F427179

General Info

Members Datasets Scaffolds Average Seq Length
375 222 750 243

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0024306|Ga0501031_0024306_424_1206
Length 260
Sequence MTAPPHALAPAHLTTAAEAGPGGVFLWVILPYLSLAFFVLGHVWRYRYDKFGWTTRSSQLYESRLLRIGSPLFHFGILVVLLGHIGGLLIPESWTDAAGISEHTYHVAAVVLGTIAGVCTLGGLALLLYRRRTVGPVFSATTRNDKAMYVSLTLTIALGLSATVVANIVGSGYNYRNTISPWFRALSYGEPDPDLMTGVPLLFQLHALSALFLFAFWPFTRLVHMLTAPLGYLTRPYIVYRSRDDRLGNRPPRRGWERVG

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
127 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
131 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
132 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
197 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 2643221561 Nocardioides sp. Root151 Isolate Unclassified
201 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
202 2643221576 Nocardioides sp. Root614 Isolate Unclassified
203 2643221590 Nocardioides sp. Root682 Isolate Unclassified
204 2643221604 Nocardioides sp. Root190 Isolate Unclassified
205 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
206 2643221641 Nocardioides sp. Root122 Isolate Unclassified
207 2643221696 Nocardioides sp. Root140 Isolate Unclassified
208 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
209 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
210 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
211 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
212 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
213 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
214 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
215 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
216 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
217 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
218 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
219 2867428634 Streptomyces sp. RP5T Isolate Unclassified
220 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
221 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
222 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.07
Metatranscriptomes 0.8
Isolates 6.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.47
Nodule 0.27
Rhizoplane 12.8
Rhizosphere 64.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0024306 3300049568 Bacteria 3949
2 JGI24739J22299_10050128 3300001989 Bacteria 1351
3 JGI24737J22298_10005848 3300001990 Bacteria 4235
4 JGI24737J22298_10055367 3300001990 Bacteria 1199
5 JGI24743J22301_10000461 3300001991 Bacteria 4670
6 JGI24735J21928_10090445 3300002067 Bacteria 877
7 JGI24738J21930_10002079 3300002075 Bacteria 5360
8 JGI24744J21845_10001889 3300002077 Bacteria 4216
9 JGI24033J26618_1023426 3300002155 Bacteria 803
10 Ga0006562J51391_1040915 3300003578 Bacteria 966
11 Ga0070658_10325008 3300005327 Bacteria 1314
12 Ga0070683_100075209 3300005329 Bacteria 3155
13 Ga0070683_100531929 3300005329 Bacteria 1123
14 Ga0070670_100385084 3300005331 Bacteria 1236
15 Ga0068869_100229060 3300005334 Bacteria 1476
16 Ga0070682_100010573 3300005337 Bacteria 5239
17 Ga0070682_100046094 3300005337 Bacteria 2704
18 Ga0070682_100080918 3300005337 Bacteria 2102
19 Ga0068868_100007754 3300005338 Bacteria 7659
20 Ga0070691_10152797 3300005341 Bacteria 1185
21 Ga0070687_100039045 3300005343 Bacteria 2383
22 Ga0070692_10009582 3300005345 Bacteria 4371
23 Ga0070668_100396880 3300005347 Bacteria 1177
24 Ga0070668_100562029 3300005347 Bacteria 994
25 Ga0070669_100070712 3300005353 Bacteria 2580
26 Ga0070674_100004097 3300005356 Bacteria 8282
27 Ga0070688_100175339 3300005365 Bacteria 1483
28 Ga0070659_100029684 3300005366 Bacteria 4227
29 Ga0070659_100121249 3300005366 Bacteria 2118
30 Ga0070701_10007841 3300005438 Bacteria 4588
31 Ga0070700_100003584 3300005441 Bacteria 8021
32 Ga0070663_100331297 3300005455 Bacteria 1227
