F427134

General Info

Members Datasets Scaffolds Average Seq Length
375 237 750 263

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0063220|Ga0466958_0063220_1137_2027
Length 289
Sequence VIARIPTALTIAGSDSGGGAGIQADLKTFLACRVHGTSAITAVTVQNSRGVTGFYELPPHAVAEQIEAVATDIGVDAAKTGMLAVAEVVRRLAITPFVVDPVAASQHGDPLLRPDALEALREVIIPLATLITPNLGEVRLLTGVDVRDRADMDAAADALLALGARAVLVKGGHLPGEEAVDLLCDGTATIELTAPRHETAHTHGSGDTLAAAITAGLARGLPLADAVREGKTFITGAVAGSFALGAGLGPVGHFWRVRGWPEEDGSDGARRGDPIEEGVGTGEHPGQVG

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.33
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.33
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0063220 3300045836 Bacteria 2257
2 JGI24751J29686_10001235 3300002459 Bacteria 5403
3 rootH2_10142163 3300003320 Bacteria 1226
4 Ga0070658_10018889 3300005327 Bacteria 5523
5 Ga0070658_10075679 3300005327 Bacteria 2761
6 Ga0070658_10077247 3300005327 Bacteria 2731
7 Ga0070658_10171668 3300005327 Bacteria 1822
8 Ga0070683_100048707 3300005329 Bacteria 3918
9 Ga0070683_100061574 3300005329 Bacteria 3490
10 Ga0070690_100289578 3300005330 Bacteria 1171
11 Ga0070670_100036192 3300005331 Bacteria 4248
12 Ga0070680_100590072 3300005336 Bacteria 953
13 Ga0068868_100004843 3300005338 Bacteria 9450
14 Ga0070660_100029747 3300005339 Bacteria 4096
15 Ga0070689_100131398 3300005340 Bacteria 2008
16 Ga0070692_10168432 3300005345 Bacteria 1261
17 Ga0070675_100015853 3300005354 Bacteria 5967
18 Ga0070671_100116227 3300005355 Bacteria 2249
19 Ga0070674_100488942 3300005356 Bacteria 1023
20 Ga0070688_100103789 3300005365 Bacteria 1879
21 Ga0070659_100000857 3300005366 Bacteria 22233
22 Ga0070659_100072309 3300005366 Bacteria 2744
23 Ga0070667_100002161 3300005367 Bacteria 17316
24 Ga0070667_100056847 3300005367 Bacteria 3306
25 Ga0070703_10005070 3300005406 Bacteria 3678
26 Ga0070703_10026176 3300005406 Bacteria 1733
27 Ga0070713_100089469 3300005436 Bacteria 2644
28 Ga0070710_10019134 3300005437 Bacteria 3535
29 Ga0070701_10032531 3300005438 Bacteria 2598
30 Ga0070711_100090370 3300005439 Bacteria 2205
31 Ga0070700_100017445 3300005441 Bacteria 4105
32 Ga0070694_100001386 3300005444 Bacteria 14172
33 Ga0070694_100069927 3300005444 Bacteria 2416
34 Ga0070708_100473914 3300005445 Unclassified 1181
35 Ga0070663_100002818 3300005455 Bacteria 9864
36 Ga0070663_100007734 3300005455 Bacteria 6564
37 Ga0070663_100079472 3300005455 Bacteria 2406
38 Ga0070662_100047724 3300005457 Bacteria 3082
39 Ga0068867_100294777 3300005459 Bacteria 1335
40 Ga0070706_100009525 3300005467 Bacteria 9033
41 Ga0070706_100307026 3300005467 Bacteria 1480
42 Ga0070707_100014414 3300005468 Bacteria 7410
43 Ga0070707_100178243 3300005468 Bacteria 2072
44 Ga0070698_100006217 3300005471 Bacteria 12997
45 Ga0070698_100020502 3300005471 Bacteria 6929
46 Ga0070698_100057613 3300005471 Bacteria 3931
47 Ga0070699_100430725 3300005518 Bacteria 1195
48 Ga0070679_100001865 3300005530 Bacteria 18957
49 Ga0070679_100301090 3300005530 Bacteria 1554
50 Ga0070684_100041296 3300005535 Bacteria 3976
51 Ga0070684_100303759 3300005535 Bacteria 1465
52 Ga0068853_100004916 3300005539 Bacteria 10402
53 Ga0070704_100005206 3300005549 Bacteria 7565
54 Ga0070704_100016070 3300005549 Bacteria 4720
55 Ga0070704_100131865 3300005549 Bacteria 1938
56 Ga0068855_100021833 3300005563 Bacteria 7678
57 Ga0068855_100028361 3300005563 Bacteria 6696
58 Ga0068855_100033567 3300005563 Bacteria 6123
59 Ga0070664_100023832 3300005564 Bacteria 5055
60 Ga0068857_100225537 3300005577 Bacteria 1712
61 Ga0068856_100010477 3300005614 Bacteria 9000
62 Ga0068856_100017645 3300005614 Bacteria 6919
63 Ga0068856_100105495 3300005614 Bacteria 2812
64 Ga0070702_100110940 3300005615 Bacteria 1700
65 Ga0068852_100038106 3300005616 Bacteria 4037
66 Ga0068859_100180320 3300005617 Bacteria 2195
67 Ga0068864_100010286 3300005618 Bacteria 7726
68 Ga0068864_100200814 3300005618 Bacteria 1831
