F427075

General Info

Members Datasets Scaffolds Average Seq Length
375 234 750 241

Family's Representative Sequence

Representative Sequence 3300031249|Ga0265339_10036811|Ga0265339_100368112
Length 274
Sequence MDGHRFMGPSPFEARATREHLRVTGLGIHEIGVNSLHMAKDRSDQAPAPASMRPEIADFLERVKSLAVPNPAGKRGRLIFALDATMSRQPTWDIACTLQADMFRTAAASGGLDIQLVYFRGLSECRASGWVANGERLAELMSAIDCRGGHTQIGKVLAHARNETGKQRVQAMVYVGDAMEEKIDDLCALAGELGLLGVPVFMFQEGNDPVAENAYREIARLSHGAYCRFDAGAAHELGELLRAVAAYAAGGMKALAALSERRDRGAKLLLAQLK

Samples

Sample ID Description Type Environment
1 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
37 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
38 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 2508501050 Microvirga lupini Lut6 Isolate Nodule
187 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
188 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
189 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
190 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
191 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
192 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
193 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
194 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
195 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
196 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
197 2922368715
198 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
199 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
200 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
201 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
202 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
203 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
204 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
205 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
206 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
207 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
208 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
209 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
210 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
211 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
212 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
213 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
214 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
215 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
216 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
217 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
218 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
219 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
220 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
221 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
222 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
223 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
224 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
225 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
226 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
227 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
228 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
229 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
