F427273

General Info

Members Datasets Scaffolds Average Seq Length
376 188 752 261

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100215477|Ga0070708_1002154772
Length 305
Sequence LRPQLTIEELGTTRCTAWSRGSGDRLGRIANAFNRRSCFSWKNRAMSIVGKVESLWRYPVKSMRGEELDEMFVGYAGVYGDRLFAFASSANANGFPFFTGRDQRQMIRYRARFRNPEKAARPVNLSDAEKHNATPLCAAPNDLMVDIETPDGKTFAINDPALIDNLRLNTDGNHELTLLRSDKAITDCRPLSIFAVQTAKKLGEETGVAVDKRRFRANVYLDLTKADGFAEDAFVGKTLRIGPKVVVSILQRDGRCMMITLDPNTAEKSPAILKAVAQAHEGMAGVYGAVLEEGMIRKGDPVELL

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.72
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 31.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100215477 3300005445 Bacteria 1800
2 JGI25406J46586_10000040 3300003203 Bacteria 57199
3 Ga0065703_1020555 3300005272 Unclassified 1699
4 Ga0065714_10146137 3300005288 Unclassified 1137
5 Ga0065704_10022310 3300005289 Bacteria 1514
6 Ga0065704_10109469 3300005289 Unclassified 2002
7 Ga0065712_10004068 3300005290 Unclassified 3754
8 Ga0065712_10098833 3300005290 Bacteria 2099
9 Ga0065712_10110388 3300005290 Bacteria 1837
10 Ga0065712_10198316 3300005290 Bacteria 1118
11 Ga0065715_10251938 3300005293 Bacteria 1148
12 Ga0065715_10300261 3300005293 Unclassified 1028
13 Ga0065707_10005253 3300005295 Bacteria 4284
14 Ga0070658_10089837 3300005327 Bacteria 2530
15 Ga0070676_10067571 3300005328 Bacteria 2137
16 Ga0070670_100056132 3300005331 Bacteria 3380
17 Ga0070670_100074955 3300005331 Bacteria 2907
18 Ga0070670_100215259 3300005331 Unclassified 1671
19 Ga0070666_10054078 3300005335 Bacteria 2708
20 Ga0068868_100086108 3300005338 Bacteria 2526
21 Ga0070660_100105567 3300005339 Bacteria 2236
22 Ga0070689_100008594 3300005340 Bacteria 7199
23 Ga0070687_100026733 3300005343 Unclassified 2781
24 Ga0070661_100407533 3300005344 Bacteria 1076
25 Ga0070668_100012599 3300005347 Bacteria 6296
26 Ga0070668_100035152 3300005347 Unclassified 3820
27 Ga0070668_100143046 3300005347 Bacteria 1929
28 Ga0070668_100165289 3300005347 Unclassified 1798
29 Ga0070669_100005628 3300005353 Bacteria 9049
30 Ga0070669_100021292 3300005353 Bacteria 4635
31 Ga0070669_100045100 3300005353 Bacteria 3212
32 Ga0070675_100010607 3300005354 Bacteria 7205
33 Ga0070675_100027040 3300005354 Bacteria 4607
34 Ga0070675_100596333 3300005354 Unclassified 1002
35 Ga0070671_100043981 3300005355 Bacteria 3711
36 Ga0070671_100084638 3300005355 Bacteria 2652
37 Ga0070671_100113873 3300005355 Bacteria 2273
38 Ga0070671_100332210 3300005355 Bacteria 1296
39 Ga0070674_100013943 3300005356 Bacteria 4983
40 Ga0070674_100033264 3300005356 Bacteria 3430
41 Ga0070673_100027177 3300005364 Bacteria 4239
42 Ga0070673_100485359 3300005364 Unclassified 1116
43 Ga0070673_100586534 3300005364 Unclassified 1016
44 Ga0070688_100000677 3300005365 Bacteria 16994
45 Ga0070688_100048122 3300005365 Bacteria 2648
46 Ga0070688_100141930 3300005365 Unclassified 1633
47 Ga0070659_100006188 3300005366 Bacteria 8645
48 Ga0070659_100280603 3300005366 Bacteria 1386
49 Ga0070667_100041185 3300005367 Bacteria 3875
50 Ga0070667_100146862 3300005367 Bacteria 2069
51 Ga0070703_10029947 3300005406 Bacteria 1637
52 Ga0070709_10039493 3300005434 Unclassified 2896
53 Ga0070714_100148858 3300005435 Bacteria 2107
54 Ga0070714_100241147 3300005435 Unclassified 1668
55 Ga0070713_100033120 3300005436 Bacteria 4136
56 Ga0070713_100235032 3300005436 Unclassified 1667
57 Ga0070713_100280928 3300005436 Unclassified 1527
58 Ga0070710_10040823 3300005437 Bacteria 2558
59 Ga0070711_100045004 3300005439 Bacteria 2998
60 Ga0070711_100140728 3300005439 Bacteria 1809
61 Ga0070711_100359219 3300005439 Unclassified 1173
62 Ga0070705_100089603 3300005440 Bacteria 1913
63 Ga0070705_100145721 3300005440 Bacteria 1564