33 Ga0068867_100007401 3300005459 Bacteria 7765
34 Ga0070685_10098344 3300005466 Bacteria 1783
35 Ga0070684_100018438 3300005535 Bacteria 5749
36 Ga0070684_100058256 3300005535 Bacteria 3375
37 Ga0070684_100390803 3300005535 Bacteria 1282
38 Ga0070672_100119232 3300005543 Bacteria 2158
39 Ga0070672_100338919 3300005543 Bacteria 1280
40 Ga0070686_100069024 3300005544 Bacteria 2307
41 Ga0070665_100000151 3300005548 Bacteria 127579
42 Ga0070704_100301990 3300005549 Bacteria 1334
43 Ga0070664_100128694 3300005564 Bacteria 2223
44 Ga0068857_100017446 3300005577 Bacteria 6292
45 Ga0068857_100224383 3300005577 Bacteria 1717
46 Ga0068857_100858136 3300005577 Bacteria 869
47 Ga0068854_100033034 3300005578 Bacteria 3605
48 Ga0070702_100025479 3300005615 Bacteria 3170
49 Ga0070702_100378181 3300005615 Bacteria 1006
50 Ga0070702_100482934 3300005615 Bacteria 906
51 Ga0068852_100007446 3300005616 Bacteria 7989
52 Ga0068852_100449712 3300005616 Bacteria 1275
53 Ga0068859_100559296 3300005617 Bacteria 1238
54 Ga0068864_100058082 3300005618 Bacteria 3343
55 Ga0068866_10048219 3300005718 Bacteria 2153
56 Ga0068861_100007082 3300005719 Bacteria 7673
57 Ga0068861_100434047 3300005719 Bacteria 1173
58 Ga0068851_10111986 3300005834 Bacteria 1458
59 Ga0068870_10005808 3300005840 Bacteria 5412
60 Ga0068860_100000631 3300005843 Bacteria 41527
61 Ga0068862_100238966 3300005844 Bacteria 1651
62 Ga0068862_100634355 3300005844 Bacteria 1029
63 Ga0081455_10200726 3300005937 Bacteria 1493
64 Ga0075365_10011408 3300006038 Bacteria 5224
65 Ga0075365_10024671 3300006038 Bacteria 3798
66 Ga0075365_10032958 3300006038 Bacteria 3334
67 Ga0075365_10044649 3300006038 Bacteria 2905
68 Ga0075365_10052143 3300006038 Bacteria 2704
69 Ga0075365_10099526 3300006038 Bacteria 1990
70 Ga0075365_10548140 3300006038 Bacteria 818
71 Ga0075368_10000815 3300006042 Bacteria 9597
72 Ga0075368_10085880 3300006042 Bacteria 1283
73 Ga0075368_10108270 3300006042 Bacteria 1144
74 Ga0075363_100000658 3300006048 Bacteria 11502
75 Ga0075363_100104481 3300006048 Bacteria 1570
76 Ga0075363_100105314 3300006048 Bacteria 1564
77 Ga0075363_100142418 3300006048 Bacteria 1351
78 Ga0075364_10015943 3300006051 Bacteria 4666
79 Ga0075364_10069327 3300006051 Bacteria 2320
80 Ga0075364_10174364 3300006051 Bacteria 1454
81 Ga0075364_10293543 3300006051 Bacteria 1106
82 Ga0075367_10001964 3300006178 Bacteria 9149
83 Ga0075367_10053933 3300006178 Bacteria 2383
84 Ga0075367_10140664 3300006178 Bacteria 1495
85 Ga0075367_10151817 3300006178 Bacteria 1438
86 Ga0075370_10005529 3300006353 Bacteria 6294
87 Ga0075370_10013898 3300006353 Bacteria 4285
88 Ga0075370_10037242 3300006353 Bacteria 2734
89 Ga0068871_100495989 3300006358 Bacteria 1100
90 Ga0068865_100013598 3300006881 Bacteria 5149
91 Ga0097620_100559282 3300006931 Bacteria 1238
92 Ga0111539_10114837 3300009094 Bacteria 3158
93 Ga0111539_10782398 3300009094 Bacteria 1110
94 Ga0105245_10027428 3300009098 Bacteria 5017
95 Ga0105243_10001281 3300009148 Bacteria 22570
96 Ga0105243_10089940 3300009148 Bacteria 2526
97 Ga0105243_10154156 3300009148 Bacteria 1974
98 Ga0105243_10747113 3300009148 Bacteria 959
99 Ga0105242_10356090 3300009176 Bacteria 1353
100 Ga0105242_10428290 3300009176 Bacteria 1242
101 Ga0105242_10519043 3300009176 Bacteria 1136
102 Ga0105248_10022228 3300009177 Bacteria 7033
103 Ga0105248_10052615 3300009177 Bacteria 4569
104 Ga0105238_10896699 3300009551 Bacteria 905
105 Ga0105249_10101535 3300009553 Bacteria 2705
106 Ga0105239_10465919 3300010375 Bacteria 1434
107 Ga0105239_10684723 3300010375 Bacteria 1172
108 Ga0105239_10841182 3300010375 Bacteria 1052
109 Ga0105246_10214723 3300011119 Bacteria 1504
110 Ga0105246_10467757 3300011119 Bacteria 1064
111 Ga0157370_10057668 3300013104 Bacteria 3691
112 Ga0157369_10271983 3300013105 Bacteria 1765
113 Ga0163162_10206006 3300013306 Bacteria 2096