230 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
231 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
232 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
233 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
234 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.17
Metatranscriptomes 0
Isolates 12.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.87
Nodule 11.2
Rhizoplane 4.53
Rhizosphere 74.67
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265339_10036811 3300031249 Bacteria 2736
2 JGI25153J46596_10007798 3300003215 Bacteria 5201
3 rootH1_10094216 3300003323 Bacteria 1855
4 Ga0065165_1000676 3300005262 Bacteria 49091
5 Ga0065165_1007291 3300005262 Bacteria 5488
6 Ga0070658_10255354 3300005327 Bacteria 1488
7 Ga0070668_100118042 3300005347 Bacteria 2117
8 Ga0070709_10129536 3300005434 Bacteria 1721
9 Ga0070709_10196944 3300005434 Bacteria 1425
10 Ga0070714_100553591 3300005435 Bacteria 1101
11 Ga0070713_100003244 3300005436 Bacteria 10726
12 Ga0070713_100756544 3300005436 Bacteria 930
13 Ga0070710_10052627 3300005437 Bacteria 2290
14 Ga0070710_10084414 3300005437 Bacteria 1861
15 Ga0070711_100025274 3300005439 Bacteria 3884
16 Ga0070711_100033371 3300005439 Bacteria 3427
17 Ga0070711_100166463 3300005439 Bacteria 1676
18 Ga0070681_10197318 3300005458 Bacteria 1931
19 Ga0070698_100076345 3300005471 Bacteria 3353
20 Ga0070679_100234665 3300005530 Bacteria 1793
21 Ga0070684_100019731 3300005535 Bacteria 5580
22 Ga0070665_100315419 3300005548 Bacteria 1567
23 Ga0068855_100408675 3300005563 Bacteria 1486
24 Ga0068854_100037132 3300005578 Bacteria 3418
25 Ga0068863_100946722 3300005841 Bacteria 863
26 Ga0068862_100153235 3300005844 Bacteria 2052
27 Ga0070717_10139771 3300006028 Bacteria 2088
28 Ga0075363_100050964 3300006048 Bacteria 2206
29 Ga0075363_100193579 3300006048 Bacteria 1160
30 Ga0070716_100286081 3300006173 Bacteria 1140
31 Ga0070712_100075980 3300006175 Bacteria 2418
32 Ga0070712_100101449 3300006175 Bacteria 2129
33 Ga0070712_100177875 3300006175 Bacteria 1656
34 Ga0070712_100331657 3300006175 Bacteria 1240
35 Ga0075370_10091367 3300006353 Bacteria 1756
36 Ga0105245_10549119 3300009098 Bacteria 1177
37 Ga0105238_10637865 3300009551 Bacteria 1075
38 Ga0105239_10240551 3300010375 Bacteria 2032
39 Ga0157373_10197865 3300013100 Bacteria 1417
40 Ga0157370_10020174 3300013104 Bacteria 6662
41 Ga0163162_11100575 3300013306 Bacteria 900
42 Ga0157375_10077790 3300013308 Bacteria 3349
43 Ga0163163_10004563 3300014325 Bacteria 11823
44 Ga0163163_10047011 3300014325 Bacteria 4240
45 Ga0157376_10114097 3300014969 Bacteria 2383
46 Ga0209563_103645 3300025230 Bacteria 3131
47 Ga0207425_1006523 3300025245 Bacteria 3182
48 Ga0209233_1012219 3300025261 Bacteria 2496
49 Ga0209564_1020765 3300025295 Bacteria 2393
50 Ga0209758_1000100 3300025297 Bacteria 227948
51 Ga0209758_1004296 3300025297 Bacteria 12015
52 Ga0209758_1030169 3300025297 Bacteria 2251
53 Ga0209256_1008177 3300025299 Bacteria 4914
54 Ga0207426_1000575 3300025302 Bacteria 49342
55 Ga0207426_1046902 3300025302 Bacteria 1306
56 Ga0209257_1002363 3300025304 Bacteria 18933
57 Ga0207699_10060225 3300025906 Bacteria 2279
58 Ga0207699_10088333 3300025906 Bacteria 1940
59 Ga0207699_10337095 3300025906 Bacteria 1061
