F427132

General Info

Members Datasets Scaffolds Average Seq Length
375 171 750 305

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0421760|Ga0451576_0421760_120_1043
Length 283
Sequence MPEEAKAPPSPEPPDELAEGFLLYLDGERRSSPRTLELYETALRQFRQWRPPFKGWDQLSSDDFRAFLFDLMKQERARHNPLMDVQLPKLEKKLPVVFTVTQIDDLLALPLKTPKDKQAPVWGAERDAAILELFYSTGMRLSELVGLNVEDIDVISEVVRVFGKGRKERLCPLGRPALEAIQRYRQKASVHNGPLFLSKVRRRMTVRAVADVVQKYWRLSGLAVHMTPHKFRHSFATHLLNNGADLRSVQTLLGHASLSTTQIYTHVSTQRMKEVYDLAHPRA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.93
Rhizosphere 91.2
Stem 0
Stem Tuber 0
Unclassified 7.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0421760 3300045051 Bacteria 1400
2 JGI24035J26624_1002987 3300002126 Bacteria 1580
3 JGI25406J46586_10000074 3300003203 Bacteria 45331
4 JGI25405J52794_10018364 3300003911 Bacteria 1396
5 Ga0065704_10004986 3300005289 Bacteria 3616
6 Ga0065704_10011666 3300005289 Bacteria 2117
7 Ga0065704_10076385 3300005289 Bacteria 5141
8 Ga0065712_10005756 3300005290 Bacteria 3093
9 Ga0065712_10069699 3300005290 Bacteria 6835
10 Ga0065712_10094240 3300005290 Bacteria 2263
11 Ga0065712_10137320 3300005290 Unclassified 1484
12 Ga0065715_10002620 3300005293 Bacteria 4610
13 Ga0065715_10003423 3300005293 Bacteria 5629
14 Ga0065715_10006416 3300005293 Bacteria 2893
15 Ga0065715_10132993 3300005293 Bacteria 1980
16 Ga0065707_10019393 3300005295 Bacteria 2807
17 Ga0065707_10146344 3300005295 Bacteria 1702
18 Ga0070676_10001935 3300005328 Bacteria 10526
19 Ga0070676_10007891 3300005328 Bacteria 5720
20 Ga0070676_10221928 3300005328 Bacteria 1249
21 Ga0070683_100053434 3300005329 Bacteria 3743
22 Ga0070690_100009845 3300005330 Bacteria 5547
23 Ga0070690_100093203 3300005330 Unclassified 1987
24 Ga0070670_100006772 3300005331 Bacteria 9708
25 Ga0070670_100051948 3300005331 Bacteria 3519
26 Ga0070670_100118364 3300005331 Unclassified 2284
27 Ga0068869_100038661 3300005334 Bacteria 3403
28 Ga0070666_10047067 3300005335 Bacteria 2895
29 Ga0070666_10096531 3300005335 Bacteria 2034
30 Ga0068868_100014738 3300005338 Bacteria 5767
31 Ga0070660_100347937 3300005339 Unclassified 1220
32 Ga0070689_100020416 3300005340 Bacteria 4915
33 Ga0070689_100023157 3300005340 Bacteria 4647
34 Ga0070689_100111283 3300005340 Bacteria 2178
35 Ga0070687_100000356 3300005343 Bacteria 15574
36 Ga0070661_100047251 3300005344 Bacteria 3149
37 Ga0070668_100004167 3300005347 Bacteria 10716
38 Ga0070668_100024844 3300005347 Bacteria 4541
39 Ga0070668_100193065 3300005347 Bacteria 1668
40 Ga0070669_100005494 3300005353 Bacteria 9149
41 Ga0070669_100008367 3300005353 Bacteria 7381
42 Ga0070669_100212003 3300005353 Unclassified 1528
43 Ga0070675_100005919 3300005354 Bacteria 9366
44 Ga0070675_100009063 3300005354 Bacteria 7729
45 Ga0070675_100036314 3300005354 Bacteria 4009
46 Ga0070675_100093629 3300005354 Bacteria 2520
47 Ga0070675_100230216 3300005354 Unclassified 1616
48 Ga0070675_100259166 3300005354 Bacteria 1523
49 Ga0070671_100328839 3300005355 Bacteria 1303
50 Ga0070674_100000696 3300005356 Bacteria 17078
51 Ga0070674_100002721 3300005356 Bacteria 9778
52 Ga0070673_100015206 3300005364 Bacteria 5396
53 Ga0070673_100073477 3300005364 Bacteria 2753
54 Ga0070688_100012243 3300005365 Bacteria 4802
55 Ga0070688_100026328 3300005365 Bacteria 3455
56 Ga0070688_100071966 3300005365 Bacteria 2214
57 Ga0070659_100011906 3300005366 Bacteria 6439
58 Ga0070659_100014632 3300005366 Bacteria 5867
59 Ga0070667_100026349 3300005367 Bacteria 4835
60 Ga0070667_100026780 3300005367 Bacteria 4797
61 Ga0070667_100123262 3300005367 Bacteria 2256
62 Ga0070667_100181872 3300005367 Unclassified 1859
