F427278

General Info

Members Datasets Scaffolds Average Seq Length
376 229 752 314

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100002382|Ga0070698_10000238217
Length 354
Sequence MSSQAARRPGKRAVRHPLRRRSVRDLSPLGKLVAYLILGLWALVVLFPLYWLAITSFKLPIQVNKGPVYLPFVDFHPSLDAWHYIFVDLRDDTLRPYVNSVVVAVGSSVVAMLFGSAAAYALIRFPYRPRVGVIALFVGCLVLAAVLIGFGVSPPLAIVVAGACFVLLARTVGHRFKRALSNRDIAFWMISQRILPPVAVVIPIYVLFQHVGLLDTRTALIITYAATNLPIVVWLMRDYFNRLPWELEEAALVDGASTFRVFRSITLPLSRPGLVATFLIVFVFAWNEYLLALFLSSANAQTMPLTVAAQNATRGPQWWYMSVLIQIMILPVIALAIGLERVISRGLLVGAVKG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
101 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
102 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
225 2818991450 Burkholderia sp. 604 Isolate Unclassified
226 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
227 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
228 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
229 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0.27
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 6.12
Rhizosphere 88.3
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100002382 3300005471 Bacteria 20736
2 JGI24739J22299_10018041 3300001989 Bacteria 2540
3 JGI24739J22299_10027119 3300001989 Bacteria 2005
4 JGI24735J21928_10000355 3300002067 Bacteria 15944
5 JGI24735J21928_10010032 3300002067 Bacteria 3029
6 JGI25406J46586_10007689 3300003203 Bacteria 4901
7 JGI25407J50210_10002824 3300003373 Bacteria 4133
8 Ga0070666_10184565 3300005335 Bacteria 1464
9 Ga0070680_100100018 3300005336 Bacteria 2407
10 Ga0070660_100003747 3300005339 Bacteria 10507
11 Ga0070668_100157505 3300005347 Bacteria 1841
12 Ga0070675_100408505 3300005354 Bacteria 1212
13 Ga0070671_100141230 3300005355 Bacteria 2032
14 Ga0070703_10001827 3300005406 Bacteria 6279
15 Ga0070713_100177598 3300005436 Unclassified 1912
16 Ga0070705_100003101 3300005440 Bacteria 8176
17 Ga0070708_100000008 3300005445 Bacteria 146021
18 Ga0070708_100015657 3300005445 Bacteria 6267
19 Ga0070708_100088575 3300005445 Bacteria 2815
20 Ga0070708_100142502 3300005445 Bacteria 2223
21 Ga0070708_100341252 3300005445 Unclassified 1412
22 Ga0070681_10236219 3300005458 Bacteria 1742
23 Ga0070706_100000396 3300005467 Bacteria 52498
24 Ga0070706_100000448 3300005467 Bacteria 49282
25 Ga0070706_100093552 3300005467 Bacteria 2789
26 Ga0070706_100253917 3300005467 Bacteria 1641
27 Ga0070706_100260005 3300005467 Bacteria 1620
28 Ga0070707_100000004 3300005468 Bacteria 265003
29 Ga0070707_100052715 3300005468 Bacteria 3900
30 Ga0070707_100077171 3300005468 Bacteria 3214
31 Ga0070707_100430455 3300005468 Bacteria 1280
32 Ga0070698_100003112 3300005471 Bacteria 18293
33 Ga0070698_100261215 3300005471 Bacteria 1664
34 Ga0070698_100282059 3300005471 Bacteria 1592
35 Ga0070698_100507117 3300005471 Bacteria 1144
36 Ga0070699_100000084 3300005518 Bacteria 89070
37 Ga0070699_100000087 3300005518 Bacteria 88377
38 Ga0070699_100000877 3300005518 Bacteria 27967
39 Ga0070699_100002109 3300005518 Bacteria 18029
40 Ga0070699_100004742 3300005518 Bacteria 12016
41 Ga0070699_100144782 3300005518 Bacteria 2099
42 Ga0070699_100317895 3300005518 Bacteria 1399
43 Ga0070679_100077504 3300005530 Bacteria 3313
44 Ga0070697_100000007 3300005536 Bacteria 197603
45 Ga0070697_100001457 3300005536 Bacteria 18017
46 Ga0070697_100003645 3300005536 Bacteria 11837
47 Ga0070697_100045770 3300005536 Bacteria 3546
48 Ga0070697_100056923 3300005536 Bacteria 3181
49 Ga0070697_100166801 3300005536 Bacteria 1862
50 Ga0070697_100210800 3300005536 Bacteria 1654
51 Ga0070697_100229179 3300005536 Unclassified 1584
52 Ga0070695_100011657 3300005545 Bacteria 5260