114 Ga0157372_10024021 3300013307 Bacteria 6614
115 Ga0157372_10087813 3300013307 Bacteria 3529
116 Ga0157372_10162781 3300013307 Bacteria 2579
117 Ga0157372_10289375 3300013307 Bacteria 1905
118 Ga0157375_10055950 3300013308 Bacteria 3892
119 Ga0157375_10713010 3300013308 Bacteria 1156
120 Ga0157375_10967809 3300013308 Bacteria 992
121 Ga0157375_11077284 3300013308 Bacteria 940
122 Ga0163163_10110709 3300014325 Bacteria 2775
123 Ga0163163_10564098 3300014325 Bacteria 1201
124 Ga0157380_10096477 3300014326 Bacteria 2451
125 Ga0157380_10258886 3300014326 Bacteria 1579
126 Ga0182008_10078484 3300014497 Bacteria 1624
127 Ga0157377_10001248 3300014745 Bacteria 10873
128 Ga0157376_10243784 3300014969 Bacteria 1675
129 Ga0157376_10603420 3300014969 Bacteria 1093
130 Ga0163161_10081357 3300017792 Bacteria 2385
131 Ga0163161_10116485 3300017792 Bacteria 2003
132 Ga0206353_11101154 3300020082 Bacteria 1400
133 Ga0207656_10096091 3300025321 Bacteria 1352
134 Ga0207642_10107223 3300025899 Bacteria 1415
135 Ga0207688_10017285 3300025901 Bacteria 3919
136 Ga0207647_10006214 3300025904 Bacteria 8706
137 Ga0207647_10032550 3300025904 Bacteria 3347
138 Ga0207643_10006969 3300025908 Bacteria 6063
139 Ga0207662_10032854 3300025918 Bacteria 3021
140 Ga0207652_10264499 3300025921 Bacteria 1551
141 Ga0207681_10078043 3300025923 Bacteria 2330
142 Ga0207650_10165506 3300025925 Bacteria 1755
143 Ga0207659_10090935 3300025926 Bacteria 2279
144 Ga0207687_10179593 3300025927 Bacteria 1639
145 Ga0207687_10495984 3300025927 Bacteria 1019
146 Ga0207686_10295694 3300025934 Bacteria 1201
147 Ga0207709_10021835 3300025935 Bacteria 3626
148 Ga0207709_10481411 3300025935 Bacteria 965
149 Ga0207669_10013837 3300025937 Bacteria 4025
150 Ga0207704_10206106 3300025938 Bacteria 1443
151 Ga0207691_10029718 3300025940 Bacteria 5111
152 Ga0207711_10064504 3300025941 Bacteria 3164
153 Ga0207711_10109420 3300025941 Bacteria 2456
154 Ga0207661_10112663 3300025944 Bacteria 2303
155 Ga0207679_10225908 3300025945 Bacteria 1578
156 Ga0207712_10063661 3300025961 Bacteria 2626
157 Ga0207712_10098653 3300025961 Bacteria 2167
158 Ga0207640_10100652 3300025981 Bacteria 2025
159 Ga0207677_10037116 3300026023 Bacteria 3182
160 Ga0207639_10054963 3300026041 Bacteria 3045
161 Ga0207639_10083215 3300026041 Bacteria 2539
162 Ga0207639_10087797 3300026041 Bacteria 2480
163 Ga0207678_10474123 3300026067 Bacteria 1089
164 Ga0207708_10000445 3300026075 Bacteria 32158
165 Ga0207708_10309597 3300026075 Bacteria 1286
166 Ga0207648_10007814 3300026089 Bacteria 10445
167 Ga0207676_10043693 3300026095 Bacteria 3452
168 Ga0207674_10238161 3300026116 Bacteria 1767
169 Ga0207675_100009111 3300026118 Bacteria 9314
170 Ga0207683_10150046 3300026121 Bacteria 2104
171 Ga0207698_10084161 3300026142 Bacteria 2577
172 Ga0207698_10317364 3300026142 Bacteria 1458
173 Ga0209813_10002429 3300027866 Bacteria 4264
174 Ga0209813_10029376 3300027866 Bacteria 1609
175 Ga0209813_10037111 3300027866 Bacteria 1467
176 Ga0268266_10003412 3300028379 Bacteria 15900
177 Ga0268265_10195541 3300028380 Bacteria 1750
178 Ga0268264_10000269 3300028381 Bacteria 91321
179 Ga0307509_10327013 3300031507 Bacteria 1267
180 Ga0307408_100571035 3300031548 Bacteria 1001
181 Ga0307405_10256493 3300031731 Bacteria 1304
182 Ga0307518_10021152 3300031838 Bacteria 4677
183 Ga0307410_10007301 3300031852 Bacteria 6038
184 Ga0307410_10386772 3300031852 Bacteria 1127
185 Ga0307406_10020504 3300031901 Bacteria 3894
186 Ga0307406_10210806 3300031901 Bacteria 1437
187 Ga0307407_10039250 3300031903 Bacteria 2631
188 Ga0307407_10147872 3300031903 Bacteria 1523
189 Ga0307412_10165624 3300031911 Bacteria 1648
190 Ga0307409_100007230 3300031995 Bacteria 6621
191 Ga0307409_100245225 3300031995 Bacteria 1634
192 Ga0307416_100123856 3300032002 Bacteria 2311
193 Ga0307416_100208258 3300032002 Bacteria 1863