69 Ga0068861_100294994 3300005719 Bacteria 1402
70 Ga0068851_10054563 3300005834 Bacteria 2035
71 Ga0068870_10000359 3300005840 Bacteria 17088
72 Ga0068870_10042766 3300005840 Bacteria 2360
73 Ga0068863_100000881 3300005841 Bacteria 30173
74 Ga0068863_100129235 3300005841 Bacteria 2411
75 Ga0068858_100058339 3300005842 Bacteria 3568
76 Ga0068858_100128128 3300005842 Bacteria 2378
77 Ga0068860_100168463 3300005843 Bacteria 2115
78 Ga0068862_100303596 3300005844 Bacteria 1469
79 Ga0081455_10002980 3300005937 Bacteria 19766
80 Ga0081455_10026766 3300005937 Bacteria 5295
81 Ga0081540_1000940 3300005983 Bacteria 26200
82 Ga0081539_10030363 3300005985 Bacteria 3356
83 Ga0081539_10044823 3300005985 Bacteria 2550
84 Ga0081539_10047221 3300005985 Bacteria 2461
85 Ga0070717_10053618 3300006028 Bacteria 3325
86 Ga0070717_10062737 3300006028 Bacteria 3082
87 Ga0075432_10002621 3300006058 Bacteria 6009
88 Ga0070715_10026898 3300006163 Bacteria 2292
89 Ga0070716_100027854 3300006173 Bacteria 3040
90 Ga0070712_100024605 3300006175 Bacteria 3992
91 Ga0097621_100215685 3300006237 Bacteria 1670
92 Ga0075430_100035903 3300006846 Bacteria 4203
93 Ga0075433_10126945 3300006852 Bacteria 2265
94 Ga0075434_100004633 3300006871 Bacteria 12425
95 Ga0068865_100153774 3300006881 Bacteria 1748
96 Ga0075436_100014946 3300006914 Bacteria 5320
97 Ga0097620_100180320 3300006931 Bacteria 2195
98 Ga0075435_100014240 3300007076 Bacteria 5939
99 Ga0105251_10009647 3300009011 Bacteria 5678
100 Ga0105240_10114157 3300009093 Bacteria 3263
101 Ga0105240_10258598 3300009093 Bacteria 2009
102 Ga0105245_10118084 3300009098 Bacteria 2475
103 Ga0105245_10158723 3300009098 Bacteria 2144
104 Ga0105247_10017368 3300009101 Bacteria 4320
105 Ga0105243_10017346 3300009148 Bacteria 5442
106 Ga0105243_10690687 3300009148 Bacteria 994
107 Ga0105241_10237168 3300009174 Bacteria 1540
108 Ga0105242_10016455 3300009176 Bacteria 5749
109 Ga0105242_10489124 3300009176 Bacteria 1168
110 Ga0105248_10101531 3300009177 Bacteria 3242
111 Ga0105237_10023369 3300009545 Bacteria 6335
112 Ga0105237_10026218 3300009545 Bacteria 5957
113 Ga0105249_10001668 3300009553 Bacteria 19472
114 Ga0105249_10026730 3300009553 Bacteria 5204
115 Ga0105249_10026846 3300009553 Bacteria 5192
116 Ga0105239_10012640 3300010375 Bacteria 9394
117 Ga0105246_10004275 3300011119 Bacteria 8685
118 Ga0157371_10172695 3300013102 Bacteria 1545
119 Ga0157370_10111362 3300013104 Bacteria 2559
120 Ga0157369_10054683 3300013105 Bacteria 4310
121 Ga0157369_10094375 3300013105 Bacteria 3193
122 Ga0157369_10581695 3300013105 Bacteria 1156
123 Ga0157374_10118114 3300013296 Bacteria 2557
124 Ga0163162_10019092 3300013306 Bacteria 6723
125 Ga0157372_10059529 3300013307 Bacteria 4272
126 Ga0157375_10068856 3300013308 Bacteria 3543
127 Ga0157375_10546729 3300013308 Bacteria 1320
128 Ga0157375_11316742 3300013308 Bacteria 850
129 Ga0163163_10041847 3300014325 Bacteria 4483
130 Ga0163163_10062110 3300014325 Bacteria 3701
131 Ga0157377_10009898 3300014745 Bacteria 4699
132 Ga0157377_10027912 3300014745 Bacteria 3034
133 Ga0157377_10141792 3300014745 Bacteria 1477
134 Ga0157376_10008623 3300014969 Bacteria 7370
135 Ga0163161_10004106 3300017792 Bacteria 10187
136 Ga0206354_11121041 3300020081 Bacteria 1650
137 Ga0206353_11539297 3300020082 Bacteria 2035
138 Ga0206353_11819782 3300020082 Bacteria 2414
139 Ga0206353_11991146 3300020082 Bacteria 1659
140 Ga0224712_10020100 3300022467 Bacteria 2261
141 Ga0207653_10000813 3300025885 Bacteria 10499
142 Ga0207653_10023846 3300025885 Bacteria 1951
143 Ga0207688_10018197 3300025901 Bacteria 3825
144 Ga0207688_10063890 3300025901 Bacteria 2077
145 Ga0207647_10189524 3300025904 Bacteria 1192
146 Ga0207699_10079725 3300025906 Bacteria 2026
147 Ga0207643_10000738 3300025908 Bacteria 20070
148 Ga0207705_10003569 3300025909 Bacteria 11849
149 Ga0207705_10135869 3300025909 Bacteria 1833