53 Ga0070696_100010003 3300005546 Bacteria 6344
54 Ga0070665_100515512 3300005548 Bacteria 1207
55 Ga0070704_100001540 3300005549 Bacteria 12432
56 Ga0068855_100166976 3300005563 Bacteria 2494
57 Ga0068861_100004758 3300005719 Bacteria 9127
58 Ga0068863_100277814 3300005841 Unclassified 1622
59 Ga0081455_10034029 3300005937 Bacteria 4571
60 Ga0081455_10040844 3300005937 Bacteria 4087
61 Ga0081538_10005429 3300005981 Bacteria 11446
62 Ga0081538_10008117 3300005981 Bacteria 8961
63 Ga0081539_10003699 3300005985 Bacteria 18239
64 Ga0081539_10005576 3300005985 Bacteria 12726
65 Ga0081539_10019693 3300005985 Bacteria 4605
66 Ga0075432_10004731 3300006058 Bacteria 4635
67 Ga0070716_100080819 3300006173 Bacteria 1939
68 Ga0075428_100017961 3300006844 Bacteria 7816
69 Ga0075430_100000732 3300006846 Bacteria 25147
70 Ga0075431_100010500 3300006847 Bacteria 9310
71 Ga0075433_10011817 3300006852 Bacteria 7032
72 Ga0075433_10062448 3300006852 Bacteria 3262
73 Ga0075433_10154227 3300006852 Bacteria 2043
74 Ga0075433_10176331 3300006852 Bacteria 1902
75 Ga0075434_100016595 3300006871 Bacteria 7080
76 Ga0075434_100343878 3300006871 Bacteria 1513
77 Ga0075429_100009337 3300006880 Bacteria 8517
78 Ga0075436_100005578 3300006914 Bacteria 8638
79 Ga0075436_100008016 3300006914 Bacteria 7231
80 Ga0075436_100015010 3300006914 Bacteria 5310
81 Ga0075435_100002761 3300007076 Bacteria 11727
82 Ga0099794_10012357 3300007265 Bacteria 3683
83 Ga0105251_10000072 3300009011 Bacteria 97611
84 Ga0105251_10000289 3300009011 Bacteria 50651
85 Ga0111539_10017567 3300009094 Bacteria 8853
86 Ga0105245_10428290 3300009098 Bacteria 1327
87 Ga0105247_10141917 3300009101 Bacteria 1575
88 Ga0114129_10002269 3300009147 Bacteria 26610
89 Ga0114129_10046098 3300009147 Bacteria 6128
90 Ga0114129_10127460 3300009147 Bacteria 3498
91 Ga0114129_10143566 3300009147 Bacteria 3271
92 Ga0114129_10159814 3300009147 Bacteria 3079
93 Ga0114129_10322597 3300009147 Bacteria 2053
94 Ga0114129_10524070 3300009147 Bacteria 1545
95 Ga0114129_10526096 3300009147 Bacteria 1541
96 Ga0105248_10376575 3300009177 Bacteria 1598
97 Ga0105237_10120700 3300009545 Bacteria 2615
98 Ga0105249_10083437 3300009553 Bacteria 2975
99 Ga0157369_10300287 3300013105 Bacteria 1670
100 Ga0163162_10001279 3300013306 Bacteria 23543
101 Ga0163162_10035817 3300013306 Bacteria 4944
102 Ga0163162_10572190 3300013306 Bacteria 1257
103 Ga0157375_10103226 3300013308 Bacteria 2938
104 Ga0163163_10497771 3300014325 Bacteria 1280
105 Ga0182007_10000922 3300015262 Bacteria 16257
106 Ga0207426_1010624 3300025302 Bacteria 3561
107 Ga0207426_1038542 3300025302 Bacteria 1504
108 Ga0207713_1000651 3300025735 Bacteria 33250
109 Ga0207713_1002779 3300025735 Bacteria 12367
110 Ga0207653_10001363 3300025885 Bacteria 7963
111 Ga0207653_10003787 3300025885 Bacteria 4762
112 Ga0207680_10283244 3300025903 Bacteria 1152
113 Ga0207647_10011214 3300025904 Bacteria 6294
114 Ga0207647_10012135 3300025904 Bacteria 6012
115 Ga0207705_10003553 3300025909 Bacteria 11868
116 Ga0207684_10000005 3300025910 Bacteria 736617
117 Ga0207684_10000014 3300025910 Bacteria 440027
118 Ga0207684_10000034 3300025910 Bacteria 291009
119 Ga0207684_10000035 3300025910 Bacteria 289353
120 Ga0207684_10000183 3300025910 Bacteria 100388
121 Ga0207684_10027359 3300025910 Bacteria 4860
122 Ga0207657_10000146 3300025919 Bacteria 71932
123 Ga0207646_10000018 3300025922 Bacteria 291009
124 Ga0207646_10000111 3300025922 Bacteria 112089
125 Ga0207646_10000119 3300025922 Bacteria 107784
126 Ga0207646_10000435 3300025922 Bacteria 55844
127 Ga0207646_10001367 3300025922 Bacteria 30219
