580
282 Ga0466971_0630478 3300044719 Unclassified 536
283 Ga0451576_0042471 3300045051 Bacteria 4799
284 Ga0451576_1161117 3300045051 Bacteria 807
285 Ga0451576_1162020 3300045051 Bacteria 807
286 Ga0451576_1512828 3300045051 Unclassified 697
287 Ga0466958_0435533 3300045836 Unclassified 848
288 Ga0495603_0429451 3300046455 Unclassified 757
289 Ga0495580_0096922 3300046472 Unclassified 2051
290 Ga0495580_0221702 3300046472 Bacteria 1299
291 Ga0495582_0027188 3300046473 Bacteria 3134
292 Ga0495582_0302387 3300046473 Bacteria 919
293 Ga0495582_0585055 3300046473 Bacteria 646
294 Ga0495662_0201788 3300046476 Bacteria 980
295 Ga0495630_0358804 3300046517 Bacteria 1116
296 Ga0495640_0495574 3300046533 Bacteria 744
297 Ga0495586_0055711 3300046535 Unclassified 2143
298 Ga0495598_0182395 3300046537 Archaea 750
299 Ga0495647_0041286 3300046681 Bacteria 1756
300 Ga0495658_0003662 3300046683 Bacteria 7604
301 Ga0495658_0106100 3300046683 Bacteria 1683
302 Ga0495674_0078282 3300047319 Unclassified 2841
303 Ga0495684_0110744 3300047471 Bacteria 2072
304 Ga0495593_0363699 3300047673 Bacteria 723
305 Ga0496102_0549790 3300048905 Bacteria 1077
306 Ga0496102_0728871 3300048905 Unclassified 914
307 Ga0496103_0637379 3300048906 Unclassified 678
308 Ga0496104_0875114 3300048907 Unclassified 804
309 Ga0496108_0224384 3300048911 Bacteria 1633
310 Ga0496109_1557147 3300048912 Bacteria 595
311 Ga0496111_0588338 3300048914 Bacteria 815
312 Ga0496112_0008962 3300048915 Bacteria 8981
313 Ga0496112_0085917 3300048915 Bacteria 3112
314 Ga0496112_1288451 3300048915 Unclassified 646
315 Ga0496113_0176083 3300048916 Bacteria 1695
316 Ga0501034_0105978 3300049571 Unclassified 2804
317 Ga0501036_0042506 3300049572 Bacteria 3848
318 Ga0501036_0432818 3300049572 Bacteria 1097
319 Ga0501039_0539051 3300049575 Unclassified 916
320 Ga0501039_0819118 3300049575 Bacteria 726
321 Ga0501039_0875567 3300049575 Unclassified 700
322 Ga0501040_0298911 3300049576 Bacteria 1151
323 Ga0501041_0067995 3300049577 Bacteria 2184
324 Ga0501042_0326829 3300049578 Unclassified 1108
325 Ga0501046_0306469 3300049580 Unclassified 1159
326 Ga0501048_0341009 3300049582 Unclassified 1068
327 Ga0501071_0263349 3300049587 Unclassified 1302
328 Ga0501071_0759487 3300049587 Bacteria 747
329 Ga0501072_0063041 3300049588 Bacteria 2924
330 Ga0501072_0854807 3300049588 Bacteria 711
331 Ga0501075_0026120 3300049591 Bacteria 4295
332 Ga0501075_0296441 3300049591 Unclassified 1232
333 Ga0501076_0113386 3300049592 Bacteria 2193
334 Ga0501076_0530000 3300049592 Bacteria 971
335 Ga0501079_0047302 3300049741 Bacteria 3319
336 Ga0501079_0653261 3300049741 Bacteria 828
337 Ga0501080_0183422 3300049742 Bacteria 1925
338 Ga0501081_0055277 3300049743 Bacteria 2743
339 Ga0501081_0203773 3300049743 Bacteria 1435
340 Ga0501045_0035793 3300049824 Bacteria 3605
341 nmdc:mga05p37_95295_c1 3300050507 Bacteria 3667
342 nmdc:mga09592_17669_c1 3300050508 Bacteria 5846