150 Ga0207705_10155018 3300025909 Bacteria 1718
151 Ga0207684_10109240 3300025910 Bacteria 2367
152 Ga0207654_10235612 3300025911 Bacteria 1221
153 Ga0207707_10066358 3300025912 Bacteria 3142
154 Ga0207695_10083291 3300025913 Bacteria 3231
155 Ga0207693_10000770 3300025915 Bacteria 28786
156 Ga0207663_10149639 3300025916 Bacteria 1636
157 Ga0207660_10032093 3300025917 Bacteria 3622
158 Ga0207662_10044581 3300025918 Bacteria 2619
159 Ga0207646_10129913 3300025922 Bacteria 2267
160 Ga0207646_10467039 3300025922 Bacteria 1138
161 Ga0207650_10013505 3300025925 Bacteria 5658
162 Ga0207650_10013982 3300025925 Bacteria 5572
163 Ga0207659_10125341 3300025926 Bacteria 1974
164 Ga0207687_10125798 3300025927 Bacteria 1924
165 Ga0207687_10210901 3300025927 Bacteria 1524
166 Ga0207664_10199029 3300025929 Bacteria 1728
167 Ga0207644_10109737 3300025931 Bacteria 2085
168 Ga0207690_10000224 3300025932 Bacteria 42771
169 Ga0207690_10348045 3300025932 Bacteria 1171
170 Ga0207706_10040209 3300025933 Bacteria 4144
171 Ga0207709_10030081 3300025935 Bacteria 3156
172 Ga0207670_10148385 3300025936 Bacteria 1737
173 Ga0207665_10000093 3300025939 Bacteria 58107
174 Ga0207689_10013851 3300025942 Bacteria 6871
175 Ga0207661_10047790 3300025944 Bacteria 3399
176 Ga0207667_10044608 3300025949 Bacteria 4697
177 Ga0207667_10116317 3300025949 Bacteria 2755
178 Ga0207712_10243867 3300025961 Bacteria 1449
179 Ga0207658_10365181 3300025986 Bacteria 1261
180 Ga0207677_10156446 3300026023 Bacteria 1765
181 Ga0207703_10137882 3300026035 Bacteria 2114
182 Ga0207703_10163701 3300026035 Bacteria 1950
183 Ga0207703_10212326 3300026035 Bacteria 1726
184 Ga0207639_10080005 3300026041 Bacteria 2584
185 Ga0207678_10000108 3300026067 Bacteria 67848
186 Ga0207678_10006045 3300026067 Bacteria 10768
187 Ga0207678_10008249 3300026067 Bacteria 9180
188 Ga0207708_10016963 3300026075 Bacteria 5482
189 Ga0207702_10024320 3300026078 Bacteria 5025
190 Ga0207702_10028073 3300026078 Bacteria 4676
191 Ga0207702_10038881 3300026078 Bacteria 3986
192 Ga0207641_10055030 3300026088 Bacteria 3378
193 Ga0207641_10124870 3300026088 Bacteria 2303
194 Ga0207648_10276397 3300026089 Bacteria 1501
195 Ga0207676_10008612 3300026095 Bacteria 7249
196 Ga0207674_10003461 3300026116 Bacteria 19309
197 Ga0207675_100016086 3300026118 Bacteria 6986
198 Ga0207675_100061734 3300026118 Bacteria 3499
199 Ga0207683_10034422 3300026121 Bacteria 4402
200 Ga0207428_10014912 3300027907 Bacteria 6733
201 Ga0207428_10211617 3300027907 Bacteria 1456
202 Ga0265332_10028362 3300031238 Bacteria 2451
203 Ga0265339_10000650 3300031249 Bacteria 26871
204 Ga0265316_10137506 3300031344 Unclassified 1837
205 Ga0265313_10031322 3300031595 Bacteria 2728
206 Ga0265314_10000670 3300031711 Bacteria 41856
207 Ga0265342_10006979 3300031712 Bacteria 8347
208 Ga0307416_100048740 3300032002 Bacteria 3363
209 Ga0307507_10173531 3300033179 Bacteria 1560
210 Ga0373958_0020731 3300034819 Bacteria 1214
211 Ga0373928_0002953 3300035084 Bacteria 3279
212 Ga0373940_0005896 3300035088 Bacteria 2685
213 Ga0373951_0011270 3300035091 Bacteria 2006
214 Ga0373952_0048941 3300035092 Bacteria 1001
215 Ga0373939_0014901 3300035114 Bacteria 2025
216 Ga0373941_0003239 3300035115 Bacteria 3667
217 Ga0373960_0007132 3300035121 Bacteria 2640
218 Ga0373962_0066715 3300035242 Bacteria 1067
219 Ga0373931_0007517 3300035691 Bacteria 5131
220 Ga0395905_0067361 3300037471 Bacteria 3354
221 Ga0395901_0447199 3300038443 Bacteria 1322
222 Ga0439435_0089173 3300042436 Bacteria 935
223 Ga0466969_0088235 3300044656 Bacteria 1472
224 Ga0466972_0039165 3300044658 Bacteria 2314
225 Ga0466972_0052690 3300044658 Bacteria 1960
226 Ga0466972_0118694 3300044658 Bacteria 1248
227 Ga0466965_0025800 3300044683 Bacteria 2847
228 Ga0466966_0016571 3300044684 Bacteria 4866
229 Ga0466961_0010011 3300044693 Bacteria 6040
230 Ga0466961_0013586 3300044693 Bacteria 5214