64 Ga0070700_100005176 3300005441 Bacteria 6894
65 Ga0070694_100019112 3300005444 Bacteria 4356
66 Ga0070708_100105473 3300005445 Bacteria 2586
67 Ga0070708_100155571 3300005445 Unclassified 2128
68 Ga0070708_100219987 3300005445 Unclassified 1781
69 Ga0070708_100287426 3300005445 Bacteria 1548
70 Ga0070708_100428842 3300005445 Unclassified 1247
71 Ga0070678_100031344 3300005456 Bacteria 3666
72 Ga0070678_100045877 3300005456 Bacteria 3129
73 Ga0070678_100098603 3300005456 Bacteria 2259
74 Ga0070662_100040352 3300005457 Bacteria 3323
75 Ga0070662_100084104 3300005457 Unclassified 2376
76 Ga0070662_100122582 3300005457 Unclassified 1994
77 Ga0068867_100117841 3300005459 Bacteria 2048
78 Ga0068867_100484705 3300005459 Bacteria 1060
79 Ga0070685_10029028 3300005466 Bacteria 3070
80 Ga0070706_100000511 3300005467 Bacteria 45508
81 Ga0070706_100032055 3300005467 Bacteria 4846
82 Ga0070706_100077332 3300005467 Bacteria 3080
83 Ga0070706_100125893 3300005467 Bacteria 2389
84 Ga0070706_100142277 3300005467 Bacteria 2239
85 Ga0070706_100229317 3300005467 Unclassified 1734
86 Ga0070706_100532847 3300005467 Bacteria 1092
87 Ga0070706_100854374 3300005467 Unclassified 841
88 Ga0070707_100005592 3300005468 Bacteria 11743
89 Ga0070707_100046805 3300005468 Bacteria 4140
90 Ga0070707_100054775 3300005468 Unclassified 3824
91 Ga0070707_100072235 3300005468 Bacteria 3325
92 Ga0070707_100084548 3300005468 Bacteria 3066
93 Ga0070707_100130085 3300005468 Bacteria 2448
94 Ga0070707_100344063 3300005468 Unclassified 1449
95 Ga0070707_100706593 3300005468 Unclassified 971
96 Ga0070698_100042716 3300005471 Bacteria 4651
97 Ga0070698_100056477 3300005471 Unclassified 3978
98 Ga0070699_100081805 3300005518 Unclassified 2815
99 Ga0070699_100255367 3300005518 Unclassified 1567
100 Ga0070679_100032712 3300005530 Bacteria 5147
101 Ga0070679_100328071 3300005530 Bacteria 1479
102 Ga0070684_100000617 3300005535 Bacteria 24524
103 Ga0070697_100019381 3300005536 Bacteria 5374
104 Ga0070697_100090108 3300005536 Bacteria 2534
105 Ga0070697_100098567 3300005536 Bacteria 2425
106 Ga0070697_100099461 3300005536 Bacteria 2414
107 Ga0070697_100126168 3300005536 Bacteria 2144
108 Ga0070697_100129126 3300005536 Bacteria 2119
109 Ga0070697_100137994 3300005536 Bacteria 2049
110 Ga0070697_100161896 3300005536 Bacteria 1891
111 Ga0070697_100177499 3300005536 Bacteria 1804
112 Ga0070697_100331967 3300005536 Bacteria 1311
113 Ga0070697_100338907 3300005536 Unclassified 1297
114 Ga0070697_100456564 3300005536 Bacteria 1113
115 Ga0070672_100027189 3300005543 Bacteria 4265
116 Ga0070686_100175966 3300005544 Bacteria 1517
117 Ga0070696_100524909 3300005546 Unclassified 945
118 Ga0070665_100027322 3300005548 Bacteria 5748
119 Ga0070665_100049626 3300005548 Bacteria 4210
120 Ga0070665_100170983 3300005548 Bacteria 2174
121 Ga0070704_100004856 3300005549 Bacteria 7793
122 Ga0070664_100026370 3300005564 Bacteria 4820
123 Ga0070664_100056526 3300005564 Bacteria 3334
124 Ga0068859_100004659 3300005617 Bacteria 13970
125 Ga0068864_100018369 3300005618 Bacteria 5842
126 Ga0068863_100014190 3300005841 Bacteria 7675
127 Ga0068858_100014340 3300005842 Bacteria 7473
128 Ga0068858_100415628 3300005842 Bacteria 1293
129 Ga0068858_100488998 3300005842 Unclassified 1188
130 Ga0068860_100007045 3300005843 Bacteria 11254
131 Ga0068860_100180390 3300005843 Unclassified 2041
132 Ga0081455_10001035 3300005937 Bacteria 35137
133 Ga0081455_10003632 3300005937 Bacteria 17675
134 Ga0081455_10054458 3300005937 Bacteria 3409
135 Ga0081455_10100046 3300005937 Bacteria 2330
136 Ga0081539_10000138 3300005985 Bacteria 170633
137 Ga0081539_10012160 3300005985 Bacteria 6679
138 Ga0081539_10022312 3300005985 Unclassified 4193