63 Ga0070667_100358833 3300005367 Bacteria 1321
64 Ga0070709_10023076 3300005434 Bacteria 3648
65 Ga0070714_100094609 3300005435 Bacteria 2622
66 Ga0070713_100295879 3300005436 Bacteria 1489
67 Ga0070710_10065679 3300005437 Bacteria 2078
68 Ga0070711_100024486 3300005439 Bacteria 3937
69 Ga0070705_100013579 3300005440 Bacteria 4170
70 Ga0070705_100048951 3300005440 Bacteria 2452
71 Ga0070700_100008652 3300005441 Bacteria 5549
72 Ga0070708_100104973 3300005445 Bacteria 2592
73 Ga0070708_100239818 3300005445 Bacteria 1702
74 Ga0070663_100051281 3300005455 Bacteria 2939
75 Ga0070663_100070265 3300005455 Unclassified 2546
76 Ga0070678_100008437 3300005456 Bacteria 6171
77 Ga0070678_100018103 3300005456 Bacteria 4558
78 Ga0070678_100054209 3300005456 Bacteria 2920
79 Ga0070678_100106617 3300005456 Bacteria 2184
80 Ga0070678_100290382 3300005456 Bacteria 1386
81 Ga0070662_100001690 3300005457 Bacteria 13569
82 Ga0070662_100053277 3300005457 Bacteria 2928
83 Ga0070706_100001701 3300005467 Bacteria 22906
84 Ga0070706_100003105 3300005467 Bacteria 16458
85 Ga0070706_100018855 3300005467 Bacteria 6364
86 Ga0070706_100079682 3300005467 Bacteria 3031
87 Ga0070706_100168238 3300005467 Bacteria 2047
88 Ga0070707_100012083 3300005468 Bacteria 8059
89 Ga0070707_100013872 3300005468 Bacteria 7546
90 Ga0070707_100018861 3300005468 Bacteria 6496
91 Ga0070707_100083340 3300005468 Bacteria 3089
92 Ga0070707_100109819 3300005468 Bacteria 2675
93 Ga0070707_100265129 3300005468 Unclassified 1671
94 Ga0070707_100276804 3300005468 Bacteria 1631
95 Ga0070707_100335200 3300005468 Bacteria 1470
96 Ga0070698_100084832 3300005471 Bacteria 3155
97 Ga0070698_100103573 3300005471 Bacteria 2816
98 Ga0070698_100314018 3300005471 Bacteria 1498
99 Ga0070699_100021668 3300005518 Bacteria 5542
100 Ga0070699_100079103 3300005518 Bacteria 2863
101 Ga0070679_100077309 3300005530 Bacteria 3317
102 Ga0070684_100001429 3300005535 Bacteria 17205
103 Ga0070684_100020173 3300005535 Bacteria 5530
104 Ga0070684_100082266 3300005535 Bacteria 2850
105 Ga0070697_100001741 3300005536 Bacteria 16620
106 Ga0070697_100028367 3300005536 Bacteria 4481
107 Ga0070697_100095101 3300005536 Bacteria 2470
108 Ga0070697_100116436 3300005536 Bacteria 2232
109 Ga0070697_100243352 3300005536 Unclassified 1537
110 Ga0070672_100004228 3300005543 Bacteria 9386
111 Ga0070672_100058619 3300005543 Bacteria 3027
112 Ga0070665_100006700 3300005548 Bacteria 11708
113 Ga0070665_100038112 3300005548 Bacteria 4832
114 Ga0070665_100045948 3300005548 Bacteria 4386
115 Ga0070665_100396020 3300005548 Bacteria 1389
116 Ga0068855_100018904 3300005563 Bacteria 8282
117 Ga0070664_100348857 3300005564 Bacteria 1346
118 Ga0068854_100171164 3300005578 Bacteria 1690
119 Ga0068856_100067172 3300005614 Bacteria 3543
120 Ga0068852_100072692 3300005616 Bacteria 3023
121 Ga0068861_100470357 3300005719 Bacteria 1130
122 Ga0068863_100013658 3300005841 Bacteria 7831
123 Ga0068863_100027108 3300005841 Bacteria 5465
124 Ga0068863_100087921 3300005841 Bacteria 2945
125 Ga0068863_100236301 3300005841 Bacteria 1764
126 Ga0068863_100336339 3300005841 Bacteria 1468
127 Ga0068858_100005473 3300005842 Bacteria 12431
128 Ga0068858_100264048 3300005842 Unclassified 1637
129 Ga0068858_100682158 3300005842 Bacteria 999
130 Ga0068860_100000427 3300005843 Bacteria 53819
131 Ga0068860_100026186 3300005843 Bacteria 5624
132 Ga0068860_100077600 3300005843 Bacteria 3159
133 Ga0068860_100242639 3300005843 Unclassified 1753
134 Ga0068862_100009189 3300005844 Bacteria 8186
135 Ga0068862_100426085 3300005844 Bacteria 1246
136 Ga0081455_10000920 3300005937 Bacteria 37814
137 Ga0081455_10004503 3300005937 Bacteria 15580