343 nmdc:mga09592_310808_c1 3300050508 Bacteria 1366
344 nmdc:mga0qj67_1367871_c1 3300050509 Unclassified 547
345 nmdc:mga0qj67_164111_c1 3300050509 Bacteria 1803
346 nmdc:mga0qj67_270008_c1 3300050509 Bacteria 1379
347 nmdc:mga0qj67_2823_c1 3300050509 Bacteria 12458
348 nmdc:mga0qj67_621083_c1 3300050509 Unclassified 863
349 nmdc:mga0qj67_953548_c1 3300050509 Unclassified 674
350 nmdc:mga06r32_1127015_c1 3300050510 Bacteria 733
351 nmdc:mga06r32_18310_c1 3300050510 Bacteria 6411
352 nmdc:mga06r32_31798_c1 3300050510 Bacteria 4959
353 nmdc:mga06r32_4653_c1 3300050510 Bacteria 12314
354 nmdc:mga06r32_536816_c1 3300050510 Bacteria 1144
355 nmdc:mga08y16_1109706_c1 3300050511 Unclassified 766
356 nmdc:mga0n895_276600_c1 3300050512 Bacteria 1703
357 nmdc:mga0n895_372406_c1 3300050512 Bacteria 1446
358 nmdc:mga0rr50_194594_c1 3300050513 Unclassified 1663
359 nmdc:mga0rr50_559661_c1 3300050513 Bacteria 974
360 nmdc:mga0rr50_87367_c1 3300050513 Bacteria 2420
361 nmdc:mga08x19_110642_c1 3300050514 Unclassified 1832
362 nmdc:mga08x19_132_c1 3300050514 Bacteria 66208
363 nmdc:mga08x19_253357_c1 3300050514 Bacteria 1216
364 nmdc:mga08x19_51743_c1 3300050514 Unclassified 2639
365 nmdc:mga0a205_1177050_c1 3300050515 Unclassified 614
366 Ga0495601_0722801 3300053077 Bacteria 635
367 Ga0500568_0001471 3300053139 Bacteria 15103
368 Ga0501084_0062038 3300054114 Bacteria 3130
369 Ga0501084_0107976 3300054114 Bacteria 2338
370 Ga0590071_035717 3300059421 Unclassified 1190
371 Ga0590075_031023 3300059424 Unclassified 1354
372 Ga0590075_048507 3300059424 Unclassified 1089
373 Ga0501082_0360658 3300060353 Bacteria 1268
374 Ga0530510_0023015 3300061734 Bacteria 4440
375 Ga0530510_0164214 3300061734 Unclassified 1643
376 Ga0530510_0164399 3300061734 Bacteria 1642
377 Ga0070717_10830396
378 JGI26133J50247_101714
379 JGI26143J51219_1001754
380 JGI26141J51220_1001468
381 Ga0065712_10379181
382 Ga0065715_10092029
383 Ga0065715_10248986
384 Ga0065707_10256272
385 Ga0070658_10140947
386 Ga0070683_100104688
387 Ga0070683_100202106
388 Ga0070683_100376175
389 Ga0070683_101615866
390 Ga0070670_100863377
391 Ga0070670_101533175
392 Ga0070660_100413943
393 Ga0070660_100615321
394 Ga0070689_100614438
395 Ga0070689_101053576
396 Ga0070669_100243515
397 Ga0070675_100026832
398 Ga0070659_100180783
399 Ga0070703_10231412
400 Ga0070709_10480507
401 Ga0070713_100048565
402 Ga0070711_100496589
403 Ga0070711_101125809
404 Ga0070705_100386487
405 Ga0070705_100762583
406 Ga0070694_100945539
407 Ga0070708_100023206
408 Ga0070708_100391500
409 Ga0070662_100412365
410 Ga0070706_100026373
411 Ga0070706_100093231
412 Ga0070706_100130056
413 Ga0070706_100273357
414 Ga0070707_100036226
415 Ga0070707_100416603
416 Ga0070707_100501564
417 Ga0070707_100792379
418 Ga0070707_101167901
419 Ga0070698_100018436
420 Ga0070698_100259641
421 Ga0070698_100330046
422 Ga0070699_100097474
423 Ga0070699_100200642
424 Ga0070699_100688862
425 Ga0070699_100741922
426 Ga0070679_100806499