60 Ga0207707_10309409 3300025912 Bacteria 1365
61 Ga0207693_10005443 3300025915 Bacteria 10616
62 Ga0207693_10038885 3300025915 Bacteria 3745
63 Ga0207663_10052178 3300025916 Bacteria 2550
64 Ga0207663_10055951 3300025916 Bacteria 2477
65 Ga0207660_10025926 3300025917 Bacteria 3986
66 Ga0207700_10216275 3300025928 Bacteria 1622
67 Ga0207700_10636739 3300025928 Bacteria 950
68 Ga0207665_10032357 3300025939 Bacteria 3462
69 Ga0207679_10171723 3300025945 Bacteria 1786
70 Ga0207679_10304634 3300025945 Bacteria 1375
71 Ga0207639_10249876 3300026041 Bacteria 1546
72 Ga0207678_10053138 3300026067 Bacteria 3492
73 Ga0207648_10062808 3300026089 Bacteria 3238
74 Ga0207675_100481622 3300026118 Bacteria 1233
75 Ga0209179_1003981 3300027512 Bacteria 2189
76 Ga0265337_1001192 3300028556 Bacteria 13219
77 Ga0265338_10396238 3300028800 Bacteria 985
78 Ga0265338_10478389 3300028800 Bacteria 879
79 Ga0265330_10005286 3300031235 Bacteria 6437
80 Ga0265328_10108927 3300031239 Bacteria 1029
81 Ga0265325_10000048 3300031241 Bacteria 82899
82 Ga0265325_10030740 3300031241 Bacteria 2878
83 Ga0265325_10031281 3300031241 Bacteria 2849
84 Ga0265325_10071033 3300031241 Bacteria 1748
85 Ga0265340_10012838 3300031247 Bacteria 4418
86 Ga0265340_10045304 3300031247 Bacteria 2149
87 Ga0265339_10000024 3300031249 Bacteria 169774
88 Ga0265339_10197949 3300031249 Bacteria 992
89 Ga0265316_10555189 3300031344 Bacteria 817
90 Ga0265313_10000006 3300031595 Bacteria 183184
91 Ga0265313_10015920 3300031595 Bacteria 4350
92 Ga0265313_10025947 3300031595 Bacteria 3096
93 Ga0265313_10054018 3300031595 Bacteria 1909
94 Ga0265313_10070781 3300031595 Bacteria 1606
95 Ga0265313_10075238 3300031595 Bacteria 1546
96 Ga0265313_10084229 3300031595 Bacteria 1439
97 Ga0307508_10121142 3300031616 Bacteria 2219
98 Ga0265314_10120793 3300031711 Bacteria 1650
99 Ga0265342_10016554 3300031712 Bacteria 4813
100 Ga0307413_10212067 3300031824 Bacteria 1407
101 Ga0307410_10014981 3300031852 Bacteria 4584
102 Ga0307407_10060716 3300031903 Bacteria 2207
103 Ga0307409_100025548 3300031995 Bacteria 4145
104 Ga0307416_100028147 3300032002 Bacteria 4175
105 Ga0307414_10055644 3300032004 Bacteria 2771
106 Ga0307411_10120274 3300032005 Bacteria 1898
107 Ga0316215_1001414 3300033544 Bacteria 2311
108 Ga0373926_0043947 3300035083 Bacteria 1600
109 Ga0373934_0061755 3300035086 Bacteria 1493
110 Ga0373944_0044396 3300035089 Bacteria 1384
111 Ga0373923_0235593 3300035111 Bacteria 854
112 Ga0373954_0076335 3300035118 Bacteria 1597
113 Ga0373956_0050207 3300035119 Bacteria 1872
114 Ga0373956_0083339 3300035119 Bacteria 1469
115 Ga0373957_0021943 3300035120 Bacteria 2271
116 Ga0373946_0191876 3300035171 Bacteria 974
117 Ga0373955_0001478 3300035172 Bacteria 9990
118 Ga0373955_0057420 3300035172 Bacteria 2138
119 Ga0373924_0001340 3300035410 Bacteria 7932
120 Ga0373935_0024187 3300035692 Bacteria 3737
121 Ga0373927_0024868 3300035695 Bacteria 3914
122 Ga0373927_0164880 3300035695 Unclassified 1452
123 Ga0373933_0001554 3300035724 Bacteria 13446
124 Ga0373933_0002274 3300035724 Bacteria 10955
125 Ga0373933_0018200 3300035724 Bacteria 3948
126 Ga0373933_0093317 3300035724 Bacteria 1860
127 Ga0373947_0004232 3300035725 Bacteria 8417