194 Ga0307416_100318182 3300032002 Bacteria 1557
195 Ga0307416_100345340 3300032002 Bacteria 1503
196 Ga0307416_100623441 3300032002 Bacteria 1161
197 Ga0307414_10012215 3300032004 Bacteria 5068
198 Ga0307411_10115426 3300032005 Bacteria 1931
199 Ga0307411_10379979 3300032005 Bacteria 1161
200 Ga0395901_0092235 3300038443 Bacteria 3171
201 Ga0451791_0651712 3300041451 Bacteria 3300
202 Ga0451791_1728168 3300041451 Bacteria 1970
203 Ga0451797_0323081 3300041453 Bacteria 2486
204 Ga0451837_1323451 3300041494 Bacteria 3951
205 Ga0451853_0979217 3300041512 Bacteria 2732
206 Ga0451853_3441559 3300041512 Bacteria 7559
207 Ga0450894_000323 3300042131 Bacteria 8519
208 Ga0450898_000700 3300042134 Bacteria 4054
209 Ga0450906_004043 3300042145 Bacteria 3102
210 Ga0466967_0739837 3300045976 Bacteria 975
211 Ga0495629_0020962 3300046459 Bacteria 4665
212 Ga0495639_0278721 3300046475 Bacteria 831
213 Ga0495662_0010513 3300046476 Bacteria 4528
214 Ga0495665_0271468 3300046531 Bacteria 871
215 Ga0495587_0003859 3300046536 Bacteria 9946
216 Ga0495625_0026596 3300046660 Bacteria 4370
217 Ga0495657_0089339 3300046675 Bacteria 1980
218 Ga0495658_0139583 3300046683 Bacteria 1481
219 Ga0495613_0063532 3300046689 Bacteria 2701
220 Ga0495581_0104040 3300047315 Bacteria 1650
221 Ga0495593_0060128 3300047673 Bacteria 1990
222 Ga0496100_0066135 3300048903 Bacteria 2397
223 Ga0496101_0037983 3300048904 Bacteria 3418
224 Ga0496101_0253325 3300048904 Bacteria 1372
225 Ga0496102_0043007 3300048905 Bacteria 4095
226 Ga0496102_0250691 3300048905 Bacteria 1669
227 Ga0496102_0444761 3300048905 Bacteria 1216
228 Ga0496104_0003571 3300048907 Bacteria 13423
229 Ga0496105_0004250 3300048908 Bacteria 10771
230 Ga0496105_0216830 3300048908 Bacteria 1559
231 Ga0496105_0541783 3300048908 Bacteria 909
232 Ga0496105_0597429 3300048908 Bacteria 857
233 Ga0496106_0029605 3300048909 Bacteria 4082
234 Ga0496106_0597602 3300048909 Bacteria 884
235 Ga0496106_0609380 3300048909 Bacteria 874
236 Ga0496107_0003988 3300048910 Bacteria 9941
237 Ga0496107_0013069 3300048910 Bacteria 5800
238 Ga0496108_0021326 3300048911 Bacteria 5325
239 Ga0496108_0108712 3300048911 Bacteria 2369
240 Ga0496108_0327067 3300048911 Bacteria 1337
241 Ga0496109_0042660 3300048912 Bacteria 4110
242 Ga0496109_0045429 3300048912 Bacteria 3986
243 Ga0496109_0048127 3300048912 Bacteria 3879
244 Ga0496109_0417995 3300048912 Bacteria 1267
245 Ga0496109_0467494 3300048912 Bacteria 1191
246 Ga0496109_0831892 3300048912 Bacteria 861
247 Ga0496110_0145417 3300048913 Bacteria 2144
248 Ga0496110_0294899 3300048913 Bacteria 1477
249 Ga0496110_0674179 3300048913 Bacteria 934
250 Ga0496111_0037936 3300048914 Bacteria 3450
251 Ga0496113_0130614 3300048916 Bacteria 1971
252 Ga0496114_0031148 3300048917 Bacteria 4387
253 Ga0496114_0033139 3300048917 Bacteria 4255
254 Ga0496114_0074878 3300048917 Bacteria 2850
255 Ga0496114_0079431 3300048917 Bacteria 2769
256 Ga0496114_0082287 3300048917 Bacteria 2721
257 Ga0496114_0111349 3300048917 Bacteria 2346
258 Ga0496114_0113678 3300048917 Bacteria 2321
259 Ga0496114_0159158 3300048917 Bacteria 1962
260 Ga0496114_0182065 3300048917 Bacteria 1835
261 Ga0496114_0244828 3300048917 Bacteria 1577
262 Ga0496114_0277932 3300048917 Bacteria 1476
263 Ga0496114_0322366 3300048917 Bacteria 1365
264 Ga0496114_0418682 3300048917 Bacteria 1186
265 Ga0496115_0005267 3300048918 Bacteria 9401
266 Ga0496115_0225963 3300048918 Bacteria 1544
267 Ga0496119_0000715 3300048922 Bacteria 44620
268 Ga0496125_0151359 3300048928 Bacteria 1593
269 Ga0501325_010573 3300049541 Bacteria 839
270 Ga0501031_0003388 3300049568 Bacteria 10230
271 Ga0501031_0055830 3300049568 Bacteria 2573
272 Ga0501031_0248919 3300049568 Bacteria 1155
273 Ga0501031_0313298 3300049568 Bacteria 1017
274 Ga0501032_0058243 3300049569 Bacteria 2594
275 Ga0501034_0019357 3300049571 Bacteria 6963