427 Ga0070684_100035799
428 Ga0070697_100015474
429 Ga0070697_100016849
430 Ga0070697_100443871
431 Ga0070697_100498144
432 Ga0068853_100512852
433 Ga0070672_100422462
434 Ga0070696_100696303
435 Ga0070665_101027818
436 Ga0070704_100069715
437 Ga0070704_101135660
438 Ga0068855_100137287
439 Ga0068855_100188256
440 Ga0068855_100704221
441 Ga0070664_100043876
442 Ga0070664_100056849
443 Ga0070664_101790637
444 Ga0068857_100921182
445 Ga0068857_101648801
446 Ga0068854_100413553
447 Ga0068859_100140357
448 Ga0068859_100685412
449 Ga0068864_100713053
450 Ga0068851_10031701
451 Ga0068858_100025298
452 Ga0068858_100213778
453 Ga0068858_100998482
454 Ga0068860_100038391
455 Ga0068860_101310084
456 Ga0068862_100195297
457 Ga0070717_10042247
458 Ga0070717_10066550
459 Ga0070717_10599192
460 Ga0070717_10797464
461 Ga0070715_10579411
462 Ga0070716_100472351
463 Ga0070716_100505047
464 Ga0070716_100718777
465 Ga0070716_100730619
466 Ga0070712_100119735
467 Ga0070712_100188022
468 Ga0070712_101068533
469 Ga0075367_10547556
470 Ga0068871_101918439
471 Ga0075428_100027051
472 Ga0075428_100066688
473 Ga0075428_100162618
474 Ga0075428_100328400
475 Ga0075428_100461441
476 Ga0075428_101080480
477 Ga0075430_100029294
478 Ga0075430_100192288
479 Ga0075430_100193728
480 Ga0075430_100926614
481 Ga0075431_100003131
482 Ga0075431_100098707
483 Ga0075431_100383537
484 Ga0075431_100464788
485 Ga0075431_100552966
486 Ga0075431_101248544
487 Ga0075433_10071295
488 Ga0075433_10631266
489 Ga0075433_10631353
490 Ga0075434_100297062
491 Ga0075434_100874933
492 Ga0075434_100997279
493 Ga0075429_100069098
494 Ga0075429_100080276
495 Ga0075429_100272034
496 Ga0068865_100984423
497 Ga0075436_100000069
498 Ga0075436_100042839
499 Ga0075436_100055625
500 Ga0075436_100293975
501 Ga0097620_100140352
502 Ga0097620_100685476
503 Ga0075435_100116718
504 Ga0075435_100293687
505 Ga0075435_100946396
506 Ga0105250_10021797
507 Ga0105240_10002806
508 Ga0105240_10015065
509 Ga0105240_10082623
510 Ga0105240_10181345
511 Ga0105240_10470817
512 Ga0111539_10787933
513 Ga0111539_10934974
514 Ga0111539_11001437
515 Ga0111539_11250756
516 Ga0111539_11303842
517 Ga0111539_11729775
518 Ga0105245_10495854
519 Ga0105247_10282722
520 Ga0114129_10046122
521 Ga0114129_10077817
522 Ga0114129_10303145
523 Ga0114129_10531047
524 Ga0114129_11360350
525 Ga0114129_11789024
526 Ga0114129_12246344
527 Ga0105243_12284709
528 Ga0105241_10200265
529 Ga0105241_10309915
530 Ga0105248_10047067
531 Ga0105248_10845322
532 Ga0105237_10006255
533 Ga0105237_10128234
534 Ga0105237_10328309
535 Ga0105237_10855446
536 Ga0105237_10967846
537 Ga0105238_10263810
538 Ga0105239_10063008
539 Ga0105239_10115400
540 Ga0105239_10694209
541 Ga0105246_10874875
542 Ga0157374_10174348
543 Ga0157378_10029806
544 Ga0157378_11077041
545 Ga0157378_11838606
546 Ga0163162_10061166
547 Ga0163162_11263762
548 Ga0157372_10754908
549 Ga0163163_10171137
550 Ga0163163_10498337
551 Ga0157380_11176239
552 Ga0157380_11381167