231 Ga0466961_0016051 3300044693 Bacteria 4808
232 Ga0466961_0031434 3300044693 Bacteria 3412
233 Ga0466961_0091569 3300044693 Bacteria 1920
234 Ga0466961_0166132 3300044693 Bacteria 1374
235 Ga0466961_0307790 3300044693 Bacteria 967
236 Ga0466961_0334637 3300044693 Bacteria 922
237 Ga0466961_0374935 3300044693 Bacteria 864
238 Ga0466963_0003793 3300044694 Bacteria 8709
239 Ga0466963_0020544 3300044694 Bacteria 4152
240 Ga0466963_0028835 3300044694 Bacteria 3567
241 Ga0466963_0083776 3300044694 Bacteria 2163
242 Ga0466963_0087764 3300044694 Bacteria 2115
243 Ga0466963_0092726 3300044694 Bacteria 2058
244 Ga0466963_0115118 3300044694 Bacteria 1848
245 Ga0466963_0141701 3300044694 Bacteria 1665
246 Ga0466963_0202955 3300044694 Bacteria 1387
247 Ga0466963_0271921 3300044694 Bacteria 1190
248 Ga0466963_0297035 3300044694 Bacteria 1136
249 Ga0466963_0334730 3300044694 Bacteria 1066
250 Ga0466964_0010713 3300044706 Bacteria 3462
251 Ga0466964_0020280 3300044706 Bacteria 2559
252 Ga0466964_0058092 3300044706 Bacteria 1603
253 Ga0466971_0102287 3300044719 Bacteria 1317
254 Ga0466968_0124652 3300044735 Bacteria 1168
255 Ga0466968_0144231 3300044735 Bacteria 1091
256 Ga0466970_0019133 3300044765 Bacteria 3549
257 Ga0466970_0040475 3300044765 Bacteria 2475
258 Ga0466970_0075127 3300044765 Bacteria 1820
259 Ga0466957_0013925 3300044842 Bacteria 4676
260 Ga0466957_0022820 3300044842 Bacteria 3695
261 Ga0466957_0115648 3300044842 Bacteria 1705
262 Ga0466960_0066647 3300044901 Bacteria 1781
263 Ga0466960_0074154 3300044901 Bacteria 1700
264 Ga0466960_0100483 3300044901 Bacteria 1489
265 Ga0466959_0018617 3300045049 Bacteria 5100
266 Ga0466959_0039564 3300045049 Bacteria 3485
267 Ga0466959_0098095 3300045049 Bacteria 2099
268 Ga0466959_0186859 3300045049 Bacteria 1447
269 Ga0466959_0288499 3300045049 Bacteria 1125
270 Ga0466959_0401135 3300045049 Bacteria 932
271 Ga0466958_0008742 3300045836 Bacteria 5622
272 Ga0466958_0024851 3300045836 Bacteria 3527
273 Ga0466958_0030626 3300045836 Bacteria 3197
274 Ga0466958_0185946 3300045836 Bacteria 1319
275 Ga0466967_0000279 3300045976 Bacteria 22606
276 Ga0466967_0001889 3300045976 Bacteria 12650
277 Ga0466967_0011567 3300045976 Bacteria 6696
278 Ga0466967_0015607 3300045976 Bacteria 5958
279 Ga0466967_0020807 3300045976 Bacteria 5314
280 Ga0466967_0023785 3300045976 Bacteria 5026
281 Ga0466967_0077453 3300045976 Bacteria 2993
282 Ga0466967_0093020 3300045976 Bacteria 2743
283 Ga0466967_0152782 3300045976 Bacteria 2159
284 Ga0466967_0199410 3300045976 Bacteria 1895
285 Ga0466967_0316605 3300045976 Bacteria 1504
286 Ga0466967_0349643 3300045976 Bacteria 1431
287 Ga0466967_0605558 3300045976 Bacteria 1081
288 Ga0495592_0120505 3300046454 Bacteria 1846
289 Ga0495603_0012077 3300046455 Bacteria 5229
290 Ga0495603_0122844 3300046455 Bacteria 1513
291 Ga0495651_0092451 3300046462 Bacteria 2266
292 Ga0495653_0158310 3300046463 Bacteria 1575
293 Ga0495585_0088816 3300046492 Bacteria 1667
294 Ga0495594_0038389 3300046499 Bacteria 2615
295 Ga0495652_0349260 3300046529 Bacteria 1060
296 Ga0495640_0199995 3300046533 Bacteria 1267
297 Ga0495656_0175073 3300046615 Bacteria 1051
298 Ga0495659_0125461 3300046664 Bacteria 1014
299 Ga0495588_0024937 3300046674 Bacteria 2975
300 Ga0495676_0249995 3300047321 Unclassified 1210
301 Ga0495684_0051621 3300047471 Bacteria 3138
302 Ga0496100_0199514 3300048903 Bacteria 1457
303 Ga0496101_0233536 3300048904 Bacteria 1430
304 Ga0496101_0254509 3300048904 Bacteria 1369
305 Ga0496102_0000949 3300048905 Bacteria 27333
306 Ga0496102_0088580 3300048905 Bacteria 2862
307 Ga0496103_0024346 3300048906 Bacteria 3654
308 Ga0496104_0023070 3300048907 Bacteria 5719
309 Ga0496105_0319546 3300048908 Bacteria 1244
310 Ga0496106_0202737 3300048909 Bacteria 1579
311 Ga0496108_0054412 3300048911 Bacteria 3358
312 Ga0496108_0057556 3300048911 Bacteria 3266