128 Ga0207646_10010941 3300025922 Bacteria 8811
129 Ga0207646_10022308 3300025922 Bacteria 5835
130 Ga0207646_10043512 3300025922 Bacteria 4032
131 Ga0207646_10150826 3300025922 Bacteria 2096
132 Ga0207687_10284105 3300025927 Bacteria 1327
133 Ga0207700_10169235 3300025928 Bacteria 1821
134 Ga0207644_10134372 3300025931 Bacteria 1898
135 Ga0207706_10014580 3300025933 Bacteria 7118
136 Ga0207711_10088303 3300025941 Bacteria 2722
137 Ga0207712_10224613 3300025961 Bacteria 1503
138 Ga0207678_10133274 3300026067 Bacteria 2120
139 Ga0207676_10132335 3300026095 Unclassified 2123
140 Ga0207675_100012277 3300026118 Bacteria 8002
141 Ga0209588_1005857 3300027671 Bacteria 3541
142 Ga0207428_10000630 3300027907 Bacteria 41466
143 Ga0268266_10295750 3300028379 Bacteria 1509
144 Ga0307513_10173535 3300031456 Bacteria 2030
145 Ga0307408_100004758 3300031548 Bacteria 9152
146 Ga0316579_10053775 3300031691 Bacteria 1887
147 Ga0316576_10013116 3300031727 Bacteria 5498
148 Ga0316577_10002508 3300031733 Bacteria 9112
149 Ga0307413_10007018 3300031824 Bacteria 5194
150 Ga0307410_10013150 3300031852 Bacteria 4817
151 Ga0307410_10147484 3300031852 Bacteria 1747
152 Ga0307406_10004198 3300031901 Bacteria 7842
153 Ga0307406_10036340 3300031901 Bacteria 3034
154 Ga0307407_10000616 3300031903 Bacteria 11349
155 Ga0307407_10133899 3300031903 Bacteria 1589
156 Ga0307409_100004612 3300031995 Bacteria 7778
157 Ga0307409_100015681 3300031995 Bacteria 4982
158 Ga0307409_100026936 3300031995 Bacteria 4064
159 Ga0307409_100221175 3300031995 Bacteria 1709
160 Ga0307416_100001809 3300032002 Bacteria 11879
161 Ga0307416_100004859 3300032002 Bacteria 8178
162 Ga0307411_10192907 3300032005 Bacteria 1557
163 Ga0307415_100007364 3300032126 Bacteria 6016
164 Ga0307415_100023386 3300032126 Bacteria 3834
165 Ga0307415_100050150 3300032126 Bacteria 2826
166 Ga0307415_100060624 3300032126 Bacteria 2615
167 Ga0373933_0171718 3300035724 Bacteria 1380
168 Ga0373937_0006847 3300036401 Bacteria 9836
169 Ga0316584_0047743 3300036712 Bacteria 3199
170 Ga0316584_0064621 3300036712 Bacteria 2740
171 Ga0395899_0136844 3300037312 Bacteria 1746
172 Ga0395900_0142536 3300037418 Bacteria 2453
173 Ga0395900_0164387 3300037418 Bacteria 2262
174 Ga0395900_0268995 3300037418 Bacteria 1700
175 Ga0395900_0324720 3300037418 Bacteria 1518
176 Ga0395898_0444004 3300037466 Unclassified 1236
177 Ga0395905_0093491 3300037471 Bacteria 2820
178 Ga0395905_0301308 3300037471 Bacteria 1490
179 Ga0395905_0416038 3300037471 Bacteria 1240
180 Ga0395905_0431806 3300037471 Bacteria 1214
181 Ga0395901_0021846 3300038443 Bacteria 6558
182 Ga0395901_0124454 3300038443 Bacteria 2709
183 Ga0395901_0259381 3300038443 Bacteria 1809
184 Ga0395901_0464039 3300038443 Bacteria 1294
185 Ga0451843_1530478 3300041509 Bacteria 1012
186 Ga0439448_0028075 3300042005 Bacteria 1775
187 Ga0450902_021521 3300042137 Bacteria 1066
188 Ga0450905_005385 3300042142 Bacteria 1718
189 Ga0450906_011150 3300042145 Bacteria 1686
190 Ga0439460_0012343 3300042461 Bacteria 2215
191 Ga0451577_0025614 3300042876 Bacteria 5351
192 Ga0451577_0064783 3300042876 Bacteria 3259
193 Ga0453684_0038499 3300044712 Bacteria 6537
194 Ga0451576_0024613 3300045051 Bacteria 6501
195 Ga0495603_0000430 3300046455 Bacteria 23265
196 Ga0495590_0000522 3300046457 Bacteria 18540
197 Ga0495629_0000184 3300046459 Bacteria 56265
198 Ga0495638_0004970 3300046460 Bacteria 9988
199 Ga0495653_0000402 3300046463 Bacteria 34782
200 Ga0495653_0061791 3300046463 Bacteria 2833
201 Ga0495650_0000155 3300046471 Bacteria 155947
202 Ga0495580_0010861 3300046472 Bacteria 7067
203 Ga0495582_0003942 3300046473 Bacteria 8340
204 Ga0495582_0015510 3300046473 Bacteria 4186