128 Ga0373947_0011036 3300035725 Bacteria 5185
129 Ga0373937_0000587 3300036401 Bacteria 32310
130 Ga0373937_0011445 3300036401 Bacteria 7786
131 Ga0373937_0014641 3300036401 Bacteria 6926
132 Ga0373937_0024891 3300036401 Bacteria 5402
133 Ga0373937_0040073 3300036401 Bacteria 4270
134 Ga0373925_0030923 3300037068 Bacteria 3932
135 Ga0373925_0513636 3300037068 Unclassified 984
136 Ga0373925_0592629 3300037068 Bacteria 913
137 Ga0395905_0025670 3300037471 Bacteria 5556
138 Ga0395901_0283142 3300038443 Bacteria 1722
139 Ga0436365_0154619 3300039437 Bacteria 10966
140 Ga0466972_0000206 3300044658 Bacteria 42982
141 Ga0466965_0007673 3300044683 Bacteria 4964
142 Ga0466965_0219030 3300044683 Bacteria 1014
143 Ga0466961_0271028 3300044693 Bacteria 1040
144 Ga0466959_0290021 3300045049 Bacteria 1122
145 Ga0495592_0004264 3300046454 Bacteria 10449
146 Ga0495592_0006906 3300046454 Bacteria 8480
147 Ga0495629_0000521 3300046459 Bacteria 32174
148 Ga0495651_0002086 3300046462 Bacteria 15401
149 Ga0495653_0016775 3300046463 Bacteria 5959
150 Ga0495580_0168158 3300046472 Bacteria 1516
151 Ga0495605_0015594 3300046474 Bacteria 4129
152 Ga0495662_0014513 3300046476 Bacteria 3831
153 Ga0495608_0004255 3300046511 Bacteria 10256
154 Ga0495608_0104619 3300046511 Bacteria 1823
155 Ga0495608_0257633 3300046511 Bacteria 1087
156 Ga0495618_0001910 3300046514 Bacteria 13694
157 Ga0495628_0002183 3300046516 Bacteria 17701
158 Ga0495628_0026813 3300046516 Bacteria 4691
159 Ga0495628_0493638 3300046516 Bacteria 885
160 Ga0495652_0002011 3300046529 Bacteria 21650
161 Ga0495652_0038192 3300046529 Bacteria 4161
162 Ga0495640_0009014 3300046533 Bacteria 7788
163 Ga0495640_0017036 3300046533 Bacteria 5423
164 Ga0495587_0000508 3300046536 Bacteria 27152
165 Ga0495587_0044183 3300046536 Bacteria 2651
166 Ga0495587_0049954 3300046536 Bacteria 2475
167 Ga0495645_0007497 3300046543 Bacteria 7593
168 Ga0495645_0077300 3300046543 Bacteria 2394
169 Ga0495622_0034469 3300046557 Bacteria 2361
170 Ga0495667_0001878 3300046559 Bacteria 13933
171 Ga0495667_0063589 3300046559 Bacteria 2415
172 Ga0495667_0066759 3300046559 Bacteria 2351
173 Ga0495634_0002323 3300046642 Bacteria 15914
174 Ga0495611_0070180 3300046648 Bacteria 1601
175 Ga0495625_0109329 3300046660 Bacteria 1891
176 Ga0495635_0015654 3300046663 Bacteria 5297
177 Ga0495635_0018457 3300046663 Bacteria 4868
178 Ga0495635_0099655 3300046663 Bacteria 1986
179 Ga0495635_0333999 3300046663 Bacteria 1013
180 Ga0495588_0038118 3300046674 Bacteria 2444
181 Ga0495588_0064397 3300046674 Bacteria 1902
182 Ga0495657_0058207 3300046675 Bacteria 2567
183 Ga0495657_0146483 3300046675 Bacteria 1469
184 Ga0495657_0313488 3300046675 Bacteria 933
185 Ga0495599_0006099 3300046678 Bacteria 7256
186 Ga0495599_0037979 3300046678 Bacteria 3025
187 Ga0495623_0002691 3300046679 Bacteria 11736
188 Ga0495646_0002468 3300046680 Bacteria 11369
189 Ga0495646_0156932 3300046680 Bacteria 1262
190 Ga0495658_0006171 3300046683 Bacteria 5882
191 Ga0495613_0010450 3300046689 Bacteria 6893
192 Ga0495600_0014156 3300046809 Bacteria 5025
193 Ga0495581_0150212 3300047315 Bacteria 1360
194 Ga0495581_0176217 3300047315 Unclassified 1250
195 Ga0495604_0001924 3300047317 Bacteria 16813
196 Ga0495604_0004764 3300047317 Bacteria 10750