276 Ga0501036_0027876 3300049572 Bacteria 4775
277 Ga0501036_0043200 3300049572 Bacteria 3816
278 Ga0501038_0012405 3300049574 Bacteria 7788
279 Ga0501038_0176165 3300049574 Bacteria 1728
280 Ga0501039_0045891 3300049575 Bacteria 3376
281 Ga0501039_0109589 3300049575 Bacteria 2158
282 Ga0501040_0095116 3300049576 Bacteria 2073
283 Ga0501040_0112711 3300049576 Bacteria 1903
284 Ga0501040_0492448 3300049576 Bacteria 884
285 Ga0501041_0018436 3300049577 Bacteria 4158
286 Ga0501042_0019965 3300049578 Bacteria 4660
287 Ga0501043_0111634 3300049579 Bacteria 2146
288 Ga0501043_0251064 3300049579 Bacteria 1362
289 Ga0501046_0087573 3300049580 Bacteria 2399
290 Ga0501047_0002087 3300049581 Bacteria 19137
291 Ga0501048_0033874 3300049582 Bacteria 3688
292 Ga0501048_0197827 3300049582 Bacteria 1424
293 Ga0501069_0123189 3300049585 Bacteria 1481
294 Ga0501069_0189237 3300049585 Bacteria 1191
295 Ga0501070_0059773 3300049586 Bacteria 3159
296 Ga0501070_0286536 3300049586 Bacteria 1343
297 Ga0501071_0017089 3300049587 Bacteria 4998
298 Ga0501071_0074125 3300049587 Bacteria 2484
299 Ga0501072_0053046 3300049588 Bacteria 3193
300 Ga0501072_0053582 3300049588 Bacteria 3177
301 Ga0501073_0034163 3300049589 Bacteria 3620
302 Ga0501074_0010913 3300049590 Bacteria 6594
303 Ga0501076_0013168 3300049592 Bacteria 6195
304 Ga0501076_0467517 3300049592 Bacteria 1039
305 Ga0501077_0082274 3300049593 Bacteria 2040
306 Ga0501079_0135692 3300049741 Bacteria 1916
307 Ga0501080_0070636 3300049742 Bacteria 3248
308 Ga0501081_0147385 3300049743 Bacteria 1689
309 Ga0501081_0403104 3300049743 Bacteria 1013
310 Ga0501035_0022904 3300049822 Bacteria 5735
311 Ga0501035_0360054 3300049822 Bacteria 1216
312 Ga0501044_0009074 3300049823 Bacteria 10870
313 Ga0501044_0180005 3300049823 Bacteria 2081
314 Ga0501045_0178855 3300049824 Bacteria 1580
315 Ga0501045_0414572 3300049824 Bacteria 1002
316 nmdc:mga03n38_106129_c1 3300050490 Bacteria 1361
317 nmdc:mga03n38_5052_c1 3300050490 Bacteria 4450
318 nmdc:mga00v17_20097_c1 3300050491 Bacteria 3822
319 nmdc:mga00v17_222112_c1 3300050491 Bacteria 1223
320 nmdc:mga00v17_27321_c1 3300050491 Bacteria 3331
321 nmdc:mga00v17_5249_c1 3300050491 Bacteria 6822
322 nmdc:mga0yw44_108711_c1 3300050492 Bacteria 1775
323 nmdc:mga0yw44_112419_c1 3300050492 Bacteria 1747
324 nmdc:mga0yw44_143851_c1 3300050492 Bacteria 1551
325 nmdc:mga0yw44_28633_c1 3300050492 Bacteria 3207
326 nmdc:mga0yw44_329163_c1 3300050492 Bacteria 1027
327 nmdc:mga0yw44_3513_c1 3300050492 Bacteria 6978
328 nmdc:mga0yw44_357897_c1 3300050492 Bacteria 983
329 nmdc:mga0yw44_45830_c2 3300050492 Bacteria 1846
330 nmdc:mga0yw44_49570_c1 3300050492 Bacteria 2535
331 nmdc:mga0yw44_81826_c1 3300050492 Bacteria 2025
332 nmdc:mga0yw44_86071_c1 3300050492 Bacteria 1979
333 nmdc:mga0yw44_87535_c2 3300050492 Bacteria 1635
334 nmdc:mga06z11_114207_c1 3300050494 Bacteria 1499
335 nmdc:mga06z11_117035_c1 3300050494 Bacteria 1483
336 nmdc:mga06z11_701_c1 3300050494 Bacteria 12171
337 nmdc:mga06z11_92589_c1 3300050494 Bacteria 1644
338 nmdc:mga04h51_129771_c1 3300050495 Bacteria 947
339 nmdc:mga04h51_158431_c1 3300050495 Bacteria 870
340 nmdc:mga04h51_2647_c1 3300050495 Bacteria 4264
341 nmdc:mga04h51_44237_c1 3300050495 Bacteria 1467
342 nmdc:mga07m45_3517_c1 3300050496 Bacteria 7560
343 nmdc:mga07m45_63081_c1 3300050496 Bacteria 2101
344 nmdc:mga08y16_22454_c1 3300050511 Bacteria 6660
345 nmdc:mga08y16_258330_c1 3300050511 Bacteria 1799
346 Ga0495619_0077808 3300053085 Bacteria 2229
347 Ga0495619_0196827 3300053085 Bacteria 1395
348 Ga0500553_009540 3300053101 Bacteria 4854
349 Ga0500573_0019056 3300053140 Bacteria 3924
350 Ga0501084_0043685 3300054114 Bacteria 3749
351 Ga0501084_0559168 3300054114 Bacteria 967
352 Ga0501082_0214504 3300060353 Bacteria 1674
353 2643826143 2643221561 Bacteria 4984412