205 Ga0495605_0013065 3300046474 Bacteria 4589
206 Ga0495605_0054302 3300046474 Bacteria 1941
207 Ga0495664_0002247 3300046477 Bacteria 10351
208 Ga0495664_0055077 3300046477 Bacteria 2366
209 Ga0495664_0117930 3300046477 Bacteria 1604
210 Ga0495596_0017837 3300046500 Bacteria 2933
211 Ga0495607_0023452 3300046501 Bacteria 3863
212 Ga0495583_0021150 3300046506 Bacteria 3352
213 Ga0495606_0003521 3300046507 Bacteria 16538
214 Ga0495620_0034174 3300046515 Bacteria 2301
215 Ga0495663_0005609 3300046525 Bacteria 3476
216 Ga0495666_0000064 3300046526 Bacteria 40955
217 Ga0495642_0001828 3300046528 Bacteria 9115
218 Ga0495652_0009733 3300046529 Bacteria 8718
219 Ga0495654_0025111 3300046530 Bacteria 3072
220 Ga0495665_0000096 3300046531 Bacteria 40491
221 Ga0495665_0002840 3300046531 Bacteria 9354
222 Ga0495640_0001956 3300046533 Bacteria 16435
223 Ga0495586_0000314 3300046535 Bacteria 30664
224 Ga0495587_0004876 3300046536 Bacteria 8804
225 Ga0495598_0004864 3300046537 Bacteria 2939
226 Ga0495597_0010239 3300046542 Bacteria 4591
227 Ga0495645_0000102 3300046543 Bacteria 59126
228 Ga0495656_0002443 3300046615 Bacteria 6177
229 Ga0495634_0020961 3300046642 Bacteria 4629
230 Ga0495611_0008247 3300046648 Bacteria 4420
231 Ga0495635_0007191 3300046663 Bacteria 7775
232 Ga0495659_0022997 3300046664 Bacteria 2114
233 Ga0495661_0004510 3300046665 Bacteria 10032
234 Ga0495588_0022177 3300046674 Bacteria 3137
235 Ga0495599_0000578 3300046678 Bacteria 20921
236 Ga0495623_0038427 3300046679 Bacteria 3060
237 Ga0495646_0017295 3300046680 Bacteria 4574
238 Ga0495646_0031591 3300046680 Bacteria 3298
239 Ga0495613_0017023 3300046689 Bacteria 5411
240 Ga0495613_0023652 3300046689 Bacteria 4579
241 Ga0495624_0011389 3300046690 Bacteria 6111
242 Ga0495624_0013313 3300046690 Bacteria 5609
243 Ga0495649_0002250 3300046694 Bacteria 13705
244 Ga0495589_0006379 3300046794 Bacteria 6232
245 Ga0495581_0000479 3300047315 Bacteria 20370
246 Ga0495581_0005660 3300047315 Bacteria 7246
247 Ga0495604_0000954 3300047317 Bacteria 24110
248 Ga0495604_0004914 3300047317 Bacteria 10598
249 Ga0495674_0047817 3300047319 Bacteria 3790
250 Ga0495674_0141818 3300047319 Bacteria 2019
251 Ga0495676_0029101 3300047321 Bacteria 4706
252 Ga0495680_0011558 3300047322 Bacteria 7807
253 Ga0495680_0023820 3300047322 Bacteria 5086
254 Ga0495683_0003400 3300047323 Bacteria 9294
255 Ga0495675_0002641 3300047444 Bacteria 10742
256 Ga0495675_0017498 3300047444 Bacteria 4543
257 Ga0495679_001009 3300047446 Bacteria 17320
258 Ga0495685_026006 3300047447 Bacteria 2015
259 Ga0495681_0038107 3300047470 Bacteria 2360
260 Ga0495684_0003315 3300047471 Bacteria 12638
261 Ga0495593_0005956 3300047673 Bacteria 7182
262 Ga0495593_0046499 3300047673 Bacteria 2312
263 Ga0495602_0006713 3300048088 Bacteria 12071
264 Ga0495614_0000793 3300048089 Bacteria 13381
265 Ga0496100_0004560 3300048903 Bacteria 7361
266 Ga0496100_0124029 3300048903 Bacteria 1811
267 Ga0496101_0003250 3300048904 Bacteria 10093
268 Ga0496101_0072801 3300048904 Bacteria 2523
269 Ga0496101_0128228 3300048904 Unclassified 1924
270 Ga0496102_0039032 3300048905 Bacteria 4288
271 Ga0496103_0003304 3300048906 Bacteria 9861
272 Ga0496104_0048563 3300048907 Bacteria 4001
273 Ga0496105_0057514 3300048908 Bacteria 3211
274 Ga0496105_0138540 3300048908 Unclassified 2004
275 Ga0496106_0004908 3300048909 Bacteria 9897
276 Ga0496108_0000076 3300048911 Bacteria 105286
277 Ga0496108_0095908 3300048911 Bacteria 2526
278 Ga0496108_0145644 3300048911 Unclassified 2042
279 Ga0496109_0066361 3300048912 Bacteria 3304
280 Ga0496110_0007630 3300048913 Bacteria 8653