139 Ga0081539_10132329 3300005985 Unclassified 1223
140 Ga0070717_10020863 3300006028 Bacteria 5158
141 Ga0070717_10052827 3300006028 Unclassified 3349
142 Ga0070717_10143574 3300006028 Unclassified 2060
143 Ga0070715_10031694 3300006163 Bacteria 2147
144 Ga0070716_100494374 3300006173 Unclassified 901
145 Ga0070712_100234829 3300006175 Unclassified 1458
146 Ga0097621_100166167 3300006237 Bacteria 1900
147 Ga0068871_100775817 3300006358 Unclassified 882
148 Ga0075428_100241688 3300006844 Bacteria 1948
149 Ga0068865_100296871 3300006881 Unclassified 1292
150 Ga0097620_100004659 3300006931 Bacteria 13970
151 Ga0075435_100077528 3300007076 Bacteria 2725
152 Ga0111539_10149333 3300009094 Bacteria 2736
153 Ga0105245_10093107 3300009098 Bacteria 2776
154 Ga0105245_10704707 3300009098 Unclassified 1043
155 Ga0105247_10377363 3300009101 Unclassified 1004
156 Ga0114129_10080547 3300009147 Bacteria 4526
157 Ga0114129_10184707 3300009147 Bacteria 2835
158 Ga0105242_10021886 3300009176 Bacteria 5024
159 Ga0105242_10733511 3300009176 Bacteria 970
160 Ga0105237_10430961 3300009545 Unclassified 1324
161 Ga0105249_10001307 3300009553 Bacteria 21845
162 Ga0105249_10110988 3300009553 Bacteria 2592
163 Ga0099796_10089220 3300010159 Unclassified 1143
164 Ga0105239_10032756 3300010375 Bacteria 5711
165 Ga0105239_10175308 3300010375 Bacteria 2398
166 Ga0105239_10237360 3300010375 Bacteria 2046
167 Ga0105239_10721746 3300010375 Unclassified 1140
168 Ga0105246_10491182 3300011119 Bacteria 1041
169 Ga0157373_10286700 3300013100 Bacteria 1168
170 Ga0157371_10287048 3300013102 Unclassified 1189
171 Ga0157370_10360680 3300013104 Bacteria 1339
172 Ga0157369_10041020 3300013105 Bacteria 5052
173 Ga0157374_10013509 3300013296 Bacteria 7127
174 Ga0157374_10023511 3300013296 Bacteria 5513
175 Ga0157374_10030143 3300013296 Unclassified 4922
176 Ga0157374_10052181 3300013296 Bacteria 3807
177 Ga0157374_10133733 3300013296 Bacteria 2402
178 Ga0157374_10135640 3300013296 Bacteria 2386
179 Ga0157374_10141435 3300013296 Bacteria 2336
180 Ga0157374_10454689 3300013296 Unclassified 1282
181 Ga0157378_10175644 3300013297 Unclassified 2012
182 Ga0157378_10485292 3300013297 Bacteria 1232
183 Ga0157378_10494314 3300013297 Bacteria 1221
184 Ga0157378_10635696 3300013297 Bacteria 1081
185 Ga0157378_10651378 3300013297 Unclassified 1069
186 Ga0157378_10669658 3300013297 Unclassified 1055
187 Ga0163162_10052510 3300013306 Bacteria 4094
188 Ga0163162_10057948 3300013306 Bacteria 3901
189 Ga0163162_10058276 3300013306 Bacteria 3891
190 Ga0163162_10121032 3300013306 Bacteria 2722
191 Ga0163162_10134012 3300013306 Bacteria 2587
192 Ga0163162_10289591 3300013306 Bacteria 1770
193 Ga0163162_10321428 3300013306 Bacteria 1680
194 Ga0163162_10474688 3300013306 Unclassified 1382
195 Ga0157372_10224296 3300013307 Bacteria 2179
196 Ga0157372_10328588 3300013307 Unclassified 1780
197 Ga0157375_10010995 3300013308 Bacteria 7982
198 Ga0157375_10016933 3300013308 Bacteria 6568
199 Ga0157375_10056629 3300013308 Bacteria 3872
200 Ga0157375_10062359 3300013308 Bacteria 3704
201 Ga0157375_10124366 3300013308 Bacteria 2692
202 Ga0157375_10151946 3300013308 Bacteria 2451
203 Ga0157375_10168542 3300013308 Unclassified 2336
204 Ga0163163_10270370 3300014325 Bacteria 1751
205 Ga0157380_10464884 3300014326 Unclassified 1219
206 Ga0157379_10001137 3300014968 Bacteria 21783
207 Ga0157376_10033143 3300014969 Bacteria 4155
208 Ga0157376_10092614 3300014969 Bacteria 2621
209 Ga0207666_1014031 3300025271 Unclassified 1129
210 Ga0207697_10000493 3300025315 Bacteria 22216
211 Ga0207697_10006442 3300025315 Bacteria 5313
212 Ga0207697_10008354 3300025315 Bacteria 4534
213 Ga0207697_10027305 3300025315 Bacteria 2334