553 Ga0182008_10258358
554 Ga0157379_11551984
555 Ga0182007_10047934
556 Ga0207710_10008269
557 Ga0207699_10031500
558 Ga0207645_10635280
559 Ga0207684_10006461
560 Ga0207684_10016252
561 Ga0207684_10032141
562 Ga0207684_10244818
563 Ga0207684_10366296
564 Ga0207684_10558591
565 Ga0207654_10194527
566 Ga0207695_10027404
567 Ga0207695_10081592
568 Ga0207671_10077032
569 Ga0207671_10943651
570 Ga0207671_11145266
571 Ga0207693_10646610
572 Ga0207663_10862042
573 Ga0207657_10035038
574 Ga0207649_10243301
575 Ga0207646_10005479
576 Ga0207646_10095280
577 Ga0207646_10135369
578 Ga0207646_10143636
579 Ga0207646_10485857
580 Ga0207646_10708225
581 Ga0207694_10203811
582 Ga0207659_11127727
583 Ga0207700_10080074
584 Ga0207700_10786000
585 Ga0207664_10137913
586 Ga0207664_10225877
587 Ga0207690_10155270
588 Ga0207690_10438842
589 Ga0207670_10056377
590 Ga0207665_10353685
591 Ga0207665_10479925
592 Ga0207691_10476200
593 Ga0207711_10035984
594 Ga0207689_10051885
595 Ga0207661_10070385
596 Ga0207661_10968549
597 Ga0207679_10068642
598 Ga0207667_10249176
599 Ga0207703_10058606
600 Ga0207641_10610529
601 Ga0207676_10533836
602 Ga0207674_10737418
603 Ga0207675_100874347
604 Ga0209973_1008860
605 Ga0209967_1002415
606 Ga0209984_1013886
607 Ga0209995_1007799
608 Ga0209968_1001587
609 Ga0209982_1012365
610 Ga0209970_1000718
611 Ga0210002_1000613
612 Ga0209983_1003862
613 Ga0209971_1000317
614 Ga0209971_1002898
615 Ga0209966_1016614
616 Ga0209998_10004085
617 Ga0209974_10000287
618 Ga0268266_10892654
619 Ga0268266_11470602
620 Ga0268265_10143890
621 Ga0268265_10415544
622 Ga0268265_10537351
623 Ga0268264_10012417
624 Ga0265760_10011442
625 Ga0265332_10331172
626 Ga0265325_10182420
627 Ga0265340_10151532
628 Ga0265339_10159763
629 Ga0265339_10165101
630 Ga0265339_10295252
631 Ga0265331_10011482
632 Ga0265316_10251522
633 Ga0265314_10131112
634 Ga0265314_10216029
635 Ga0265342_10008266
636 Ga0265342_10063136
637 Ga0316576_10228909
638 Ga0307416_100558989
639 Ga0373926_0373157
640 Ga0373944_0303914
641 Ga0373923_0248328
642 Ga0373943_0551764
643 Ga0373927_0394318
644 Ga0373947_0223258
645 Ga0436364_0167295
646 Ga0436362_0374081
647 Ga0439436_0221049
648 Ga0451845_0384636
649 Ga0439456_026185
650 Ga0439460_0072708
651 Ga0439460_0089281
652 Ga0450893_0095142
653 Ga0451577_0027696
654 Ga0451577_0092265
655 Ga0453684_0173914
656 Ga0453684_0826765
657 Ga0453684_2019297
658 Ga0466971_0630478
659 Ga0451576_0042471
660 Ga0451576_1161117
661 Ga0451576_1162020
662 Ga0451576_1512828
663 Ga0466958_0435533
664 Ga0495603_0429451
665 Ga0495580_0096922
666 Ga0495580_0221702
667 Ga0495582_0027188
668 Ga0495582_0302387
669 Ga0495582_0585055
670 Ga0495662_0201788
671 Ga0495630_0358804
672 Ga0495640_0495574
673 Ga0495586_0055711
674 Ga0495598_0182395
675 Ga0495647_0041286
676 Ga0495658_0003662
677 Ga0495658_0106100
678 Ga0495674_0078282
679 Ga0495684_0110744
680 Ga0495593_0363699
681 Ga0496102_0549790
682 Ga0496102_0728871
683 Ga0496103_0637379