313 Ga0496109_0011267 3300048912 Bacteria 7679
314 Ga0496109_0050541 3300048912 Bacteria 3786
315 Ga0496110_0073826 3300048913 Bacteria 3027
316 Ga0496111_0013575 3300048914 Bacteria 5547
317 Ga0496111_0322680 3300048914 Bacteria 1144
318 Ga0496114_0016591 3300048917 Bacteria 5937
319 Ga0496114_0314980 3300048917 Bacteria 1382
320 Ga0496115_0013535 3300048918 Bacteria 6172
321 Ga0496115_0110940 3300048918 Bacteria 2254
322 Ga0496118_0191850 3300048921 Bacteria 1221
323 Ga0496119_0000292 3300048922 Bacteria 70198
324 Ga0496121_0040109 3300048924 Bacteria 4112
325 Ga0496126_0000006 3300048929 Bacteria 798804
326 Ga0496126_0017076 3300048929 Bacteria 7238
327 Ga0501031_0010579 3300049568 Bacteria 6007
328 Ga0501031_0307382 3300049568 Bacteria 1027
329 Ga0501032_0037777 3300049569 Bacteria 3291
330 Ga0501033_0088577 3300049570 Bacteria 2265
331 Ga0501033_0221950 3300049570 Bacteria 1345
332 Ga0501034_0020764 3300049571 Bacteria 6703
333 Ga0501036_0170784 3300049572 Bacteria 1832
334 Ga0501037_0024537 3300049573 Bacteria 4459
335 Ga0501037_0290657 3300049573 Bacteria 1137
336 Ga0501038_0006001 3300049574 Bacteria 11236
337 Ga0501038_0255742 3300049574 Bacteria 1386
338 Ga0501040_0004086 3300049576 Bacteria 9486
339 Ga0501041_0208207 3300049577 Bacteria 1226
340 Ga0501042_0003181 3300049578 Bacteria 10244
341 Ga0501042_0184515 3300049578 Bacteria 1505
342 Ga0501046_0092637 3300049580 Bacteria 2323
343 Ga0501047_0012483 3300049581 Bacteria 8046
344 Ga0501048_0002212 3300049582 Bacteria 14809
345 Ga0501048_0038599 3300049582 Bacteria 3426
346 Ga0501048_0458162 3300049582 Bacteria 913
347 Ga0501070_0034888 3300049586 Bacteria 4204
348 Ga0501074_0084853 3300049590 Bacteria 2270
349 Ga0501075_0013416 3300049591 Bacteria 5847
350 Ga0501077_0060499 3300049593 Bacteria 2404
351 Ga0501079_0296700 3300049741 Bacteria 1264
352 Ga0501081_0019090 3300049743 Bacteria 4560
353 Ga0501035_0007662 3300049822 Bacteria 10086
354 Ga0501035_0123761 3300049822 Bacteria 2259
355 Ga0501044_0064118 3300049823 Bacteria 3752
356 Ga0501044_0117459 3300049823 Bacteria 2664
357 Ga0501045_0012467 3300049824 Bacteria 5986
358 nmdc:mga05p37_125170_c1 3300050507 Bacteria 3157
359 nmdc:mga09592_355779_c1 3300050508 Bacteria 1267
360 nmdc:mga06r32_195554_c1 3300050510 Bacteria 2010
361 nmdc:mga06r32_298979_c1 3300050510 Bacteria 1596
362 nmdc:mga0n895_10130_c1 3300050512 Bacteria 8297
363 nmdc:mga0rr50_145176_c1 3300050513 Bacteria 1912
364 nmdc:mga0rr50_5935_c1 3300050513 Bacteria 7354
365 nmdc:mga08x19_177806_c1 3300050514 Bacteria 1452
366 nmdc:mga0a205_16257_c1 3300050515 Bacteria 6967
367 Ga0495601_0005782 3300053077 Bacteria 7214
368 Ga0495619_0025959 3300053085 Bacteria 3767
369 Ga0501084_0037495 3300054114 Bacteria 4050
370 Ga0501082_0041731 3300060353 Bacteria 3956
371 Ga0466962_0013651 3300061719 Bacteria 3910
372 Ga0466962_0031895 3300061719 Bacteria 2523
373 Ga0466962_0053928 3300061719 Bacteria 1921
374 Ga0466962_0087792 3300061719 Bacteria 1489
375 8003319742 8003314358 Bacteria 10575343
376 Ga0466958_0063220
377 JGI24751J29686_10001235
378 rootH2_10142163
379 Ga0070658_10018889
380 Ga0070658_10075679
381 Ga0070658_10077247
382 Ga0070658_10171668
383 Ga0070683_100048707
384 Ga0070683_100061574
385 Ga0070690_100289578
386 Ga0070670_100036192
387 Ga0070680_100590072
388 Ga0068868_100004843
389 Ga0070660_100029747
390 Ga0070689_100131398
391 Ga0070692_10168432
392 Ga0070675_100015853
393 Ga0070671_100116227
394 Ga0070674_100488942
395 Ga0070688_100103789
396 Ga0070659_100000857
397 Ga0070659_100072309
398 Ga0070667_100002161
399 Ga0070667_100056847
400 Ga0070703_10005070
401 Ga0070703_10026176
402 Ga0070713_100089469
403 Ga0070710_10019134
404 Ga0070701_10032531
405 Ga0070711_100090370
406 Ga0070700_100017445
407 Ga0070694_100001386
408 Ga0070694_100069927
409 Ga0070708_100473914
410 Ga0070663_100002818
411 Ga0070663_100007734
412 Ga0070663_100079472