214 Ga0207697_10049065 3300025315 Unclassified 1742
215 Ga0207688_10039382 3300025901 Bacteria 2625
216 Ga0207680_10235028 3300025903 Unclassified 1261
217 Ga0207647_10006914 3300025904 Bacteria 8226
218 Ga0207699_10041127 3300025906 Bacteria 2667
219 Ga0207699_10063976 3300025906 Unclassified 2224
220 Ga0207645_10000927 3300025907 Bacteria 24317
221 Ga0207645_10034722 3300025907 Bacteria 3240
222 Ga0207645_10058741 3300025907 Bacteria 2456
223 Ga0207645_10243384 3300025907 Unclassified 1189
224 Ga0207684_10000186 3300025910 Bacteria 98342
225 Ga0207684_10006910 3300025910 Bacteria 10267
226 Ga0207684_10010154 3300025910 Bacteria 8290
227 Ga0207684_10027669 3300025910 Unclassified 4829
228 Ga0207684_10373501 3300025910 Unclassified 1227
229 Ga0207684_10626808 3300025910 Bacteria 917
230 Ga0207684_10720147 3300025910 Unclassified 847
231 Ga0207684_10720424 3300025910 Unclassified 847
232 Ga0207671_10239330 3300025914 Unclassified 1425
233 Ga0207693_10003482 3300025915 Bacteria 13432
234 Ga0207693_10077100 3300025915 Unclassified 2610
235 Ga0207693_10181599 3300025915 Unclassified 1656
236 Ga0207663_10081505 3300025916 Unclassified 2119
237 Ga0207662_10048003 3300025918 Unclassified 2529
238 Ga0207657_10091559 3300025919 Bacteria 2535
239 Ga0207657_10270225 3300025919 Unclassified 1351
240 Ga0207646_10005086 3300025922 Bacteria 13956
241 Ga0207646_10006749 3300025922 Bacteria 11816
242 Ga0207646_10049418 3300025922 Bacteria 3767
243 Ga0207646_10053015 3300025922 Bacteria 3629
244 Ga0207646_10086615 3300025922 Bacteria 2803
245 Ga0207646_10116865 3300025922 Bacteria 2395
246 Ga0207646_10175301 3300025922 Bacteria 1936
247 Ga0207646_10423795 3300025922 Unclassified 1201
248 Ga0207681_10044464 3300025923 Bacteria 2976
249 Ga0207681_10137493 3300025923 Unclassified 1815
250 Ga0207681_10298723 3300025923 Bacteria 1273
251 Ga0207681_10406076 3300025923 Unclassified 1101
252 Ga0207650_10056874 3300025925 Bacteria 2908
253 Ga0207650_10221118 3300025925 Unclassified 1524
254 Ga0207650_10238999 3300025925 Unclassified 1467
255 Ga0207659_10043209 3300025926 Bacteria 3164
256 Ga0207659_10094428 3300025926 Bacteria 2241
257 Ga0207659_10160163 3300025926 Bacteria 1766
258 Ga0207659_10360362 3300025926 Unclassified 1208
259 Ga0207659_10449009 3300025926 Unclassified 1086
260 Ga0207664_10311391 3300025929 Bacteria 1387
261 Ga0207644_10062062 3300025931 Bacteria 2709
262 Ga0207644_10464951 3300025931 Unclassified 1040
263 Ga0207690_10018668 3300025932 Bacteria 4255
264 Ga0207706_10106350 3300025933 Bacteria 2469
265 Ga0207706_10112837 3300025933 Unclassified 2391
266 Ga0207706_10144553 3300025933 Bacteria 2093
267 Ga0207706_10163843 3300025933 Bacteria 1954
268 Ga0207670_10013226 3300025936 Bacteria 4856
269 Ga0207670_10021451 3300025936 Bacteria 3986
270 Ga0207670_10254896 3300025936 Unclassified 1358
271 Ga0207670_10406292 3300025936 Bacteria 1090
272 Ga0207669_10007713 3300025937 Bacteria 5006
273 Ga0207704_10119816 3300025938 Unclassified 1798
274 Ga0207665_10485931 3300025939 Unclassified 952
275 Ga0207665_10556137 3300025939 Bacteria 892
276 Ga0207665_10579702 3300025939 Unclassified 874
277 Ga0207691_10000763 3300025940 Bacteria 31848
278 Ga0207691_10116161 3300025940 Bacteria 2375
279 Ga0207691_10233041 3300025940 Unclassified 1594
280 Ga0207691_10385505 3300025940 Unclassified 1196
281 Ga0207661_10017659 3300025944 Bacteria 5286
282 Ga0207651_10168372 3300025960 Bacteria 1725
283 Ga0207712_10012496 3300025961 Bacteria 5426
284 Ga0207668_10056140 3300025972 Bacteria 2741
285 Ga0207668_10123096 3300025972 Unclassified 1967
286 Ga0207668_10175803 3300025972 Unclassified 1684
287 Ga0207658_10186553 3300025986 Unclassified 1721
288 Ga0207658_10231616 3300025986 Unclassified 1560