684 Ga0496104_0875114
685 Ga0496108_0224384
686 Ga0496109_1557147
687 Ga0496111_0588338
688 Ga0496112_0008962
689 Ga0496112_0085917
690 Ga0496112_1288451
691 Ga0496113_0176083
692 Ga0501034_0105978
693 Ga0501036_0042506
694 Ga0501036_0432818
695 Ga0501039_0539051
696 Ga0501039_0819118
697 Ga0501039_0875567
698 Ga0501040_0298911
699 Ga0501041_0067995
700 Ga0501042_0326829
701 Ga0501046_0306469
702 Ga0501048_0341009
703 Ga0501071_0263349
704 Ga0501071_0759487
705 Ga0501072_0063041
706 Ga0501072_0854807
707 Ga0501075_0026120
708 Ga0501075_0296441
709 Ga0501076_0113386
710 Ga0501076_0530000
711 Ga0501079_0047302
712 Ga0501079_0653261
713 Ga0501080_0183422
714 Ga0501081_0055277
715 Ga0501081_0203773
716 Ga0501045_0035793
717 nmdc:mga05p37_95295_c1
718 nmdc:mga09592_17669_c1
719 nmdc:mga09592_310808_c1
720 nmdc:mga0qj67_1367871_c1
721 nmdc:mga0qj67_164111_c1
722 nmdc:mga0qj67_270008_c1
723 nmdc:mga0qj67_2823_c1
724 nmdc:mga0qj67_621083_c1
725 nmdc:mga0qj67_953548_c1
726 nmdc:mga06r32_1127015_c1
727 nmdc:mga06r32_18310_c1
728 nmdc:mga06r32_31798_c1
729 nmdc:mga06r32_4653_c1
730 nmdc:mga06r32_536816_c1
731 nmdc:mga08y16_1109706_c1
732 nmdc:mga0n895_276600_c1
733 nmdc:mga0n895_372406_c1
734 nmdc:mga0rr50_194594_c1
735 nmdc:mga0rr50_559661_c1
736 nmdc:mga0rr50_87367_c1
737 nmdc:mga08x19_110642_c1
738 nmdc:mga08x19_132_c1
739 nmdc:mga08x19_253357_c1
740 nmdc:mga08x19_51743_c1
741 nmdc:mga0a205_1177050_c1
742 Ga0495601_0722801
743 Ga0500568_0001471
744 Ga0501084_0062038
745 Ga0501084_0107976
746 Ga0590071_035717
747 Ga0590075_031023
748 Ga0590075_048507
749 Ga0501082_0360658
750 Ga0530510_0023015
751 Ga0530510_0164214
752 Ga0530510_0164399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

38

174

0.91

PF04978

DUF664

Protein of unknown function (DUF664)

35

180

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8772 8 152
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8177 7 164
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7739 7 146
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.7728 1 164
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.7581 8 146
ID Description Score Start End Superfamily
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8687 8 152 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8153 7 164 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7739 7 146 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7626 8 152 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7525 8 146 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V9TUW0-F1-model_v4 DinB-like domain-containing protein 0.9843 1 170
AF-A0A2V9TUW0-F1-model_v4 DinB-like domain-containing protein 0.9785 1 170
AF-A0A3N5ZW94-F1-model_v4 DinB family protein 0.9749 4 120
AF-A0A3D1AVG6-F1-model_v4 DinB-like domain-containing protein 0.9696 1 162
AF-A0A7Y8HY27-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9669 1 170 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949

Map