138 Ga0081455_10021340 3300005937 Bacteria 6077
139 Ga0081455_10023537 3300005937 Bacteria 5729
140 Ga0081455_10027118 3300005937 Bacteria 5253
141 Ga0081455_10070977 3300005937 Bacteria 2889
142 Ga0081540_1000223 3300005983 Bacteria 59812
143 Ga0081539_10000077 3300005985 Bacteria 228125
144 Ga0081539_10010032 3300005985 Bacteria 7792
145 Ga0081539_10043032 3300005985 Bacteria 2623
146 Ga0070717_10004319 3300006028 Bacteria 10252
147 Ga0070717_10028954 3300006028 Bacteria 4439
148 Ga0070717_10126169 3300006028 Bacteria 2197
149 Ga0070717_10259085 3300006028 Bacteria 1538
150 Ga0070717_10479811 3300006028 Bacteria 1122
151 Ga0070712_100002671 3300006175 Bacteria 11006
152 Ga0070712_100018008 3300006175 Bacteria 4582
153 Ga0070712_100096978 3300006175 Bacteria 2172
154 Ga0070712_100144981 3300006175 Unclassified 1816
155 Ga0097621_100055832 3300006237 Bacteria 3226
156 Ga0097621_100063779 3300006237 Bacteria 3029
157 Ga0068871_100014267 3300006358 Bacteria 5918
158 Ga0068871_100018199 3300006358 Bacteria 5335
159 Ga0068871_100022602 3300006358 Bacteria 4852
160 Ga0068871_100148952 3300006358 Bacteria 1995
161 Ga0075428_100458693 3300006844 Bacteria 1365
162 Ga0075433_10211562 3300006852 Unclassified 1723
163 Ga0068865_100008759 3300006881 Bacteria 6258
164 Ga0075436_100049867 3300006914 Bacteria 2889
165 Ga0099795_10069838 3300007788 Bacteria 1323
166 Ga0099795_10100500 3300007788 Bacteria 1134
167 Ga0111539_10263376 3300009094 Bacteria 2007
168 Ga0111539_10312824 3300009094 Bacteria 1828
169 Ga0105247_10094473 3300009101 Bacteria 1902
170 Ga0114129_10015741 3300009147 Bacteria 10752
171 Ga0114129_10866167 3300009147 Bacteria 1147
172 Ga0105237_10062134 3300009545 Bacteria 3734
173 Ga0105237_10449250 3300009545 Bacteria 1295
174 Ga0105249_10003527 3300009553 Bacteria 13530
175 Ga0105249_10066156 3300009553 Bacteria 3327
176 Ga0105249_10105714 3300009553 Bacteria 2654
177 Ga0105239_10031559 3300010375 Bacteria 5826
178 Ga0105239_10049640 3300010375 Bacteria 4601
179 Ga0105239_10140272 3300010375 Bacteria 2693
180 Ga0105239_10254020 3300010375 Bacteria 1975
181 Ga0105239_10318752 3300010375 Bacteria 1753
182 Ga0157374_10003608 3300013296 Bacteria 13031
183 Ga0157374_10050402 3300013296 Bacteria 3869
184 Ga0157374_10077811 3300013296 Bacteria 3140
185 Ga0157374_10126890 3300013296 Bacteria 2467
186 Ga0157374_10156900 3300013296 Bacteria 2215
187 Ga0157374_10328406 3300013296 Unclassified 1517
188 Ga0157378_10009515 3300013297 Bacteria 8462
189 Ga0157378_10193926 3300013297 Bacteria 1918
190 Ga0163162_10009774 3300013306 Bacteria 9338
191 Ga0163162_10037351 3300013306 Bacteria 4847
192 Ga0163162_10049038 3300013306 Bacteria 4232
193 Ga0163162_10159439 3300013306 Unclassified 2377
194 Ga0157372_10065915 3300013307 Bacteria 4068
195 Ga0157372_10183421 3300013307 Bacteria 2423
196 Ga0157372_10206546 3300013307 Bacteria 2276
197 Ga0157375_10000246 3300013308 Bacteria 49312
198 Ga0157375_10010685 3300013308 Bacteria 8085
199 Ga0157375_10082714 3300013308 Bacteria 3253
200 Ga0157375_10092655 3300013308 Bacteria 3086
201 Ga0157375_10383757 3300013308 Unclassified 1572
202 Ga0157375_10572239 3300013308 Bacteria 1290
203 Ga0157375_10932551 3300013308 Bacteria 1011
204 Ga0163163_10036116 3300014325 Bacteria 4798
205 Ga0163163_10304911 3300014325 Bacteria 1645
206 Ga0163163_10505134 3300014325 Bacteria 1271
207 Ga0157379_10003716 3300014968 Bacteria 12985
208 Ga0157379_10162314 3300014968 Bacteria 2017
209 Ga0157379_10172446 3300014968 Bacteria 1953
210 Ga0157376_10018222 3300014969 Bacteria 5376
211 Ga0157376_10034743 3300014969 Bacteria 4073
212 Ga0157376_10083096 3300014969 Bacteria 2754