354 2643850174 2643221567 Bacteria 4163945
355 2643889375 2643221576 Bacteria 5214352
356 2643958430 2643221590 Bacteria 5214697
357 2644036074 2643221604 Bacteria 5014917
358 2644136193 2643221624 Bacteria 4384879
359 2644229420 2643221641 Bacteria 4490190
360 2644532120 2643221696 Bacteria 5431823
361 2738892249 2738541308 Bacteria 7020677
362 2744956112 2744054611 Bacteria 5611514
363 2785340230 2784746763 Bacteria 9783172
364 2786675555 2786546132 Bacteria 10419719
365 2808914491 2808606375 Bacteria 9466072
366 2811842370 2808606982 Bacteria 7791042
367 2812333054 2811994874 Bacteria 5367947
368 2812477249 2811994917 Bacteria 7761064
369 2816424945 2816332119 Bacteria 8120218
370 2855390878 2855386786 Bacteria 4752232
371 2862287612 2862281513 Bacteria 9621493
372 2867433493 2867428634 Bacteria 9590268
373 2891399269 2891395885 Bacteria 9251614
374 3001891909 3001889506 Bacteria 2975194
375 8054613676 8054609563 Bacteria 5170090
376 Ga0501031_0024306
377 JGI24739J22299_10050128
378 JGI24737J22298_10005848
379 JGI24737J22298_10055367
380 JGI24743J22301_10000461
381 JGI24735J21928_10090445
382 JGI24738J21930_10002079
383 JGI24744J21845_10001889
384 JGI24033J26618_1023426
385 Ga0006562J51391_1040915
386 Ga0070658_10325008
387 Ga0070683_100075209
388 Ga0070683_100531929
389 Ga0070670_100385084
390 Ga0068869_100229060
391 Ga0070682_100010573
392 Ga0070682_100046094
393 Ga0070682_100080918
394 Ga0068868_100007754
395 Ga0070691_10152797
396 Ga0070687_100039045
397 Ga0070692_10009582
398 Ga0070668_100396880
399 Ga0070668_100562029
400 Ga0070669_100070712
401 Ga0070674_100004097
402 Ga0070688_100175339
403 Ga0070659_100029684
404 Ga0070659_100121249
405 Ga0070701_10007841
406 Ga0070700_100003584
407 Ga0070663_100331297
408 Ga0068867_100007401
409 Ga0070685_10098344
410 Ga0070684_100018438
411 Ga0070684_100058256
412 Ga0070684_100390803
413 Ga0070672_100119232
414 Ga0070672_100338919
415 Ga0070686_100069024
416 Ga0070665_100000151
417 Ga0070704_100301990
418 Ga0070664_100128694
419 Ga0068857_100017446
420 Ga0068857_100224383
421 Ga0068857_100858136
422 Ga0068854_100033034
423 Ga0070702_100025479
424 Ga0070702_100378181
425 Ga0070702_100482934
426 Ga0068852_100007446
427 Ga0068852_100449712
428 Ga0068859_100559296
429 Ga0068864_100058082
430 Ga0068866_10048219
431 Ga0068861_100007082
432 Ga0068861_100434047
433 Ga0068851_10111986
434 Ga0068870_10005808
435 Ga0068860_100000631
436 Ga0068862_100238966
437 Ga0068862_100634355
438 Ga0081455_10200726
439 Ga0075365_10011408
440 Ga0075365_10024671
441 Ga0075365_10032958
442 Ga0075365_10044649
443 Ga0075365_10052143
444 Ga0075365_10099526
445 Ga0075365_10548140
446 Ga0075368_10000815
447 Ga0075368_10085880
448 Ga0075368_10108270
449 Ga0075363_100000658
450 Ga0075363_100104481
451 Ga0075363_100105314
452 Ga0075363_100142418
453 Ga0075364_10015943
454 Ga0075364_10069327
455 Ga0075364_10174364
456 Ga0075364_10293543
457 Ga0075367_10001964
458 Ga0075367_10053933
459 Ga0075367_10140664
460 Ga0075367_10151817
461 Ga0075370_10005529
462 Ga0075370_10013898
463 Ga0075370_10037242
464 Ga0068871_100495989
465 Ga0068865_100013598
466 Ga0097620_100559282
467 Ga0111539_10114837
468 Ga0111539_10782398
469 Ga0105245_10027428
470 Ga0105243_10001281
471 Ga0105243_10089940
472 Ga0105243_10154156
473 Ga0105243_10747113
474 Ga0105242_10356090
475 Ga0105242_10428290
476 Ga0105242_10519043
477 Ga0105248_10022228
478 Ga0105248_10052615
479 Ga0105238_10896699
480 Ga0105249_10101535
481 Ga0105239_10465919
482 Ga0105239_10684723
483 Ga0105239_10841182
484 Ga0105246_10214723
485 Ga0105246_10467757
486 Ga0157370_10057668
487 Ga0157369_10271983
488 Ga0163162_10206006
489 Ga0157372_10024021
490 Ga0157372_10087813
491 Ga0157372_10162781
492 Ga0157372_10289375
493 Ga0157375_10055950
494 Ga0157375_10713010
495 Ga0157375_10967809
496 Ga0157375_11077284
497 Ga0163163_10110709