281 Ga0496110_0174952 3300048913 Unclassified 1948
282 Ga0496111_0000166 3300048914 Bacteria 29882
283 Ga0496111_0263497 3300048914 Bacteria 1279
284 Ga0496112_0003027 3300048915 Bacteria 13744
285 Ga0496113_0014170 3300048916 Bacteria 5430
286 Ga0496113_0092989 3300048916 Bacteria 2327
287 Ga0496114_0001973 3300048917 Bacteria 15587
288 Ga0496116_0005262 3300048919 Bacteria 12088
289 Ga0496117_0011286 3300048920 Bacteria 8012
290 Ga0496118_0002675 3300048921 Bacteria 23557
291 Ga0496118_0010572 3300048921 Bacteria 9120
292 Ga0496118_0182466 3300048921 Bacteria 1266
293 Ga0496121_0065001 3300048924 Bacteria 2971
294 Ga0496122_0002609 3300048925 Bacteria 25235
295 Ga0496123_0025824 3300048926 Bacteria 4416
296 Ga0496124_0009012 3300048927 Bacteria 10323
297 Ga0496125_0003235 3300048928 Bacteria 20084
298 Ga0496126_0000679 3300048929 Bacteria 62626
299 Ga0501031_0006035 3300049568 Bacteria 7904
300 Ga0501031_0220191 3300049568 Bacteria 1236
301 Ga0501033_0041580 3300049570 Bacteria 3429
302 Ga0501036_0003487 3300049572 Bacteria 12574
303 Ga0501036_0136703 3300049572 Bacteria 2069
304 Ga0501037_0007986 3300049573 Bacteria 7755
305 Ga0501038_0030919 3300049574 Bacteria 4734
306 Ga0501039_0010666 3300049575 Bacteria 7001
307 Ga0501040_0000175 3300049576 Bacteria 36317
308 Ga0501040_0034295 3300049576 Bacteria 3439
309 Ga0501041_0000495 3300049577 Bacteria 20213
310 Ga0501041_0133263 3300049577 Bacteria 1548
311 Ga0501042_0023487 3300049578 Bacteria 4316
312 Ga0501042_0059102 3300049578 Bacteria 2737
313 Ga0501043_0213081 3300049579 Bacteria 1497
314 Ga0501046_0001719 3300049580 Bacteria 20894
315 Ga0501047_0238866 3300049581 Bacteria 1668
316 Ga0501048_0000979 3300049582 Bacteria 21153
317 Ga0501067_0155511 3300049583 Bacteria 1274
318 Ga0501070_0024511 3300049586 Bacteria 5059
319 Ga0501071_0006322 3300049587 Bacteria 7685
320 Ga0501071_0053573 3300049587 Bacteria 2910
321 Ga0501071_0078621 3300049587 Bacteria 2411
322 Ga0501071_0078890 3300049587 Bacteria 2407
323 Ga0501072_0048429 3300049588 Bacteria 3347
324 Ga0501074_0000618 3300049590 Bacteria 22144
325 Ga0501075_0006094 3300049591 Bacteria 8279
326 Ga0501075_0059506 3300049591 Bacteria 2878
327 Ga0501076_0021408 3300049592 Bacteria 4959
328 Ga0501077_0011214 3300049593 Bacteria 5592
329 Ga0501079_0000250 3300049741 Bacteria 32653
330 Ga0501079_0036499 3300049741 Bacteria 3786
331 Ga0501081_0000397 3300049743 Bacteria 23982
332 Ga0501044_0081828 3300049823 Bacteria 3268
333 Ga0501045_0018347 3300049824 Bacteria 4976
334 Ga0501045_0027906 3300049824 Bacteria 4071
335 Ga0501045_0188103 3300049824 Bacteria 1539
336 nmdc:mga05p37_219739_c1 3300050507 Bacteria 2293
337 nmdc:mga05p37_229917_c1 3300050507 Bacteria 2235
338 nmdc:mga05p37_2680_c1 3300050507 Bacteria 20724
339 nmdc:mga05p37_5339_c1 3300050507 Bacteria 15091
340 nmdc:mga05p37_565098_c1 3300050507 Unclassified 1291
341 nmdc:mga05p37_97792_c1 3300050507 Bacteria 3616
342 nmdc:mga09592_6044_c1 3300050508 Bacteria 9874
343 nmdc:mga0qj67_1327_c1 3300050509 Bacteria 17394
344 nmdc:mga06r32_143669_c1 3300050510 Bacteria 2363
345 nmdc:mga06r32_14827_c1 3300050510 Bacteria 7071
346 nmdc:mga08y16_2151_c1 3300050511 Bacteria 20215
347 nmdc:mga0n895_139748_c1 3300050512 Bacteria 2450
348 nmdc:mga0n895_506181_c1 3300050512 Bacteria 1216
349 nmdc:mga0n895_92662_c1 3300050512 Bacteria 3025
350 nmdc:mga0rr50_35410_c1 3300050513 Bacteria 3585
351 nmdc:mga08x19_206494_c1 3300050514 Bacteria 1348
352 nmdc:mga08x19_21143_c1 3300050514 Bacteria 4013
353 nmdc:mga08x19_7759_c1 3300050514 Bacteria 6375
354 nmdc:mga0a205_107049_c1 3300050515 Bacteria 2694
355 nmdc:mga0a205_191903_c1 3300050515 Bacteria 1935