213 Ga0157376_10141457 3300014969 Bacteria 2159
214 Ga0213876_10006604 3300021384 Bacteria 6327
215 Ga0213876_10024631 3300021384 Bacteria 3177
216 Ga0207697_10000300 3300025315 Bacteria 27618
217 Ga0207697_10000867 3300025315 Bacteria 17114
218 Ga0207697_10002089 3300025315 Bacteria 10508
219 Ga0207697_10002499 3300025315 Bacteria 9496
220 Ga0207697_10004182 3300025315 Bacteria 6941
221 Ga0207697_10004441 3300025315 Bacteria 6701
222 Ga0207697_10023673 3300025315 Bacteria 2514
223 Ga0207697_10044912 3300025315 Bacteria 1818
224 Ga0207653_10019572 3300025885 Bacteria 2135
225 Ga0207688_10026284 3300025901 Bacteria 3200
226 Ga0207680_10016439 3300025903 Bacteria 3884
227 Ga0207647_10018489 3300025904 Bacteria 4710
228 Ga0207699_10170113 3300025906 Bacteria 1457
229 Ga0207645_10002315 3300025907 Bacteria 15057
230 Ga0207645_10123092 3300025907 Bacteria 1685
231 Ga0207684_10000134 3300025910 Bacteria 133720
232 Ga0207684_10004963 3300025910 Bacteria 12411
233 Ga0207684_10007014 3300025910 Bacteria 10189
234 Ga0207684_10078914 3300025910 Bacteria 2800
235 Ga0207684_10096423 3300025910 Bacteria 2524
236 Ga0207684_10389186 3300025910 Bacteria 1199
237 Ga0207671_10358134 3300025914 Bacteria 1157
238 Ga0207693_10001844 3300025915 Bacteria 18562
239 Ga0207693_10074745 3300025915 Bacteria 2654
240 Ga0207693_10187355 3300025915 Bacteria 1628
241 Ga0207662_10000538 3300025918 Bacteria 16805
242 Ga0207657_10263530 3300025919 Unclassified 1371
243 Ga0207649_10054373 3300025920 Bacteria 2491
244 Ga0207646_10000815 3300025922 Bacteria 40524
245 Ga0207646_10021817 3300025922 Bacteria 5909
246 Ga0207646_10030203 3300025922 Bacteria 4916
247 Ga0207646_10047297 3300025922 Bacteria 3858
248 Ga0207646_10065374 3300025922 Bacteria 3247
249 Ga0207646_10088109 3300025922 Bacteria 2777
250 Ga0207646_10163506 3300025922 Bacteria 2009
251 Ga0207681_10015110 3300025923 Bacteria 4813
252 Ga0207681_10258442 3300025923 Bacteria 1362
253 Ga0207650_10007754 3300025925 Bacteria 7318
254 Ga0207650_10015170 3300025925 Bacteria 5361
255 Ga0207650_10082499 3300025925 Bacteria 2440
256 Ga0207659_10072888 3300025926 Bacteria 2512
257 Ga0207659_10081401 3300025926 Unclassified 2394
258 Ga0207659_10247801 3300025926 Unclassified 1444
259 Ga0207700_10263371 3300025928 Bacteria 1477
260 Ga0207700_10282397 3300025928 Bacteria 1428
261 Ga0207664_10153250 3300025929 Bacteria 1959
262 Ga0207644_10019688 3300025931 Bacteria 4582
263 Ga0207644_10030303 3300025931 Bacteria 3761
264 Ga0207644_10033876 3300025931 Bacteria 3573
265 Ga0207644_10077845 3300025931 Bacteria 2443
266 Ga0207690_10032171 3300025932 Bacteria 3363
267 Ga0207690_10186461 3300025932 Bacteria 1566
268 Ga0207706_10002608 3300025933 Bacteria 17551
269 Ga0207670_10005980 3300025936 Bacteria 6722
270 Ga0207670_10087181 3300025936 Bacteria 2199
271 Ga0207669_10008742 3300025937 Bacteria 4775
272 Ga0207691_10001507 3300025940 Bacteria 23148
273 Ga0207689_10052812 3300025942 Bacteria 3348
274 Ga0207689_10221815 3300025942 Bacteria 1562
275 Ga0207661_10296501 3300025944 Bacteria 1448
276 Ga0207679_10104572 3300025945 Bacteria 2222
277 Ga0207679_10163701 3300025945 Bacteria 1824
278 Ga0207667_10024490 3300025949 Bacteria 6626
279 Ga0207651_10037395 3300025960 Bacteria 3180
280 Ga0207651_10120793 3300025960 Bacteria 1986
281 Ga0207712_10045973 3300025961 Bacteria 3025
282 Ga0207658_10007068 3300025986 Bacteria 7644
283 Ga0207677_10009008 3300026023 Bacteria 5600
284 Ga0207677_10085041 3300026023 Unclassified 2282
285 Ga0207703_10024852 3300026035 Bacteria 4713
286 Ga0207703_10212022 3300026035 Unclassified 1727
287 Ga0207703_10278727 3300026035 Bacteria 1517