289 Ga0207677_10108400 3300026023 Bacteria 2062
290 Ga0207677_10126018 3300026023 Unclassified 1935
291 Ga0207677_10336203 3300026023 Unclassified 1260
292 Ga0207677_10533513 3300026023 Unclassified 1020
293 Ga0207703_10008730 3300026035 Bacteria 8000
294 Ga0207678_10010502 3300026067 Bacteria 8134
295 Ga0207678_10691159 3300026067 Bacteria 897
296 Ga0207708_10068573 3300026075 Bacteria 2715
297 Ga0207641_10005722 3300026088 Bacteria 10560
298 Ga0207641_10262850 3300026088 Bacteria 1617
299 Ga0207648_10066271 3300026089 Bacteria 3149
300 Ga0207675_100259304 3300026118 Unclassified 1684
301 Ga0207683_10008684 3300026121 Bacteria 8687
302 Ga0207683_10023943 3300026121 Bacteria 5253
303 Ga0207683_10081817 3300026121 Bacteria 2867
304 Ga0207683_10104049 3300026121 Unclassified 2537
305 Ga0207683_10149503 3300026121 Unclassified 2107
306 Ga0207683_10214668 3300026121 Bacteria 1752
307 Ga0210002_1008173 3300027617 Unclassified 1592
308 Ga0209974_10015634 3300027876 Bacteria 2520
309 Ga0268266_10118593 3300028379 Bacteria 2352
310 Ga0268264_10050322 3300028381 Bacteria 3469
311 Ga0268264_10308382 3300028381 Bacteria 1492
312 Ga0307513_10024953 3300031456 Bacteria 6941
313 Ga0307408_100326853 3300031548 Bacteria 1294
314 Ga0373926_0159665 3300035083 Unclassified 860
315 Ga0373944_0045958 3300035089 Unclassified 1364
316 Ga0373943_0025215 3300035170 Bacteria 2779
317 Ga0373931_0062950 3300035691 Bacteria 2004
318 Ga0373927_0114749 3300035695 Bacteria 1756
319 Ga0373933_0157789 3300035724 Bacteria 1440
320 Ga0373947_0013773 3300035725 Bacteria 4636
321 Ga0373947_0057536 3300035725 Bacteria 2353
322 Ga0373947_0075148 3300035725 Unclassified 2080
323 Ga0373937_0145673 3300036401 Bacteria 2217
324 Ga0373925_0090525 3300037068 Bacteria 2339
325 Ga0395900_0004036 3300037418 Bacteria 15664
326 Ga0395900_0175043 3300037418 Unclassified 2183
327 Ga0395898_0040159 3300037466 Unclassified 4629
328 Ga0395901_0024456 3300038443 Bacteria 6200
329 Ga0466964_0122564 3300044706 Bacteria 1174
330 Ga0495592_0004114 3300046454 Bacteria 10585
331 Ga0495580_0138697 3300046472 Unclassified 1686
332 Ga0495662_0100536 3300046476 Bacteria 1415
333 Ga0495664_0028574 3300046477 Bacteria 3257
334 Ga0495608_0306972 3300046511 Bacteria 982
335 Ga0495628_0032786 3300046516 Bacteria 4190
336 Ga0495628_0155667 3300046516 Bacteria 1739
337 Ga0495630_0043307 3300046517 Bacteria 3362
338 Ga0495644_0110096 3300046523 Unclassified 1045
339 Ga0495652_0162362 3300046529 Bacteria 1733
340 Ga0495598_0039230 3300046537 Bacteria 1376
341 Ga0495598_0043003 3300046537 Unclassified 1329
342 Ga0495645_0008772 3300046543 Bacteria 7062
343 Ga0495645_0231728 3300046543 Bacteria 1237
344 Ga0495668_0285301 3300046616 Unclassified 905
345 Ga0495634_0057154 3300046642 Bacteria 2605
346 Ga0495599_0001668 3300046678 Bacteria 12814
347 Ga0495599_0160021 3300046678 Unclassified 1392
348 Ga0495623_0032811 3300046679 Bacteria 3335
349 Ga0495646_0022086 3300046680 Bacteria 4016
350 Ga0495669_0045729 3300046684 Unclassified 1952
351 Ga0495674_0111258 3300047319 Bacteria 2322
352 Ga0495680_0104954 3300047322 Bacteria 2102
353 Ga0495602_0038008 3300048088 Bacteria 4457
354 Ga0496100_0154963 3300048903 Unclassified 1638
355 Ga0496102_0013012 3300048905 Bacteria 7204
356 Ga0496104_0411778 3300048907 Bacteria 1264
357 Ga0496105_0456515 3300048908 Unclassified 1008
358 Ga0496108_0079182 3300048911 Bacteria 2782
359 Ga0496108_0104378 3300048911 Bacteria 2419
360 Ga0496108_0248322 3300048911 Bacteria 1548
361 Ga0496109_0127718 3300048912 Bacteria 2371
362 Ga0496109_0748161 3300048912 Bacteria 915
363 Ga0496110_0229813 3300048913 Unclassified 1687
364 Ga0496111_0131535 3300048914 Bacteria 1852
365 Ga0496112_0043402 3300048915 Unclassified 4402