498 Ga0163163_10564098
499 Ga0157380_10096477
500 Ga0157380_10258886
501 Ga0182008_10078484
502 Ga0157377_10001248
503 Ga0157376_10243784
504 Ga0157376_10603420
505 Ga0163161_10081357
506 Ga0163161_10116485
507 Ga0206353_11101154
508 Ga0207656_10096091
509 Ga0207642_10107223
510 Ga0207688_10017285
511 Ga0207647_10006214
512 Ga0207647_10032550
513 Ga0207643_10006969
514 Ga0207662_10032854
515 Ga0207652_10264499
516 Ga0207681_10078043
517 Ga0207650_10165506
518 Ga0207659_10090935
519 Ga0207687_10179593
520 Ga0207687_10495984
521 Ga0207686_10295694
522 Ga0207709_10021835
523 Ga0207709_10481411
524 Ga0207669_10013837
525 Ga0207704_10206106
526 Ga0207691_10029718
527 Ga0207711_10064504
528 Ga0207711_10109420
529 Ga0207661_10112663
530 Ga0207679_10225908
531 Ga0207712_10063661
532 Ga0207712_10098653
533 Ga0207640_10100652
534 Ga0207677_10037116
535 Ga0207639_10054963
536 Ga0207639_10083215
537 Ga0207639_10087797
538 Ga0207678_10474123
539 Ga0207708_10000445
540 Ga0207708_10309597
541 Ga0207648_10007814
542 Ga0207676_10043693
543 Ga0207674_10238161
544 Ga0207675_100009111
545 Ga0207683_10150046
546 Ga0207698_10084161
547 Ga0207698_10317364
548 Ga0209813_10002429
549 Ga0209813_10029376
550 Ga0209813_10037111
551 Ga0268266_10003412
552 Ga0268265_10195541
553 Ga0268264_10000269
554 Ga0307509_10327013
555 Ga0307408_100571035
556 Ga0307405_10256493
557 Ga0307518_10021152
558 Ga0307410_10007301
559 Ga0307410_10386772
560 Ga0307406_10020504
561 Ga0307406_10210806
562 Ga0307407_10039250
563 Ga0307407_10147872
564 Ga0307412_10165624
565 Ga0307409_100007230
566 Ga0307409_100245225
567 Ga0307416_100123856
568 Ga0307416_100208258
569 Ga0307416_100318182
570 Ga0307416_100345340
571 Ga0307416_100623441
572 Ga0307414_10012215
573 Ga0307411_10115426
574 Ga0307411_10379979
575 Ga0395901_0092235
576 Ga0451791_0651712
577 Ga0451791_1728168
578 Ga0451797_0323081
579 Ga0451837_1323451
580 Ga0451853_0979217
581 Ga0451853_3441559
582 Ga0450894_000323
583 Ga0450898_000700
584 Ga0450906_004043
585 Ga0466967_0739837
586 Ga0495629_0020962
587 Ga0495639_0278721
588 Ga0495662_0010513
589 Ga0495665_0271468
590 Ga0495587_0003859
591 Ga0495625_0026596
592 Ga0495657_0089339
593 Ga0495658_0139583
594 Ga0495613_0063532
595 Ga0495581_0104040
596 Ga0495593_0060128
597 Ga0496100_0066135
598 Ga0496101_0037983
599 Ga0496101_0253325
600 Ga0496102_0043007
601 Ga0496102_0250691
602 Ga0496102_0444761
603 Ga0496104_0003571
604 Ga0496105_0004250
605 Ga0496105_0216830
606 Ga0496105_0541783
607 Ga0496105_0597429
608 Ga0496106_0029605
609 Ga0496106_0597602
610 Ga0496106_0609380
611 Ga0496107_0003988
612 Ga0496107_0013069
613 Ga0496108_0021326
614 Ga0496108_0108712
615 Ga0496108_0327067
616 Ga0496109_0042660
617 Ga0496109_0045429
618 Ga0496109_0048127
619 Ga0496109_0417995
620 Ga0496109_0467494
621 Ga0496109_0831892
622 Ga0496110_0145417
623 Ga0496110_0294899
624 Ga0496110_0674179
625 Ga0496111_0037936
626 Ga0496113_0130614
627 Ga0496114_0031148
628 Ga0496114_0033139
629 Ga0496114_0074878
630 Ga0496114_0079431
631 Ga0496114_0082287
632 Ga0496114_0111349
633 Ga0496114_0113678
634 Ga0496114_0159158
635 Ga0496114_0182065
636 Ga0496114_0244828
637 Ga0496114_0277932
638 Ga0496114_0322366
639 Ga0496114_0418682
640 Ga0496115_0005267
641 Ga0496115_0225963
642 Ga0496119_0000715
643 Ga0496125_0151359
644 Ga0501325_010573
645 Ga0501031_0003388
646 Ga0501031_0055830
647 Ga0501031_0248919
648 Ga0501031_0313298
649 Ga0501032_0058243
650 Ga0501034_0019357
651 Ga0501036_0027876
652 Ga0501036_0043200
653 Ga0501038_0012405
654 Ga0501038_0176165
655 Ga0501039_0045891
656 Ga0501039_0109589
657 Ga0501040_0095116
658 Ga0501040_0112711
659 Ga0501040_0492448
660 Ga0501041_0018436
661 Ga0501042_0019965
662 Ga0501043_0111634
663 Ga0501043_0251064
664 Ga0501046_0087573
665 Ga0501047_0002087
666 Ga0501048_0033874
667 Ga0501048_0197827
668 Ga0501069_0123189