288 Ga0207678_10004972 3300026067 Bacteria 11922
289 Ga0207708_10012267 3300026075 Bacteria 6389
290 Ga0207702_10105439 3300026078 Bacteria 2497
291 Ga0207641_10091449 3300026088 Bacteria 2663
292 Ga0207641_10189055 3300026088 Bacteria 1891
293 Ga0207641_10234607 3300026088 Bacteria 1707
294 Ga0207648_10020090 3300026089 Bacteria 6024
295 Ga0207676_10184759 3300026095 Bacteria 1829
296 Ga0207675_100395491 3300026118 Bacteria 1361
297 Ga0207683_10007400 3300026121 Bacteria 9412
298 Ga0207683_10031858 3300026121 Bacteria 4578
299 Ga0207683_10047558 3300026121 Unclassified 3757
300 Ga0207698_10260472 3300026142 Unclassified 1593
301 Ga0268266_10012024 3300028379 Bacteria 7491
302 Ga0268266_10042915 3300028379 Bacteria 3864
303 Ga0268266_10068608 3300028379 Bacteria 3071
304 Ga0268266_10141594 3300028379 Bacteria 2158
305 Ga0268266_10155881 3300028379 Bacteria 2062
306 Ga0268266_10254725 3300028379 Bacteria 1624
307 Ga0268266_10303285 3300028379 Bacteria 1491
308 Ga0268264_10000834 3300028381 Bacteria 32981
309 Ga0268264_10037959 3300028381 Bacteria 3973
310 Ga0268264_10221659 3300028381 Bacteria 1741
311 Ga0307513_10056302 3300031456 Bacteria 4199
312 Ga0373944_0053225 3300035089 Bacteria 1281
313 Ga0373954_0105521 3300035118 Bacteria 1361
314 Ga0373943_0055747 3300035170 Bacteria 1959
315 Ga0373924_0067220 3300035410 Bacteria 1508
316 Ga0373935_0034398 3300035692 Bacteria 3158
317 Ga0373947_0020544 3300035725 Bacteria 3814
318 Ga0373947_0083696 3300035725 Bacteria 1979
319 Ga0373925_0082491 3300037068 Unclassified 2447
320 Ga0373925_0361580 3300037068 Bacteria 1180
321 Ga0395900_0191091 3300037418 Bacteria 2077
322 Ga0395900_0207328 3300037418 Bacteria 1980
323 Ga0395900_0381022 3300037418 Unclassified 1378
324 Ga0395898_0018396 3300037466 Bacteria 7124
325 Ga0395901_0023546 3300038443 Bacteria 6314
326 Ga0395901_0069606 3300038443 Bacteria 3665
327 Ga0395901_0352481 3300038443 Unclassified 1519
328 Ga0436365_0140663 3300039437 Bacteria 1814
329 Ga0436365_0652797 3300039437 Bacteria 4317
330 Ga0436365_1824550 3300039437 Bacteria 7124
331 Ga0451800_1285277 3300041459 Bacteria 1122
332 Ga0451853_1234598 3300041512 Bacteria 1632
333 Ga0451576_0200397 3300045051 Bacteria 2085
334 Ga0495592_0111366 3300046454 Bacteria 1937
335 Ga0495653_0195679 3300046463 Bacteria 1376
336 Ga0495580_0051957 3300046472 Unclassified 2896
337 Ga0495628_0178765 3300046516 Bacteria 1606
338 Ga0495630_0029014 3300046517 Bacteria 4112
339 Ga0495587_0054834 3300046536 Bacteria 2348
340 Ga0495645_0064428 3300046543 Bacteria 2652
341 Ga0495599_0043697 3300046678 Bacteria 2812
342 Ga0495658_0020967 3300046683 Bacteria 3439
343 Ga0495669_0073045 3300046684 Bacteria 1566
344 Ga0495604_0172412 3300047317 Bacteria 1520
345 Ga0495684_0007232 3300047471 Bacteria 8617
346 Ga0496101_0277838 3300048904 Bacteria 1308
347 Ga0496101_0393640 3300048904 Bacteria 1091
348 Ga0496101_0416965 3300048904 Bacteria 1058
349 Ga0496102_0395737 3300048905 Bacteria 1299
350 Ga0496102_0686641 3300048905 Bacteria 947
351 Ga0496104_0233166 3300048907 Bacteria 1753
352 Ga0496104_0255953 3300048907 Bacteria 1663
353 Ga0496107_0124989 3300048910 Bacteria 1897
354 Ga0496108_0074916 3300048911 Bacteria 2859
355 Ga0496108_0076370 3300048911 Bacteria 2832
356 Ga0496109_0133433 3300048912 Bacteria 2319
357 Ga0496110_0090425 3300048913 Bacteria 2737
358 Ga0496111_0249679 3300048914 Bacteria 1317
359 Ga0496112_0014717 3300048915 Bacteria 7274
360 Ga0496112_0025584 3300048915 Bacteria 5668
361 Ga0496112_0080133 3300048915 Bacteria 3229
362 Ga0496112_0090313 3300048915 Bacteria 3032
363 Ga0496112_0437406 3300048915 Bacteria 1246
364 Ga0496113_0014718 3300048916 Bacteria 5349