197 Ga0495674_0008420 3300047319 Bacteria 9825
198 Ga0495674_0193529 3300047319 Bacteria 1689
199 Ga0495676_0097804 3300047321 Bacteria 2179
200 Ga0495680_0001904 3300047322 Bacteria 21904
201 Ga0495680_0028868 3300047322 Bacteria 4546
202 Ga0495683_0067292 3300047323 Bacteria 1764
203 Ga0495684_0008917 3300047471 Bacteria 7748
204 Ga0495593_0090438 3300047673 Bacteria 1577
205 Ga0495602_0004715 3300048088 Bacteria 14255
206 Ga0495602_0007856 3300048088 Bacteria 11154
207 Ga0496100_0042989 3300048903 Bacteria 2888
208 Ga0496101_0407951 3300048904 Unclassified 1070
209 Ga0496102_0199299 3300048905 Bacteria 1887
210 Ga0496104_0000196 3300048907 Bacteria 53901
211 Ga0496104_0010964 3300048907 Bacteria 8109
212 Ga0496104_0529414 3300048907 Bacteria 1089
213 Ga0496105_0002093 3300048908 Bacteria 14435
214 Ga0496105_0002162 3300048908 Bacteria 14234
215 Ga0496108_0005096 3300048911 Bacteria 10615
216 Ga0496110_0078111 3300048913 Bacteria 2946
217 Ga0496110_0275378 3300048913 Bacteria 1532
218 Ga0496112_0074357 3300048915 Bacteria 3359
219 Ga0496112_0673104 3300048915 Bacteria 964
220 Ga0496113_0008854 3300048916 Bacteria 6579
221 Ga0496114_0096399 3300048917 Bacteria 2518
222 Ga0496115_0004975 3300048918 Bacteria 9649
223 Ga0496115_0034568 3300048918 Bacteria 3995
224 Ga0496121_0053754 3300048924 Bacteria 3371
225 Ga0496124_0198885 3300048927 Bacteria 1526
226 Ga0496126_0069472 3300048929 Bacteria 3142
227 Ga0501032_0069093 3300049569 Bacteria 2357
228 Ga0501032_0084236 3300049569 Bacteria 2113
229 Ga0501033_0385011 3300049570 Bacteria 979
230 Ga0501034_0001763 3300049571 Bacteria 27682
231 Ga0501034_0091876 3300049571 Bacteria 3032
232 Ga0501034_0101306 3300049571 Bacteria 2873
233 Ga0501034_0153641 3300049571 Bacteria 2277
234 Ga0501034_0180957 3300049571 Bacteria 2073
235 Ga0501034_0222474 3300049571 Bacteria 1839
236 Ga0501034_0391531 3300049571 Bacteria 1313
237 Ga0501034_0510310 3300049571 Bacteria 1115
238 Ga0501036_0113202 3300049572 Bacteria 2293
239 Ga0501036_0131532 3300049572 Bacteria 2112
240 Ga0501036_0310536 3300049572 Bacteria 1318
241 Ga0501036_0505356 3300049572 Bacteria 1006
242 Ga0501036_0507214 3300049572 Bacteria 1003
243 Ga0501037_0033331 3300049573 Bacteria 3804
244 Ga0501037_0112329 3300049573 Bacteria 1962
245 Ga0501037_0292104 3300049573 Bacteria 1133
246 Ga0501038_0119576 3300049574 Bacteria 2174
247 Ga0501038_0186426 3300049574 Bacteria 1672
248 Ga0501038_0204822 3300049574 Bacteria 1581
249 Ga0501038_0531404 3300049574 Bacteria 896
250 Ga0501038_0840723 3300049574 Bacteria 680
251 Ga0501039_0032885 3300049575 Bacteria 4000
252 Ga0501039_0064170 3300049575 Bacteria 2846
253 Ga0501039_0431813 3300049575 Bacteria 1034
254 Ga0501043_0057170 3300049579 Bacteria 3063
255 Ga0501043_0069537 3300049579 Bacteria 2765
256 Ga0501043_0114656 3300049579 Bacteria 2115
257 Ga0501046_0024652 3300049580 Bacteria 4930
258 Ga0501046_0213752 3300049580 Bacteria 1430
259 Ga0501047_0009728 3300049581 Bacteria 9092
260 Ga0501047_0025000 3300049581 Bacteria 5736
261 Ga0501047_0132411 3300049581 Bacteria 2373
262 Ga0501047_0212730 3300049581 Bacteria 1791
263 Ga0501047_0297201 3300049581 Bacteria 1458
264 Ga0501048_0063957 3300049582 Bacteria 2602