669 Ga0501069_0189237
670 Ga0501070_0059773
671 Ga0501070_0286536
672 Ga0501071_0017089
673 Ga0501071_0074125
674 Ga0501072_0053046
675 Ga0501072_0053582
676 Ga0501073_0034163
677 Ga0501074_0010913
678 Ga0501076_0013168
679 Ga0501076_0467517
680 Ga0501077_0082274
681 Ga0501079_0135692
682 Ga0501080_0070636
683 Ga0501081_0147385
684 Ga0501081_0403104
685 Ga0501035_0022904
686 Ga0501035_0360054
687 Ga0501044_0009074
688 Ga0501044_0180005
689 Ga0501045_0178855
690 Ga0501045_0414572
691 nmdc:mga03n38_106129_c1
692 nmdc:mga03n38_5052_c1
693 nmdc:mga00v17_20097_c1
694 nmdc:mga00v17_222112_c1
695 nmdc:mga00v17_27321_c1
696 nmdc:mga00v17_5249_c1
697 nmdc:mga0yw44_108711_c1
698 nmdc:mga0yw44_112419_c1
699 nmdc:mga0yw44_143851_c1
700 nmdc:mga0yw44_28633_c1
701 nmdc:mga0yw44_329163_c1
702 nmdc:mga0yw44_3513_c1
703 nmdc:mga0yw44_357897_c1
704 nmdc:mga0yw44_45830_c2
705 nmdc:mga0yw44_49570_c1
706 nmdc:mga0yw44_81826_c1
707 nmdc:mga0yw44_86071_c1
708 nmdc:mga0yw44_87535_c2
709 nmdc:mga06z11_114207_c1
710 nmdc:mga06z11_117035_c1
711 nmdc:mga06z11_701_c1
712 nmdc:mga06z11_92589_c1
713 nmdc:mga04h51_129771_c1
714 nmdc:mga04h51_158431_c1
715 nmdc:mga04h51_2647_c1
716 nmdc:mga04h51_44237_c1
717 nmdc:mga07m45_3517_c1
718 nmdc:mga07m45_63081_c1
719 nmdc:mga08y16_22454_c1
720 nmdc:mga08y16_258330_c1
721 Ga0495619_0077808
722 Ga0495619_0196827
723 Ga0500553_009540
724 Ga0500573_0019056
725 Ga0501084_0043685
726 Ga0501084_0559168
727 Ga0501082_0214504
728 2643826143
729 2643850174
730 2643889375
731 2643958430
732 2644036074
733 2644136193
734 2644229420
735 2644532120
736 2738892249
737 2744956112
738 2785340230
739 2786675555
740 2808914491
741 2811842370
742 2812333054
743 2812477249
744 2816424945
745 2855390878
746 2862287612
747 2867433493
748 2891399269
749 3001891909
750 8054613676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02665

Nitrate_red_gam

Nitrate reductase gamma subunit

23

243

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ir6-assembly1.cif.gz_C crystal structure of narghi mutant narg-h49s 0.8596 2 215
1y5n-assembly1.cif.gz_C the crystal structure of the narghi mutant nari-k86a in complex with pentachlorophenol 0.8565 2 215
1siw-assembly1.cif.gz_C crystal structure of the apomolybdo-narghi 0.8525 2 215
3ir5-assembly1.cif.gz_C crystal structure of narghi mutant narg-h49c 0.8505 2 215
1y5l-assembly1.cif.gz_C the crystal structure of the narghi mutant nari-h66y 0.8414 2 215
ID Description Score Start End Superfamily
af_Q2FVM4_1_215_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8993 2 213 1.20.950.20
af_O06562_6_220_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8937 1 213 1.20.950.20
af_Q2FVM4_1_215_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8837 2 213 1.20.950.20
af_O06562_6_220_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8819 1 213 1.20.950.20
1siwC01 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8602 2 213 1.20.950.20
ID Description Score Start End GO Terms
AF-W9GQZ9-F1-model_v4 Nitrate reductase 0.9405 1 205 GO:0005886
GO:0008940
GO:0009055
GO:0009325
GO:0019645
GO:0020037
GO:0042128
GO:0046872
AF-A0A4Q9HNQ0-F1-model_v4 Respiratory nitrate reductase subunit gamma (EC 1.7.99.4) 0.9376 2 197 GO:0005886
GO:0008940
GO:0009055
GO:0009325
GO:0019645
GO:0020037
GO:0042128
GO:0046872
AF-A0A558AKU7-F1-model_v4 Respiratory nitrate reductase subunit gamma (EC 1.7.99.4) 0.9291 2 202 GO:0005886
GO:0008940
GO:0009055
GO:0009325
GO:0019645
GO:0020037
GO:0042128
GO:0046872
AF-A0A7K2P5L8-F1-model_v4 Respiratory nitrate reductase subunit gamma (EC 1.7.99.4) 0.9236 3 160 GO:0005886
GO:0008940
GO:0009055
GO:0009325
GO:0019645
GO:0020037
GO:0042128
GO:0046872
AF-A0A5C8C6E7-F1-model_v4 Respiratory nitrate reductase subunit gamma (EC 1.7.99.4) 0.9234 1 178 GO:0005886
GO:0008940
GO:0009055
GO:0009325
GO:0019645
GO:0020037
GO:0042128
GO:0046872

Map