356 nmdc:mga0a205_286285_c1 3300050515 Bacteria 1523
357 nmdc:mga0a205_315190_c1 3300050515 Bacteria 1436
358 nmdc:mga0a205_60927_c1 3300050515 Bacteria 3645
359 nmdc:mga0a205_99858_c1 3300050515 Bacteria 2801
360 Ga0500658_0013338 3300053134 Bacteria 3035
361 Ga0500658_0056273 3300053134 Bacteria 1622
362 Ga0500609_000155 3300053731 Bacteria 9375
363 Ga0501084_0006847 3300054114 Bacteria 9382
364 Ga0501084_0058477 3300054114 Bacteria 3226
365 Ga0501084_0106539 3300054114 Bacteria 2355
366 Ga0587085_011110 3300059506 Unclassified 1209
367 Ga0501082_0006200 3300060353 Bacteria 10377
368 Ga0501082_0085682 3300060353 Bacteria 2717
369 Ga0530510_0002682 3300061734 Bacteria 12229
370 Ga0530510_0054544 3300061734 Bacteria 2888
371 Ga0530510_0298317 3300061734 Bacteria 1206
372 2819620573 2818991450 Bacteria 6962147
373 2896388764 2896384573 Bacteria 7700774
374 2928108828 2928108538 Bacteria 7360024
375 2928136052 2928135762 Bacteria 7259641
376 2928504168 2928503688 Bacteria 7268108
377 Ga0070698_100002382
378 JGI24739J22299_10018041
379 JGI24739J22299_10027119
380 JGI24735J21928_10000355
381 JGI24735J21928_10010032
382 JGI25406J46586_10007689
383 JGI25407J50210_10002824
384 Ga0070666_10184565
385 Ga0070680_100100018
386 Ga0070660_100003747
387 Ga0070668_100157505
388 Ga0070675_100408505
389 Ga0070671_100141230
390 Ga0070703_10001827
391 Ga0070713_100177598
392 Ga0070705_100003101
393 Ga0070708_100000008
394 Ga0070708_100015657
395 Ga0070708_100088575
396 Ga0070708_100142502
397 Ga0070708_100341252
398 Ga0070681_10236219
399 Ga0070706_100000396
400 Ga0070706_100000448
401 Ga0070706_100093552
402 Ga0070706_100253917
403 Ga0070706_100260005
404 Ga0070707_100000004
405 Ga0070707_100052715
406 Ga0070707_100077171
407 Ga0070707_100430455
408 Ga0070698_100003112
409 Ga0070698_100261215
410 Ga0070698_100282059
411 Ga0070698_100507117
412 Ga0070699_100000084
413 Ga0070699_100000087
414 Ga0070699_100000877
415 Ga0070699_100002109
416 Ga0070699_100004742
417 Ga0070699_100144782
418 Ga0070699_100317895
419 Ga0070679_100077504
420 Ga0070697_100000007
421 Ga0070697_100001457
422 Ga0070697_100003645
423 Ga0070697_100045770
424 Ga0070697_100056923
425 Ga0070697_100166801
426 Ga0070697_100210800
427 Ga0070697_100229179
428 Ga0070695_100011657
429 Ga0070696_100010003
430 Ga0070665_100515512
431 Ga0070704_100001540
432 Ga0068855_100166976
433 Ga0068861_100004758
434 Ga0068863_100277814
435 Ga0081455_10034029
436 Ga0081455_10040844
437 Ga0081538_10005429
438 Ga0081538_10008117
439 Ga0081539_10003699
440 Ga0081539_10005576
441 Ga0081539_10019693
442 Ga0075432_10004731
443 Ga0070716_100080819
444 Ga0075428_100017961
445 Ga0075430_100000732
446 Ga0075431_100010500
447 Ga0075433_10011817
448 Ga0075433_10062448
449 Ga0075433_10154227
450 Ga0075433_10176331
451 Ga0075434_100016595
452 Ga0075434_100343878
453 Ga0075429_100009337
454 Ga0075436_100005578
455 Ga0075436_100008016
456 Ga0075436_100015010
457 Ga0075435_100002761
458 Ga0099794_10012357
459 Ga0105251_10000072
460 Ga0105251_10000289
461 Ga0111539_10017567
462 Ga0105245_10428290
463 Ga0105247_10141917
464 Ga0114129_10002269
465 Ga0114129_10046098
466 Ga0114129_10127460
467 Ga0114129_10143566
468 Ga0114129_10159814
469 Ga0114129_10322597
470 Ga0114129_10524070
471 Ga0114129_10526096
472 Ga0105248_10376575
473 Ga0105237_10120700
474 Ga0105249_10083437
475 Ga0157369_10300287
476 Ga0163162_10001279
477 Ga0163162_10035817
478 Ga0163162_10572190
479 Ga0157375_10103226
480 Ga0163163_10497771
481 Ga0182007_10000922
482 Ga0207426_1010624
483 Ga0207426_1038542
484 Ga0207713_1000651
485 Ga0207713_1002779
486 Ga0207653_10001363
487 Ga0207653_10003787
488 Ga0207680_10283244