365 Ga0496113_0298049 3300048916 Bacteria 1291
366 Ga0496114_0008540 3300048917 Bacteria 8119
367 Ga0496114_0024483 3300048917 Bacteria 4929
368 Ga0496115_0006050 3300048918 Bacteria 8837
369 Ga0496115_0015091 3300048918 Bacteria 5854
370 Ga0496115_0132192 3300048918 Bacteria 2057
371 nmdc:mga05p37_14439_c1 3300050507 Bacteria 9480
372 nmdc:mga08y16_195081_c1 3300050511 Bacteria 2099
373 nmdc:mga08y16_252212_c1 3300050511 Bacteria 1823
374 nmdc:mga08y16_690701_c1 3300050511 Bacteria 1021
375 nmdc:mga0n895_473728_c1 3300050512 Bacteria 1263
376 Ga0451576_0421760
377 JGI24035J26624_1002987
378 JGI25406J46586_10000074
379 JGI25405J52794_10018364
380 Ga0065704_10004986
381 Ga0065704_10011666
382 Ga0065704_10076385
383 Ga0065712_10005756
384 Ga0065712_10069699
385 Ga0065712_10094240
386 Ga0065712_10137320
387 Ga0065715_10002620
388 Ga0065715_10003423
389 Ga0065715_10006416
390 Ga0065715_10132993
391 Ga0065707_10019393
392 Ga0065707_10146344
393 Ga0070676_10001935
394 Ga0070676_10007891
395 Ga0070676_10221928
396 Ga0070683_100053434
397 Ga0070690_100009845
398 Ga0070690_100093203
399 Ga0070670_100006772
400 Ga0070670_100051948
401 Ga0070670_100118364
402 Ga0068869_100038661
403 Ga0070666_10047067
404 Ga0070666_10096531
405 Ga0068868_100014738
406 Ga0070660_100347937
407 Ga0070689_100020416
408 Ga0070689_100023157
409 Ga0070689_100111283
410 Ga0070687_100000356
411 Ga0070661_100047251
412 Ga0070668_100004167
413 Ga0070668_100024844
414 Ga0070668_100193065
415 Ga0070669_100005494
416 Ga0070669_100008367
417 Ga0070669_100212003
418 Ga0070675_100005919
419 Ga0070675_100009063
420 Ga0070675_100036314
421 Ga0070675_100093629
422 Ga0070675_100230216
423 Ga0070675_100259166
424 Ga0070671_100328839
425 Ga0070674_100000696
426 Ga0070674_100002721
427 Ga0070673_100015206
428 Ga0070673_100073477
429 Ga0070688_100012243
430 Ga0070688_100026328
431 Ga0070688_100071966
432 Ga0070659_100011906
433 Ga0070659_100014632
434 Ga0070667_100026349
435 Ga0070667_100026780
436 Ga0070667_100123262
437 Ga0070667_100181872
438 Ga0070667_100358833
439 Ga0070709_10023076
440 Ga0070714_100094609
441 Ga0070713_100295879
442 Ga0070710_10065679
443 Ga0070711_100024486
444 Ga0070705_100013579
445 Ga0070705_100048951
446 Ga0070700_100008652
447 Ga0070708_100104973
448 Ga0070708_100239818
449 Ga0070663_100051281
450 Ga0070663_100070265
451 Ga0070678_100008437
452 Ga0070678_100018103
453 Ga0070678_100054209
454 Ga0070678_100106617
455 Ga0070678_100290382
456 Ga0070662_100001690
457 Ga0070662_100053277
458 Ga0070706_100001701
459 Ga0070706_100003105
460 Ga0070706_100018855
461 Ga0070706_100079682
462 Ga0070706_100168238
463 Ga0070707_100012083
464 Ga0070707_100013872
465 Ga0070707_100018861
466 Ga0070707_100083340
467 Ga0070707_100109819
468 Ga0070707_100265129
469 Ga0070707_100276804
470 Ga0070707_100335200
471 Ga0070698_100084832
472 Ga0070698_100103573
473 Ga0070698_100314018
474 Ga0070699_100021668
475 Ga0070699_100079103
476 Ga0070679_100077309
477 Ga0070684_100001429
478 Ga0070684_100020173
479 Ga0070684_100082266
480 Ga0070697_100001741
481 Ga0070697_100028367
482 Ga0070697_100095101
483 Ga0070697_100116436
484 Ga0070697_100243352
485 Ga0070672_100004228
486 Ga0070672_100058619
487 Ga0070665_100006700
488 Ga0070665_100038112
489 Ga0070665_100045948
490 Ga0070665_100396020
491 Ga0068855_100018904
492 Ga0070664_100348857
493 Ga0068854_100171164
494 Ga0068856_100067172
495 Ga0068852_100072692
496 Ga0068861_100470357
497 Ga0068863_100013658
498 Ga0068863_100027108
499 Ga0068863_100087921
500 Ga0068863_100236301
501 Ga0068863_100336339
502 Ga0068858_100005473
503 Ga0068858_100264048
504 Ga0068858_100682158