265 Ga0501048_0220581 3300049582 Bacteria 1345
266 Ga0501067_0073911 3300049583 Bacteria 1888
267 Ga0501068_0089815 3300049584 Bacteria 1894
268 Ga0501069_0035439 3300049585 Bacteria 2750
269 Ga0501069_0045127 3300049585 Bacteria 2441
270 Ga0501069_0092029 3300049585 Bacteria 1715
271 Ga0501070_0023404 3300049586 Bacteria 5175
272 Ga0501070_0046114 3300049586 Bacteria 3624
273 Ga0501070_0060355 3300049586 Bacteria 3143
274 Ga0501070_0230419 3300049586 Bacteria 1518
275 Ga0501070_0278759 3300049586 Bacteria 1364
276 Ga0501070_0434848 3300049586 Bacteria 1059
277 Ga0501073_0015709 3300049589 Bacteria 5490
278 Ga0501073_0023572 3300049589 Bacteria 4418
279 Ga0501073_0052713 3300049589 Bacteria 2848
280 Ga0501073_0156070 3300049589 Bacteria 1581
281 Ga0501074_0085492 3300049590 Bacteria 2260
282 Ga0501074_0093134 3300049590 Bacteria 2157
283 Ga0501074_0187587 3300049590 Bacteria 1474
284 Ga0501075_0455177 3300049591 Bacteria 976
285 Ga0501259_053791 3300049688 Bacteria 824
286 Ga0501079_0012709 3300049741 Bacteria 6431
287 Ga0501080_0017075 3300049742 Bacteria 6703
288 Ga0501080_0042433 3300049742 Bacteria 4235
289 Ga0501080_0122111 3300049742 Bacteria 2413
290 Ga0501080_0454853 3300049742 Bacteria 1147
291 Ga0501081_0117797 3300049743 Bacteria 1889
292 Ga0501083_0025179 3300049744 Bacteria 4120
293 Ga0501083_0083732 3300049744 Bacteria 2112
294 Ga0501083_0166790 3300049744 Bacteria 1439
295 Ga0501083_0183243 3300049744 Bacteria 1367
296 Ga0501044_0014560 3300049823 Bacteria 8484
297 Ga0501044_0129088 3300049823 Bacteria 2523
298 Ga0501044_0490131 3300049823 Bacteria 1131
299 Ga0501212_006171 3300049851 Bacteria 1609
300 nmdc:mga03n38_153557_c1 3300050490 Bacteria 1160
301 nmdc:mga00v17_118339_c1 3300050491 Bacteria 1685
302 nmdc:mga06z11_124850_c1 3300050494 Bacteria 1439
303 Ga0495601_0000456 3300053077 Bacteria 21456
304 Ga0495601_0005218 3300053077 Bacteria 7557
305 Ga0495601_0016464 3300053077 Bacteria 4480
306 Ga0495601_0032773 3300053077 Bacteria 3235
307 Ga0495612_0000989 3300053078 Bacteria 11684
308 Ga0495612_0142134 3300053078 Bacteria 1041
309 Ga0495595_0000429 3300053084 Bacteria 15919
310 Ga0495595_0002617 3300053084 Bacteria 7056
311 Ga0495595_0009276 3300053084 Bacteria 4064
312 Ga0495595_0063157 3300053084 Bacteria 1738
313 Ga0495619_0000043 3300053085 Bacteria 109865
314 Ga0495619_0000492 3300053085 Bacteria 26472
315 Ga0495619_0000551 3300053085 Bacteria 24828
316 Ga0495619_0047151 3300053085 Bacteria 2836
317 Ga0500566_0004313 3300053094 Bacteria 8483
318 Ga0500636_0019161 3300053177 Bacteria 4050
319 Ga0501084_0196382 3300054114 Bacteria 1702
320 Ga0501084_0264727 3300054114 Bacteria 1451
321 Ga0501084_0535643 3300054114 Bacteria 990
322 Ga0501082_0029322 3300060353 Bacteria 4739
323 Ga0501082_0103827 3300060353 Bacteria 2458
324 Ga0501082_0200316 3300060353 Bacteria 1737
325 Ga0501082_0431360 3300060353 Bacteria 1151
326 Ga0466962_0073108 3300061719 Bacteria 1638
327 2508729951 2508501050 Bacteria 9633614
328 2509074427 2508501114 Bacteria 7082538
329 2528853384 2528768022 Bacteria 10457665
330 2643755915 2643221547 Bacteria 4740017
331 2776264857 2775506901 Bacteria 9631051
332 2824671078 2824661429 Bacteria 9877870
333 2842039983 2842038055 Bacteria 8002051