366 Ga0496112_0466408 3300048915 Unclassified 1200
367 Ga0496113_0034627 3300048916 Bacteria 3686
368 nmdc:mga05p37_183156_c1 3300050507 Bacteria 2547
369 nmdc:mga05p37_703078_c1 3300050507 Bacteria 1122
370 nmdc:mga06r32_369303_c1 3300050510 Unclassified 1418
371 nmdc:mga0n895_210115_c1 3300050512 Unclassified 1976
372 nmdc:mga0rr50_446506_c1 3300050513 Unclassified 1096
373 nmdc:mga08x19_81254_c1 3300050514 Bacteria 2128
374 nmdc:mga0a205_619739_c1 3300050515 Unclassified 934
375 Ga0495601_0007981 3300053077 Bacteria 6233
376 Ga0495619_0296121 3300053085 Unclassified 1121
377 Ga0070708_100215477
378 JGI25406J46586_10000040
379 Ga0065703_1020555
380 Ga0065714_10146137
381 Ga0065704_10022310
382 Ga0065704_10109469
383 Ga0065712_10004068
384 Ga0065712_10098833
385 Ga0065712_10110388
386 Ga0065712_10198316
387 Ga0065715_10251938
388 Ga0065715_10300261
389 Ga0065707_10005253
390 Ga0070658_10089837
391 Ga0070676_10067571
392 Ga0070670_100056132
393 Ga0070670_100074955
394 Ga0070670_100215259
395 Ga0070666_10054078
396 Ga0068868_100086108
397 Ga0070660_100105567
398 Ga0070689_100008594
399 Ga0070687_100026733
400 Ga0070661_100407533
401 Ga0070668_100012599
402 Ga0070668_100035152
403 Ga0070668_100143046
404 Ga0070668_100165289
405 Ga0070669_100005628
406 Ga0070669_100021292
407 Ga0070669_100045100
408 Ga0070675_100010607
409 Ga0070675_100027040
410 Ga0070675_100596333
411 Ga0070671_100043981
412 Ga0070671_100084638
413 Ga0070671_100113873
414 Ga0070671_100332210
415 Ga0070674_100013943
416 Ga0070674_100033264
417 Ga0070673_100027177
418 Ga0070673_100485359
419 Ga0070673_100586534
420 Ga0070688_100000677
421 Ga0070688_100048122
422 Ga0070688_100141930
423 Ga0070659_100006188
424 Ga0070659_100280603
425 Ga0070667_100041185
426 Ga0070667_100146862
427 Ga0070703_10029947
428 Ga0070709_10039493
429 Ga0070714_100148858
430 Ga0070714_100241147
431 Ga0070713_100033120
432 Ga0070713_100235032
433 Ga0070713_100280928
434 Ga0070710_10040823
435 Ga0070711_100045004
436 Ga0070711_100140728
437 Ga0070711_100359219
438 Ga0070705_100089603
439 Ga0070705_100145721
440 Ga0070700_100005176
441 Ga0070694_100019112
442 Ga0070708_100105473
443 Ga0070708_100155571
444 Ga0070708_100219987
445 Ga0070708_100287426
446 Ga0070708_100428842
447 Ga0070678_100031344
448 Ga0070678_100045877
449 Ga0070678_100098603
450 Ga0070662_100040352
451 Ga0070662_100084104
452 Ga0070662_100122582
453 Ga0068867_100117841
454 Ga0068867_100484705
455 Ga0070685_10029028
456 Ga0070706_100000511
457 Ga0070706_100032055
458 Ga0070706_100077332
459 Ga0070706_100125893
460 Ga0070706_100142277
461 Ga0070706_100229317
462 Ga0070706_100532847
463 Ga0070706_100854374
464 Ga0070707_100005592
465 Ga0070707_100046805
466 Ga0070707_100054775
467 Ga0070707_100072235
468 Ga0070707_100084548
469 Ga0070707_100130085
470 Ga0070707_100344063
471 Ga0070707_100706593
472 Ga0070698_100042716
473 Ga0070698_100056477
474 Ga0070699_100081805
475 Ga0070699_100255367
476 Ga0070679_100032712
477 Ga0070679_100328071
478 Ga0070684_100000617
479 Ga0070697_100019381
480 Ga0070697_100090108
481 Ga0070697_100098567
482 Ga0070697_100099461
483 Ga0070697_100126168
484 Ga0070697_100129126
485 Ga0070697_100137994
486 Ga0070697_100161896
487 Ga0070697_100177499
488 Ga0070697_100331967
489 Ga0070697_100338907
490 Ga0070697_100456564
491 Ga0070672_100027189
492 Ga0070686_100175966
493 Ga0070696_100524909
494 Ga0070665_100027322
495 Ga0070665_100049626
496 Ga0070665_100170983
497 Ga0070704_100004856
498 Ga0070664_100026370
499 Ga0070664_100056526
500 Ga0068859_100004659
501 Ga0068864_100018369
502 Ga0068863_100014190
503 Ga0068858_100014340
504 Ga0068858_100415628
505 Ga0068858_100488998
506 Ga0068860_100007045