505 Ga0068860_100000427
506 Ga0068860_100026186
507 Ga0068860_100077600
508 Ga0068860_100242639
509 Ga0068862_100009189
510 Ga0068862_100426085
511 Ga0081455_10000920
512 Ga0081455_10004503
513 Ga0081455_10021340
514 Ga0081455_10023537
515 Ga0081455_10027118
516 Ga0081455_10070977
517 Ga0081540_1000223
518 Ga0081539_10000077
519 Ga0081539_10010032
520 Ga0081539_10043032
521 Ga0070717_10004319
522 Ga0070717_10028954
523 Ga0070717_10126169
524 Ga0070717_10259085
525 Ga0070717_10479811
526 Ga0070712_100002671
527 Ga0070712_100018008
528 Ga0070712_100096978
529 Ga0070712_100144981
530 Ga0097621_100055832
531 Ga0097621_100063779
532 Ga0068871_100014267
533 Ga0068871_100018199
534 Ga0068871_100022602
535 Ga0068871_100148952
536 Ga0075428_100458693
537 Ga0075433_10211562
538 Ga0068865_100008759
539 Ga0075436_100049867
540 Ga0099795_10069838
541 Ga0099795_10100500
542 Ga0111539_10263376
543 Ga0111539_10312824
544 Ga0105247_10094473
545 Ga0114129_10015741
546 Ga0114129_10866167
547 Ga0105237_10062134
548 Ga0105237_10449250
549 Ga0105249_10003527
550 Ga0105249_10066156
551 Ga0105249_10105714
552 Ga0105239_10031559
553 Ga0105239_10049640
554 Ga0105239_10140272
555 Ga0105239_10254020
556 Ga0105239_10318752
557 Ga0157374_10003608
558 Ga0157374_10050402
559 Ga0157374_10077811
560 Ga0157374_10126890
561 Ga0157374_10156900
562 Ga0157374_10328406
563 Ga0157378_10009515
564 Ga0157378_10193926
565 Ga0163162_10009774
566 Ga0163162_10037351
567 Ga0163162_10049038
568 Ga0163162_10159439
569 Ga0157372_10065915
570 Ga0157372_10183421
571 Ga0157372_10206546
572 Ga0157375_10000246
573 Ga0157375_10010685
574 Ga0157375_10082714
575 Ga0157375_10092655
576 Ga0157375_10383757
577 Ga0157375_10572239
578 Ga0157375_10932551
579 Ga0163163_10036116
580 Ga0163163_10304911
581 Ga0163163_10505134
582 Ga0157379_10003716
583 Ga0157379_10162314
584 Ga0157379_10172446
585 Ga0157376_10018222
586 Ga0157376_10034743
587 Ga0157376_10083096
588 Ga0157376_10141457
589 Ga0213876_10006604
590 Ga0213876_10024631
591 Ga0207697_10000300
592 Ga0207697_10000867
593 Ga0207697_10002089
594 Ga0207697_10002499
595 Ga0207697_10004182
596 Ga0207697_10004441
597 Ga0207697_10023673
598 Ga0207697_10044912
599 Ga0207653_10019572
600 Ga0207688_10026284
601 Ga0207680_10016439
602 Ga0207647_10018489
603 Ga0207699_10170113
604 Ga0207645_10002315
605 Ga0207645_10123092
606 Ga0207684_10000134
607 Ga0207684_10004963
608 Ga0207684_10007014
609 Ga0207684_10078914
610 Ga0207684_10096423
611 Ga0207684_10389186
612 Ga0207671_10358134
613 Ga0207693_10001844
614 Ga0207693_10074745
615 Ga0207693_10187355
616 Ga0207662_10000538
617 Ga0207657_10263530
618 Ga0207649_10054373
619 Ga0207646_10000815
620 Ga0207646_10021817
621 Ga0207646_10030203
622 Ga0207646_10047297
623 Ga0207646_10065374
624 Ga0207646_10088109
625 Ga0207646_10163506
626 Ga0207681_10015110
627 Ga0207681_10258442
628 Ga0207650_10007754
629 Ga0207650_10015170
630 Ga0207650_10082499
631 Ga0207659_10072888
632 Ga0207659_10081401
633 Ga0207659_10247801
634 Ga0207700_10263371
635 Ga0207700_10282397
636 Ga0207664_10153250
637 Ga0207644_10019688
638 Ga0207644_10030303
639 Ga0207644_10033876
640 Ga0207644_10077845
641 Ga0207690_10032171
642 Ga0207690_10186461
643 Ga0207706_10002608
644 Ga0207670_10005980
645 Ga0207670_10087181
646 Ga0207669_10008742
647 Ga0207691_10001507
648 Ga0207689_10052812
649 Ga0207689_10221815
650 Ga0207661_10296501
651 Ga0207679_10104572
652 Ga0207679_10163701
653 Ga0207667_10024490
654 Ga0207651_10037395
655 Ga0207651_10120793
656 Ga0207712_10045973
657 Ga0207658_10007068
658 Ga0207677_10009008
659 Ga0207677_10085041
660 Ga0207703_10024852
661 Ga0207703_10212022