413 Ga0070662_100047724
414 Ga0068867_100294777
415 Ga0070706_100009525
416 Ga0070706_100307026
417 Ga0070707_100014414
418 Ga0070707_100178243
419 Ga0070698_100006217
420 Ga0070698_100020502
421 Ga0070698_100057613
422 Ga0070699_100430725
423 Ga0070679_100001865
424 Ga0070679_100301090
425 Ga0070684_100041296
426 Ga0070684_100303759
427 Ga0068853_100004916
428 Ga0070704_100005206
429 Ga0070704_100016070
430 Ga0070704_100131865
431 Ga0068855_100021833
432 Ga0068855_100028361
433 Ga0068855_100033567
434 Ga0070664_100023832
435 Ga0068857_100225537
436 Ga0068856_100010477
437 Ga0068856_100017645
438 Ga0068856_100105495
439 Ga0070702_100110940
440 Ga0068852_100038106
441 Ga0068859_100180320
442 Ga0068864_100010286
443 Ga0068864_100200814
444 Ga0068861_100294994
445 Ga0068851_10054563
446 Ga0068870_10000359
447 Ga0068870_10042766
448 Ga0068863_100000881
449 Ga0068863_100129235
450 Ga0068858_100058339
451 Ga0068858_100128128
452 Ga0068860_100168463
453 Ga0068862_100303596
454 Ga0081455_10002980
455 Ga0081455_10026766
456 Ga0081540_1000940
457 Ga0081539_10030363
458 Ga0081539_10044823
459 Ga0081539_10047221
460 Ga0070717_10053618
461 Ga0070717_10062737
462 Ga0075432_10002621
463 Ga0070715_10026898
464 Ga0070716_100027854
465 Ga0070712_100024605
466 Ga0097621_100215685
467 Ga0075430_100035903
468 Ga0075433_10126945
469 Ga0075434_100004633
470 Ga0068865_100153774
471 Ga0075436_100014946
472 Ga0097620_100180320
473 Ga0075435_100014240
474 Ga0105251_10009647
475 Ga0105240_10114157
476 Ga0105240_10258598
477 Ga0105245_10118084
478 Ga0105245_10158723
479 Ga0105247_10017368
480 Ga0105243_10017346
481 Ga0105243_10690687
482 Ga0105241_10237168
483 Ga0105242_10016455
484 Ga0105242_10489124
485 Ga0105248_10101531
486 Ga0105237_10023369
487 Ga0105237_10026218
488 Ga0105249_10001668
489 Ga0105249_10026730
490 Ga0105249_10026846
491 Ga0105239_10012640
492 Ga0105246_10004275
493 Ga0157371_10172695
494 Ga0157370_10111362
495 Ga0157369_10054683
496 Ga0157369_10094375
497 Ga0157369_10581695
498 Ga0157374_10118114
499 Ga0163162_10019092
500 Ga0157372_10059529
501 Ga0157375_10068856
502 Ga0157375_10546729
503 Ga0157375_11316742
504 Ga0163163_10041847
505 Ga0163163_10062110
506 Ga0157377_10009898
507 Ga0157377_10027912
508 Ga0157377_10141792
509 Ga0157376_10008623
510 Ga0163161_10004106
511 Ga0206354_11121041
512 Ga0206353_11539297
513 Ga0206353_11819782
514 Ga0206353_11991146
515 Ga0224712_10020100
516 Ga0207653_10000813
517 Ga0207653_10023846
518 Ga0207688_10018197
519 Ga0207688_10063890
520 Ga0207647_10189524
521 Ga0207699_10079725
522 Ga0207643_10000738
523 Ga0207705_10003569
524 Ga0207705_10135869
525 Ga0207705_10155018
526 Ga0207684_10109240
527 Ga0207654_10235612
528 Ga0207707_10066358
529 Ga0207695_10083291
530 Ga0207693_10000770
531 Ga0207663_10149639
532 Ga0207660_10032093
533 Ga0207662_10044581
534 Ga0207646_10129913
535 Ga0207646_10467039
536 Ga0207650_10013505
537 Ga0207650_10013982
538 Ga0207659_10125341
539 Ga0207687_10125798
540 Ga0207687_10210901
541 Ga0207664_10199029
542 Ga0207644_10109737
543 Ga0207690_10000224
544 Ga0207690_10348045
545 Ga0207706_10040209
546 Ga0207709_10030081
547 Ga0207670_10148385
548 Ga0207665_10000093
549 Ga0207689_10013851
550 Ga0207661_10047790
551 Ga0207667_10044608
552 Ga0207667_10116317
553 Ga0207712_10243867
554 Ga0207658_10365181
555 Ga0207677_10156446
556 Ga0207703_10137882
557 Ga0207703_10163701
558 Ga0207703_10212326
559 Ga0207639_10080005
560 Ga0207678_10000108
561 Ga0207678_10006045
562 Ga0207678_10008249
563 Ga0207708_10016963
564 Ga0207702_10024320
565 Ga0207702_10028073
566 Ga0207702_10038881
567 Ga0207641_10055030
568 Ga0207641_10124870
569 Ga0207648_10276397
570 Ga0207676_10008612
571 Ga0207674_10003461
572 Ga0207675_100016086
573 Ga0207675_100061734
574 Ga0207683_10034422
575 Ga0207428_10014912
576 Ga0207428_10211617
577 Ga0265332_10028362
578 Ga0265339_10000650
579 Ga0265316_10137506