489 Ga0207647_10011214
490 Ga0207647_10012135
491 Ga0207705_10003553
492 Ga0207684_10000005
493 Ga0207684_10000014
494 Ga0207684_10000034
495 Ga0207684_10000035
496 Ga0207684_10000183
497 Ga0207684_10027359
498 Ga0207657_10000146
499 Ga0207646_10000018
500 Ga0207646_10000111
501 Ga0207646_10000119
502 Ga0207646_10000435
503 Ga0207646_10001367
504 Ga0207646_10010941
505 Ga0207646_10022308
506 Ga0207646_10043512
507 Ga0207646_10150826
508 Ga0207687_10284105
509 Ga0207700_10169235
510 Ga0207644_10134372
511 Ga0207706_10014580
512 Ga0207711_10088303
513 Ga0207712_10224613
514 Ga0207678_10133274
515 Ga0207676_10132335
516 Ga0207675_100012277
517 Ga0209588_1005857
518 Ga0207428_10000630
519 Ga0268266_10295750
520 Ga0307513_10173535
521 Ga0307408_100004758
522 Ga0316579_10053775
523 Ga0316576_10013116
524 Ga0316577_10002508
525 Ga0307413_10007018
526 Ga0307410_10013150
527 Ga0307410_10147484
528 Ga0307406_10004198
529 Ga0307406_10036340
530 Ga0307407_10000616
531 Ga0307407_10133899
532 Ga0307409_100004612
533 Ga0307409_100015681
534 Ga0307409_100026936
535 Ga0307409_100221175
536 Ga0307416_100001809
537 Ga0307416_100004859
538 Ga0307411_10192907
539 Ga0307415_100007364
540 Ga0307415_100023386
541 Ga0307415_100050150
542 Ga0307415_100060624
543 Ga0373933_0171718
544 Ga0373937_0006847
545 Ga0316584_0047743
546 Ga0316584_0064621
547 Ga0395899_0136844
548 Ga0395900_0142536
549 Ga0395900_0164387
550 Ga0395900_0268995
551 Ga0395900_0324720
552 Ga0395898_0444004
553 Ga0395905_0093491
554 Ga0395905_0301308
555 Ga0395905_0416038
556 Ga0395905_0431806
557 Ga0395901_0021846
558 Ga0395901_0124454
559 Ga0395901_0259381
560 Ga0395901_0464039
561 Ga0451843_1530478
562 Ga0439448_0028075
563 Ga0450902_021521
564 Ga0450905_005385
565 Ga0450906_011150
566 Ga0439460_0012343
567 Ga0451577_0025614
568 Ga0451577_0064783
569 Ga0453684_0038499
570 Ga0451576_0024613
571 Ga0495603_0000430
572 Ga0495590_0000522
573 Ga0495629_0000184
574 Ga0495638_0004970
575 Ga0495653_0000402
576 Ga0495653_0061791
577 Ga0495650_0000155
578 Ga0495580_0010861
579 Ga0495582_0003942
580 Ga0495582_0015510
581 Ga0495605_0013065
582 Ga0495605_0054302
583 Ga0495664_0002247
584 Ga0495664_0055077
585 Ga0495664_0117930
586 Ga0495596_0017837
587 Ga0495607_0023452
588 Ga0495583_0021150
589 Ga0495606_0003521
590 Ga0495620_0034174
591 Ga0495663_0005609
592 Ga0495666_0000064
593 Ga0495642_0001828
594 Ga0495652_0009733
595 Ga0495654_0025111
596 Ga0495665_0000096
597 Ga0495665_0002840
598 Ga0495640_0001956
599 Ga0495586_0000314
600 Ga0495587_0004876
601 Ga0495598_0004864
602 Ga0495597_0010239
603 Ga0495645_0000102
604 Ga0495656_0002443
605 Ga0495634_0020961
606 Ga0495611_0008247
607 Ga0495635_0007191
608 Ga0495659_0022997
609 Ga0495661_0004510
610 Ga0495588_0022177
611 Ga0495599_0000578
612 Ga0495623_0038427
613 Ga0495646_0017295
614 Ga0495646_0031591
615 Ga0495613_0017023
616 Ga0495613_0023652
617 Ga0495624_0011389
618 Ga0495624_0013313
619 Ga0495649_0002250
620 Ga0495589_0006379
621 Ga0495581_0000479
622 Ga0495581_0005660
623 Ga0495604_0000954
624 Ga0495604_0004914
625 Ga0495674_0047817
626 Ga0495674_0141818
627 Ga0495676_0029101
628 Ga0495680_0011558
629 Ga0495680_0023820
630 Ga0495683_0003400
631 Ga0495675_0002641
632 Ga0495675_0017498
633 Ga0495679_001009
634 Ga0495685_026006
635 Ga0495681_0038107
636 Ga0495684_0003315
637 Ga0495593_0005956
638 Ga0495593_0046499
639 Ga0495602_0006713
640 Ga0495614_0000793
641 Ga0496100_0004560
642 Ga0496100_0124029
643 Ga0496101_0003250
644 Ga0496101_0072801
645 Ga0496101_0128228
646 Ga0496102_0039032
647 Ga0496103_0003304
648 Ga0496104_0048563
649 Ga0496105_0057514
650 Ga0496105_0138540
651 Ga0496106_0004908