507 Ga0068860_100180390
508 Ga0081455_10001035
509 Ga0081455_10003632
510 Ga0081455_10054458
511 Ga0081455_10100046
512 Ga0081539_10000138
513 Ga0081539_10012160
514 Ga0081539_10022312
515 Ga0081539_10132329
516 Ga0070717_10020863
517 Ga0070717_10052827
518 Ga0070717_10143574
519 Ga0070715_10031694
520 Ga0070716_100494374
521 Ga0070712_100234829
522 Ga0097621_100166167
523 Ga0068871_100775817
524 Ga0075428_100241688
525 Ga0068865_100296871
526 Ga0097620_100004659
527 Ga0075435_100077528
528 Ga0111539_10149333
529 Ga0105245_10093107
530 Ga0105245_10704707
531 Ga0105247_10377363
532 Ga0114129_10080547
533 Ga0114129_10184707
534 Ga0105242_10021886
535 Ga0105242_10733511
536 Ga0105237_10430961
537 Ga0105249_10001307
538 Ga0105249_10110988
539 Ga0099796_10089220
540 Ga0105239_10032756
541 Ga0105239_10175308
542 Ga0105239_10237360
543 Ga0105239_10721746
544 Ga0105246_10491182
545 Ga0157373_10286700
546 Ga0157371_10287048
547 Ga0157370_10360680
548 Ga0157369_10041020
549 Ga0157374_10013509
550 Ga0157374_10023511
551 Ga0157374_10030143
552 Ga0157374_10052181
553 Ga0157374_10133733
554 Ga0157374_10135640
555 Ga0157374_10141435
556 Ga0157374_10454689
557 Ga0157378_10175644
558 Ga0157378_10485292
559 Ga0157378_10494314
560 Ga0157378_10635696
561 Ga0157378_10651378
562 Ga0157378_10669658
563 Ga0163162_10052510
564 Ga0163162_10057948
565 Ga0163162_10058276
566 Ga0163162_10121032
567 Ga0163162_10134012
568 Ga0163162_10289591
569 Ga0163162_10321428
570 Ga0163162_10474688
571 Ga0157372_10224296
572 Ga0157372_10328588
573 Ga0157375_10010995
574 Ga0157375_10016933
575 Ga0157375_10056629
576 Ga0157375_10062359
577 Ga0157375_10124366
578 Ga0157375_10151946
579 Ga0157375_10168542
580 Ga0163163_10270370
581 Ga0157380_10464884
582 Ga0157379_10001137
583 Ga0157376_10033143
584 Ga0157376_10092614
585 Ga0207666_1014031
586 Ga0207697_10000493
587 Ga0207697_10006442
588 Ga0207697_10008354
589 Ga0207697_10027305
590 Ga0207697_10049065
591 Ga0207688_10039382
592 Ga0207680_10235028
593 Ga0207647_10006914
594 Ga0207699_10041127
595 Ga0207699_10063976
596 Ga0207645_10000927
597 Ga0207645_10034722
598 Ga0207645_10058741
599 Ga0207645_10243384
600 Ga0207684_10000186
601 Ga0207684_10006910
602 Ga0207684_10010154
603 Ga0207684_10027669
604 Ga0207684_10373501
605 Ga0207684_10626808
606 Ga0207684_10720147
607 Ga0207684_10720424
608 Ga0207671_10239330
609 Ga0207693_10003482
610 Ga0207693_10077100
611 Ga0207693_10181599
612 Ga0207663_10081505
613 Ga0207662_10048003
614 Ga0207657_10091559
615 Ga0207657_10270225
616 Ga0207646_10005086
617 Ga0207646_10006749
618 Ga0207646_10049418
619 Ga0207646_10053015
620 Ga0207646_10086615
621 Ga0207646_10116865
622 Ga0207646_10175301
623 Ga0207646_10423795
624 Ga0207681_10044464
625 Ga0207681_10137493
626 Ga0207681_10298723
627 Ga0207681_10406076
628 Ga0207650_10056874
629 Ga0207650_10221118
630 Ga0207650_10238999
631 Ga0207659_10043209
632 Ga0207659_10094428
633 Ga0207659_10160163
634 Ga0207659_10360362
635 Ga0207659_10449009
636 Ga0207664_10311391
637 Ga0207644_10062062
638 Ga0207644_10464951
639 Ga0207690_10018668
640 Ga0207706_10106350
641 Ga0207706_10112837
642 Ga0207706_10144553
643 Ga0207706_10163843
644 Ga0207670_10013226
645 Ga0207670_10021451
646 Ga0207670_10254896
647 Ga0207670_10406292
648 Ga0207669_10007713
649 Ga0207704_10119816
650 Ga0207665_10485931
651 Ga0207665_10556137
652 Ga0207665_10579702
653 Ga0207691_10000763
654 Ga0207691_10116161
655 Ga0207691_10233041
656 Ga0207691_10385505
657 Ga0207661_10017659
658 Ga0207651_10168372
659 Ga0207712_10012496
660 Ga0207668_10056140
661 Ga0207668_10123096
662 Ga0207668_10175803
663 Ga0207658_10186553
664 Ga0207658_10231616
665 Ga0207677_10108400
666 Ga0207677_10126018
667 Ga0207677_10336203
668 Ga0207677_10533513