662 Ga0207703_10278727
663 Ga0207678_10004972
664 Ga0207708_10012267
665 Ga0207702_10105439
666 Ga0207641_10091449
667 Ga0207641_10189055
668 Ga0207641_10234607
669 Ga0207648_10020090
670 Ga0207676_10184759
671 Ga0207675_100395491
672 Ga0207683_10007400
673 Ga0207683_10031858
674 Ga0207683_10047558
675 Ga0207698_10260472
676 Ga0268266_10012024
677 Ga0268266_10042915
678 Ga0268266_10068608
679 Ga0268266_10141594
680 Ga0268266_10155881
681 Ga0268266_10254725
682 Ga0268266_10303285
683 Ga0268264_10000834
684 Ga0268264_10037959
685 Ga0268264_10221659
686 Ga0307513_10056302
687 Ga0373944_0053225
688 Ga0373954_0105521
689 Ga0373943_0055747
690 Ga0373924_0067220
691 Ga0373935_0034398
692 Ga0373947_0020544
693 Ga0373947_0083696
694 Ga0373925_0082491
695 Ga0373925_0361580
696 Ga0395900_0191091
697 Ga0395900_0207328
698 Ga0395900_0381022
699 Ga0395898_0018396
700 Ga0395901_0023546
701 Ga0395901_0069606
702 Ga0395901_0352481
703 Ga0436365_0140663
704 Ga0436365_0652797
705 Ga0436365_1824550
706 Ga0451800_1285277
707 Ga0451853_1234598
708 Ga0451576_0200397
709 Ga0495592_0111366
710 Ga0495653_0195679
711 Ga0495580_0051957
712 Ga0495628_0178765
713 Ga0495630_0029014
714 Ga0495587_0054834
715 Ga0495645_0064428
716 Ga0495599_0043697
717 Ga0495658_0020967
718 Ga0495669_0073045
719 Ga0495604_0172412
720 Ga0495684_0007232
721 Ga0496101_0277838
722 Ga0496101_0393640
723 Ga0496101_0416965
724 Ga0496102_0395737
725 Ga0496102_0686641
726 Ga0496104_0233166
727 Ga0496104_0255953
728 Ga0496107_0124989
729 Ga0496108_0074916
730 Ga0496108_0076370
731 Ga0496109_0133433
732 Ga0496110_0090425
733 Ga0496111_0249679
734 Ga0496112_0014717
735 Ga0496112_0025584
736 Ga0496112_0080133
737 Ga0496112_0090313
738 Ga0496112_0437406
739 Ga0496113_0014718
740 Ga0496113_0298049
741 Ga0496114_0008540
742 Ga0496114_0024483
743 Ga0496115_0006050
744 Ga0496115_0015091
745 Ga0496115_0132192
746 nmdc:mga05p37_14439_c1
747 nmdc:mga08y16_195081_c1
748 nmdc:mga08y16_252212_c1
749 nmdc:mga08y16_690701_c1
750 nmdc:mga0n895_473728_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

97

271

0.94

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

18

79

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxo-assembly1.cif.gz_A crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase 0.8357 20 107
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.8175 20 114
2kob-assembly1.cif.gz_A solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a 0.8026 20 115
2oxo-assembly1.cif.gz_A crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase 0.7813 20 107
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.7796 20 113
ID Description Score Start End Superfamily
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9245 20 107 1.10.150.130
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9193 18 107 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.908 20 107 1.10.150.130
af_Q2FZ30_3_95_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8907 20 107 1.10.150.130
af_P9WF33_5_106_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8846 20 102 1.10.150.130
ID Description Score Start End GO Terms
AF-A0A350HBD0-F1-model_v4 Tyr recombinase domain-containing protein 0.9165 147 305 GO:0003677
GO:0006310
GO:0015074
AF-A0A5E6MH04-F1-model_v4 Partial Tyrosine recombinase XerC 0.8936 118 308 GO:0003677
GO:0006310
GO:0015074
AF-A0A2V6UZT3-F1-model_v4 Tyr recombinase domain-containing protein 0.892 159 308 GO:0003677
GO:0006310
GO:0015074
AF-A0A0J8D8V5-F1-model_v4 Phage integrase family 0.8862 128 304 GO:0003677
GO:0005737
GO:0006310
GO:0015074
AF-A0A2V5MN33-F1-model_v4 Integrase 0.8738 102 308 GO:0003677
GO:0006310
GO:0015074

Map