652 Ga0496108_0000076
653 Ga0496108_0095908
654 Ga0496108_0145644
655 Ga0496109_0066361
656 Ga0496110_0007630
657 Ga0496110_0174952
658 Ga0496111_0000166
659 Ga0496111_0263497
660 Ga0496112_0003027
661 Ga0496113_0014170
662 Ga0496113_0092989
663 Ga0496114_0001973
664 Ga0496116_0005262
665 Ga0496117_0011286
666 Ga0496118_0002675
667 Ga0496118_0010572
668 Ga0496118_0182466
669 Ga0496121_0065001
670 Ga0496122_0002609
671 Ga0496123_0025824
672 Ga0496124_0009012
673 Ga0496125_0003235
674 Ga0496126_0000679
675 Ga0501031_0006035
676 Ga0501031_0220191
677 Ga0501033_0041580
678 Ga0501036_0003487
679 Ga0501036_0136703
680 Ga0501037_0007986
681 Ga0501038_0030919
682 Ga0501039_0010666
683 Ga0501040_0000175
684 Ga0501040_0034295
685 Ga0501041_0000495
686 Ga0501041_0133263
687 Ga0501042_0023487
688 Ga0501042_0059102
689 Ga0501043_0213081
690 Ga0501046_0001719
691 Ga0501047_0238866
692 Ga0501048_0000979
693 Ga0501067_0155511
694 Ga0501070_0024511
695 Ga0501071_0006322
696 Ga0501071_0053573
697 Ga0501071_0078621
698 Ga0501071_0078890
699 Ga0501072_0048429
700 Ga0501074_0000618
701 Ga0501075_0006094
702 Ga0501075_0059506
703 Ga0501076_0021408
704 Ga0501077_0011214
705 Ga0501079_0000250
706 Ga0501079_0036499
707 Ga0501081_0000397
708 Ga0501044_0081828
709 Ga0501045_0018347
710 Ga0501045_0027906
711 Ga0501045_0188103
712 nmdc:mga05p37_219739_c1
713 nmdc:mga05p37_229917_c1
714 nmdc:mga05p37_2680_c1
715 nmdc:mga05p37_5339_c1
716 nmdc:mga05p37_565098_c1
717 nmdc:mga05p37_97792_c1
718 nmdc:mga09592_6044_c1
719 nmdc:mga0qj67_1327_c1
720 nmdc:mga06r32_143669_c1
721 nmdc:mga06r32_14827_c1
722 nmdc:mga08y16_2151_c1
723 nmdc:mga0n895_139748_c1
724 nmdc:mga0n895_506181_c1
725 nmdc:mga0n895_92662_c1
726 nmdc:mga0rr50_35410_c1
727 nmdc:mga08x19_206494_c1
728 nmdc:mga08x19_21143_c1
729 nmdc:mga08x19_7759_c1
730 nmdc:mga0a205_107049_c1
731 nmdc:mga0a205_191903_c1
732 nmdc:mga0a205_286285_c1
733 nmdc:mga0a205_315190_c1
734 nmdc:mga0a205_60927_c1
735 nmdc:mga0a205_99858_c1
736 Ga0500658_0013338
737 Ga0500658_0056273
738 Ga0500609_000155
739 Ga0501084_0006847
740 Ga0501084_0058477
741 Ga0501084_0106539
742 Ga0587085_011110
743 Ga0501082_0006200
744 Ga0501082_0085682
745 Ga0530510_0002682
746 Ga0530510_0054544
747 Ga0530510_0298317
748 2819620573
749 2896388764
750 2928108828
751 2928136052
752 2928504168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

166

349

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.7291 17 264
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.7115 17 244
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.71 64 252
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7001 69 252
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.6924 17 292
ID Description Score Start End Superfamily
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8231 18 264 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8191 16 264 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8001 18 272 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7499 20 290 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7473 18 272 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A530QMM7-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9009 86 251 GO:0005886
GO:0055085
AF-A0A0F9H527-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8884 41 255 GO:0005886
GO:0055085
AF-A0A543BCU8-F1-model_v4 N,N'-diacetylchitobiose transport system permease protein 0.8852 10 250 GO:0005886
GO:0055085
AF-A0A377M0Y8-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.883 16 260 GO:0005886
GO:0055085
AF-A0A0F9H527-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8798 41 255 GO:0005886
GO:0055085

Map