669 Ga0207703_10008730
670 Ga0207678_10010502
671 Ga0207678_10691159
672 Ga0207708_10068573
673 Ga0207641_10005722
674 Ga0207641_10262850
675 Ga0207648_10066271
676 Ga0207675_100259304
677 Ga0207683_10008684
678 Ga0207683_10023943
679 Ga0207683_10081817
680 Ga0207683_10104049
681 Ga0207683_10149503
682 Ga0207683_10214668
683 Ga0210002_1008173
684 Ga0209974_10015634
685 Ga0268266_10118593
686 Ga0268264_10050322
687 Ga0268264_10308382
688 Ga0307513_10024953
689 Ga0307408_100326853
690 Ga0373926_0159665
691 Ga0373944_0045958
692 Ga0373943_0025215
693 Ga0373931_0062950
694 Ga0373927_0114749
695 Ga0373933_0157789
696 Ga0373947_0013773
697 Ga0373947_0057536
698 Ga0373947_0075148
699 Ga0373937_0145673
700 Ga0373925_0090525
701 Ga0395900_0004036
702 Ga0395900_0175043
703 Ga0395898_0040159
704 Ga0395901_0024456
705 Ga0466964_0122564
706 Ga0495592_0004114
707 Ga0495580_0138697
708 Ga0495662_0100536
709 Ga0495664_0028574
710 Ga0495608_0306972
711 Ga0495628_0032786
712 Ga0495628_0155667
713 Ga0495630_0043307
714 Ga0495644_0110096
715 Ga0495652_0162362
716 Ga0495598_0039230
717 Ga0495598_0043003
718 Ga0495645_0008772
719 Ga0495645_0231728
720 Ga0495668_0285301
721 Ga0495634_0057154
722 Ga0495599_0001668
723 Ga0495599_0160021
724 Ga0495623_0032811
725 Ga0495646_0022086
726 Ga0495669_0045729
727 Ga0495674_0111258
728 Ga0495680_0104954
729 Ga0495602_0038008
730 Ga0496100_0154963
731 Ga0496102_0013012
732 Ga0496104_0411778
733 Ga0496105_0456515
734 Ga0496108_0079182
735 Ga0496108_0104378
736 Ga0496108_0248322
737 Ga0496109_0127718
738 Ga0496109_0748161
739 Ga0496110_0229813
740 Ga0496111_0131535
741 Ga0496112_0043402
742 Ga0496112_0466408
743 Ga0496113_0034627
744 nmdc:mga05p37_183156_c1
745 nmdc:mga05p37_703078_c1
746 nmdc:mga06r32_369303_c1
747 nmdc:mga0n895_210115_c1
748 nmdc:mga0rr50_446506_c1
749 nmdc:mga08x19_81254_c1
750 nmdc:mga0a205_619739_c1
751 Ga0495601_0007981
752 Ga0495619_0296121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

180

303

0.9

PF03476

MOSC_N

MOSC N-terminal beta barrel domain

49

158

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.8053 146 263
4ima-assembly1.cif.gz_C the structure of c436m-hlpyk in complex with citrate/mn/atp/fru-1,6-bp 0.7823 192 261
4hyv-assembly1.cif.gz_A pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium, pep and f26bp 0.7625 176 261
3hqp-assembly15.cif.gz_O crystal structure of leishmania mexicana pyruvate kinase (lmpyk) in complex with atp, oxalate and fructose 2,6 bisphosphate 0.7562 176 261
3hqo-assembly1.cif.gz_K crystal structures of leishmania mexicana pyruvate kinase (lmpyk) in complex with atp and oxalate 0.7506 176 261
ID Description Score Start End Superfamily
af_A1Z803_208_336_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8876 142 260 2.40.33.20
af_Q21657_579_705_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8448 138 260 2.40.33.20
af_U4PC34_202_334_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.844 138 260 2.40.33.20
af_P75863_136_262_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8314 138 260 2.40.33.20
af_Q58EJ9_194_321_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.819 138 260 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A2V6F917-F1-model_v4 MOSC domain-containing protein 0.9815 1 262 GO:0003824
GO:0030151
GO:0030170
AF-A0A2V6F917-F1-model_v4 MOSC domain-containing protein 0.9778 1 262 GO:0003824
GO:0030151
GO:0030170
AF-A0A1E2RX79-F1-model_v4 MOSC domain protein 0.9763 154 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A2V6DIS9-F1-model_v4 MOSC domain-containing protein 0.9722 1 262 GO:0003824
GO:0030151
GO:0030170
AF-A0A2V6M197-F1-model_v4 MOSC domain-containing protein 0.9695 134 263 GO:0003824
GO:0030151
GO:0030170

Map