334 2842047072 2842045827 Bacteria 8006841
335 2857510393 2857509624 Bacteria 7472071
336 2879109490 2879099564 Bacteria 10442239
337 2888394816 2888388044 Bacteria 7304136
338 2922373194
339 2932792010 2932784394 Bacteria 9704911
340 2932814123 2932809354 Bacteria 9135765
341 2932819389 2932818245 Bacteria 9955613
342 2932833900 2932828146 Bacteria 9745859
343 2935618568 2935616580 Bacteria 9032984
344 2935644589 2935638405 Bacteria 10015038
345 2935673520 2935665750 Bacteria 9571747
346 2935678407 2935675223 Bacteria 9928132
347 2935688164 2935684952 Bacteria 9590419
348 2935698830 2935694250 Bacteria 9291695
349 2935708444 2935703347 Bacteria 10242284
350 2935715183 2935713505 Bacteria 9608509
351 2935726252 2935722832 Bacteria 9608746
352 2935734002 2935732158 Bacteria 9706831
353 2935743381 2935741537 Bacteria 9707219
354 2935754581 2935750917 Bacteria 9590372
355 2935765360 2935760218 Bacteria 9817913
356 2935805311 2935801545 Bacteria 9301974
357 2935816609 2935810662 Bacteria 9401221
358 2935833662 2935827899 Bacteria 10038562
359 2935839652 2935837841 Bacteria 9454360
360 2935856933 2935855204 Bacteria 9035059
361 2935871237 2935864058 Bacteria 9784707
362 2935876258 2935873716 Bacteria 9632195
363 2935997779 2935992306 Bacteria 9802711
364 2936007290 2936002035 Bacteria 9362176
365 2936043129 2936037263 Bacteria 9446081
366 2940560042 2940556831 Bacteria 9590747
367 2941540341 2941538514 Bacteria 9402094
368 8002061826 8002060224 Bacteria 4026565
369 8016514529 8016511872 Bacteria 9921665
370 8017061897 8017057580 Bacteria 10023680
371 8019581432 8019576017 Bacteria 10049540
372 8019589059 8019586578 Bacteria 10212056
373 8019602174 8019597564 Bacteria 10041141
374 8019616386 8019608314 Bacteria 10042931
375 8019657269 8019648815 Bacteria 10014479
376 Ga0265339_10036811
377 JGI25153J46596_10007798
378 rootH1_10094216
379 Ga0065165_1000676
380 Ga0065165_1007291
381 Ga0070658_10255354
382 Ga0070668_100118042
383 Ga0070709_10129536
384 Ga0070709_10196944
385 Ga0070714_100553591
386 Ga0070713_100003244
387 Ga0070713_100756544
388 Ga0070710_10052627
389 Ga0070710_10084414
390 Ga0070711_100025274
391 Ga0070711_100033371
392 Ga0070711_100166463
393 Ga0070681_10197318
394 Ga0070698_100076345
395 Ga0070679_100234665
396 Ga0070684_100019731
397 Ga0070665_100315419
398 Ga0068855_100408675
399 Ga0068854_100037132
400 Ga0068863_100946722
401 Ga0068862_100153235
402 Ga0070717_10139771
403 Ga0075363_100050964
404 Ga0075363_100193579
405 Ga0070716_100286081
406 Ga0070712_100075980
407 Ga0070712_100101449
408 Ga0070712_100177875
409 Ga0070712_100331657
410 Ga0075370_10091367
411 Ga0105245_10549119
412 Ga0105238_10637865
413 Ga0105239_10240551
414 Ga0157373_10197865
415 Ga0157370_10020174
416 Ga0163162_11100575
417 Ga0157375_10077790
418 Ga0163163_10004563
419 Ga0163163_10047011
420 Ga0157376_10114097
421 Ga0209563_103645
422 Ga0207425_1006523
423 Ga0209233_1012219
424 Ga0209564_1020765
425 Ga0209758_1000100
426 Ga0209758_1004296
427 Ga0209758_1030169
428 Ga0209256_1008177
429 Ga0207426_1000575
430 Ga0207426_1046902
431 Ga0209257_1002363
432 Ga0207699_10060225
433 Ga0207699_10088333
434 Ga0207699_10337095
435 Ga0207707_10309409
436 Ga0207693_10005443
437 Ga0207693_10038885
438 Ga0207663_10052178