580 Ga0265313_10031322
581 Ga0265314_10000670
582 Ga0265342_10006979
583 Ga0307416_100048740
584 Ga0307507_10173531
585 Ga0373958_0020731
586 Ga0373928_0002953
587 Ga0373940_0005896
588 Ga0373951_0011270
589 Ga0373952_0048941
590 Ga0373939_0014901
591 Ga0373941_0003239
592 Ga0373960_0007132
593 Ga0373962_0066715
594 Ga0373931_0007517
595 Ga0395905_0067361
596 Ga0395901_0447199
597 Ga0439435_0089173
598 Ga0466969_0088235
599 Ga0466972_0039165
600 Ga0466972_0052690
601 Ga0466972_0118694
602 Ga0466965_0025800
603 Ga0466966_0016571
604 Ga0466961_0010011
605 Ga0466961_0013586
606 Ga0466961_0016051
607 Ga0466961_0031434
608 Ga0466961_0091569
609 Ga0466961_0166132
610 Ga0466961_0307790
611 Ga0466961_0334637
612 Ga0466961_0374935
613 Ga0466963_0003793
614 Ga0466963_0020544
615 Ga0466963_0028835
616 Ga0466963_0083776
617 Ga0466963_0087764
618 Ga0466963_0092726
619 Ga0466963_0115118
620 Ga0466963_0141701
621 Ga0466963_0202955
622 Ga0466963_0271921
623 Ga0466963_0297035
624 Ga0466963_0334730
625 Ga0466964_0010713
626 Ga0466964_0020280
627 Ga0466964_0058092
628 Ga0466971_0102287
629 Ga0466968_0124652
630 Ga0466968_0144231
631 Ga0466970_0019133
632 Ga0466970_0040475
633 Ga0466970_0075127
634 Ga0466957_0013925
635 Ga0466957_0022820
636 Ga0466957_0115648
637 Ga0466960_0066647
638 Ga0466960_0074154
639 Ga0466960_0100483
640 Ga0466959_0018617
641 Ga0466959_0039564
642 Ga0466959_0098095
643 Ga0466959_0186859
644 Ga0466959_0288499
645 Ga0466959_0401135
646 Ga0466958_0008742
647 Ga0466958_0024851
648 Ga0466958_0030626
649 Ga0466958_0185946
650 Ga0466967_0000279
651 Ga0466967_0001889
652 Ga0466967_0011567
653 Ga0466967_0015607
654 Ga0466967_0020807
655 Ga0466967_0023785
656 Ga0466967_0077453
657 Ga0466967_0093020
658 Ga0466967_0152782
659 Ga0466967_0199410
660 Ga0466967_0316605
661 Ga0466967_0349643
662 Ga0466967_0605558
663 Ga0495592_0120505
664 Ga0495603_0012077
665 Ga0495603_0122844
666 Ga0495651_0092451
667 Ga0495653_0158310
668 Ga0495585_0088816
669 Ga0495594_0038389
670 Ga0495652_0349260
671 Ga0495640_0199995
672 Ga0495656_0175073
673 Ga0495659_0125461
674 Ga0495588_0024937
675 Ga0495676_0249995
676 Ga0495684_0051621
677 Ga0496100_0199514
678 Ga0496101_0233536
679 Ga0496101_0254509
680 Ga0496102_0000949
681 Ga0496102_0088580
682 Ga0496103_0024346
683 Ga0496104_0023070
684 Ga0496105_0319546
685 Ga0496106_0202737
686 Ga0496108_0054412
687 Ga0496108_0057556
688 Ga0496109_0011267
689 Ga0496109_0050541
690 Ga0496110_0073826
691 Ga0496111_0013575
692 Ga0496111_0322680
693 Ga0496114_0016591
694 Ga0496114_0314980
695 Ga0496115_0013535
696 Ga0496115_0110940
697 Ga0496118_0191850
698 Ga0496119_0000292
699 Ga0496121_0040109
700 Ga0496126_0000006
701 Ga0496126_0017076
702 Ga0501031_0010579
703 Ga0501031_0307382
704 Ga0501032_0037777
705 Ga0501033_0088577
706 Ga0501033_0221950
707 Ga0501034_0020764
708 Ga0501036_0170784
709 Ga0501037_0024537
710 Ga0501037_0290657
711 Ga0501038_0006001
712 Ga0501038_0255742
713 Ga0501040_0004086
714 Ga0501041_0208207
715 Ga0501042_0003181
716 Ga0501042_0184515
717 Ga0501046_0092637
718 Ga0501047_0012483
719 Ga0501048_0002212
720 Ga0501048_0038599
721 Ga0501048_0458162
722 Ga0501070_0034888
723 Ga0501074_0084853
724 Ga0501075_0013416
725 Ga0501077_0060499
726 Ga0501079_0296700
727 Ga0501081_0019090
728 Ga0501035_0007662
729 Ga0501035_0123761
730 Ga0501044_0064118
731 Ga0501044_0117459
732 Ga0501045_0012467
733 nmdc:mga05p37_125170_c1
734 nmdc:mga09592_355779_c1
735 nmdc:mga06r32_195554_c1
736 nmdc:mga06r32_298979_c1
737 nmdc:mga0n895_10130_c1
738 nmdc:mga0rr50_145176_c1
739 nmdc:mga0rr50_5935_c1
740 nmdc:mga08x19_177806_c1
741 nmdc:mga0a205_16257_c1
742 Ga0495601_0005782
743 Ga0495619_0025959
744 Ga0501084_0037495
745 Ga0501082_0041731
746 Ga0466962_0013651
747 Ga0466962_0031895
748 Ga0466962_0053928
749 Ga0466962_0087792
750 8003319742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08543

Phos_pyr_kin

Phosphomethylpyrimidine kinase

15

252

0.97

PF00294

PfkB

pfkB family carbohydrate kinase

31

235

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i5b-assembly2.cif.gz_D the crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution 0.9377 8 232
2i5b-assembly1.cif.gz_B the crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution 0.9368 8 232
1ub0-assembly1.cif.gz_A-2 crystal structure analysis of phosphomethylpyrimidine kinase (thid) from thermus thermophilus hb8 0.9351 10 233
4c5k-assembly2.cif.gz_A structure of the pyridoxal kinase from staphylococcus aureus in complex with adp 0.9304 7 233
4c5m-assembly2.cif.gz_A structure of the pyridoxal kinase from staphylococcus aureus in complex with amp-pcp 0.9295 7 233
ID Description Score Start End Superfamily
af_P9WG77_1_265_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9711 7 237 3.40.1190.20
af_Q2FWG1_2_274_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9428 7 232 3.40.1190.20
af_Q06490_24_336_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9377 9 237 3.40.1190.20
2i5bB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9368 8 232 3.40.1190.20
af_O94266_18_315_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9368 6 237 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7C7DAU9-F1-model_v4 Bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase 0.9816 113 239 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A3A2ZRK1-F1-model_v4 Thiamine biosynthesis protein 0.9802 7 84 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A533ZFW3-F1-model_v4 hydroxymethylpyrimidine kinase (EC 2.7.1.49) 0.9771 93 237 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A7J3QFZ0-F1-model_v4 Bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase 0.9767 100 234 GO:0005829
GO:0008902
GO:0008972
GO:0009228
AF-A0A645GKV5-F1-model_v4 PN/PL/PM kinase (Pyridoxal kinase) (Pyridoxamine kinase) (Vitamin B6 kinase) 0.9759 92 232 GO:0005829
GO:0008478
GO:0008902
GO:0008972
GO:0009228

Map