439 Ga0207663_10055951
440 Ga0207660_10025926
441 Ga0207700_10216275
442 Ga0207700_10636739
443 Ga0207665_10032357
444 Ga0207679_10171723
445 Ga0207679_10304634
446 Ga0207639_10249876
447 Ga0207678_10053138
448 Ga0207648_10062808
449 Ga0207675_100481622
450 Ga0209179_1003981
451 Ga0265337_1001192
452 Ga0265338_10396238
453 Ga0265338_10478389
454 Ga0265330_10005286
455 Ga0265328_10108927
456 Ga0265325_10000048
457 Ga0265325_10030740
458 Ga0265325_10031281
459 Ga0265325_10071033
460 Ga0265340_10012838
461 Ga0265340_10045304
462 Ga0265339_10000024
463 Ga0265339_10197949
464 Ga0265316_10555189
465 Ga0265313_10000006
466 Ga0265313_10015920
467 Ga0265313_10025947
468 Ga0265313_10054018
469 Ga0265313_10070781
470 Ga0265313_10075238
471 Ga0265313_10084229
472 Ga0307508_10121142
473 Ga0265314_10120793
474 Ga0265342_10016554
475 Ga0307413_10212067
476 Ga0307410_10014981
477 Ga0307407_10060716
478 Ga0307409_100025548
479 Ga0307416_100028147
480 Ga0307414_10055644
481 Ga0307411_10120274
482 Ga0316215_1001414
483 Ga0373926_0043947
484 Ga0373934_0061755
485 Ga0373944_0044396
486 Ga0373923_0235593
487 Ga0373954_0076335
488 Ga0373956_0050207
489 Ga0373956_0083339
490 Ga0373957_0021943
491 Ga0373946_0191876
492 Ga0373955_0001478
493 Ga0373955_0057420
494 Ga0373924_0001340
495 Ga0373935_0024187
496 Ga0373927_0024868
497 Ga0373927_0164880
498 Ga0373933_0001554
499 Ga0373933_0002274
500 Ga0373933_0018200
501 Ga0373933_0093317
502 Ga0373947_0004232
503 Ga0373947_0011036
504 Ga0373937_0000587
505 Ga0373937_0011445
506 Ga0373937_0014641
507 Ga0373937_0024891
508 Ga0373937_0040073
509 Ga0373925_0030923
510 Ga0373925_0513636
511 Ga0373925_0592629
512 Ga0395905_0025670
513 Ga0395901_0283142
514 Ga0436365_0154619
515 Ga0466972_0000206
516 Ga0466965_0007673
517 Ga0466965_0219030
518 Ga0466961_0271028
519 Ga0466959_0290021
520 Ga0495592_0004264
521 Ga0495592_0006906
522 Ga0495629_0000521
523 Ga0495651_0002086
524 Ga0495653_0016775
525 Ga0495580_0168158
526 Ga0495605_0015594
527 Ga0495662_0014513
528 Ga0495608_0004255
529 Ga0495608_0104619
530 Ga0495608_0257633
531 Ga0495618_0001910
532 Ga0495628_0002183
533 Ga0495628_0026813
534 Ga0495628_0493638
535 Ga0495652_0002011
536 Ga0495652_0038192
537 Ga0495640_0009014
538 Ga0495640_0017036
539 Ga0495587_0000508
540 Ga0495587_0044183
541 Ga0495587_0049954
542 Ga0495645_0007497
543 Ga0495645_0077300
544 Ga0495622_0034469
545 Ga0495667_0001878
546 Ga0495667_0063589
547 Ga0495667_0066759
548 Ga0495634_0002323
549 Ga0495611_0070180
550 Ga0495625_0109329
551 Ga0495635_0015654
552 Ga0495635_0018457
553 Ga0495635_0099655
554 Ga0495635_0333999
555 Ga0495588_0038118
556 Ga0495588_0064397
557 Ga0495657_0058207
558 Ga0495657_0146483
559 Ga0495657_0313488
560 Ga0495599_0006099
561 Ga0495599_0037979
562 Ga0495623_0002691
563 Ga0495646_0002468
564 Ga0495646_0156932
565 Ga0495658_0006171
566 Ga0495613_0010450
567 Ga0495600_0014156
568 Ga0495581_0150212
569 Ga0495581_0176217
570 Ga0495604_0001924
571 Ga0495604_0004764
572 Ga0495674_0008420
573 Ga0495674_0193529
574 Ga0495676_0097804
575 Ga0495680_0001904
576 Ga0495680_0028868
577 Ga0495683_0067292
578 Ga0495684_0008917
579 Ga0495593_0090438
580 Ga0495602_0004715
581 Ga0495602_0007856
582 Ga0496100_0042989
583 Ga0496101_0407951
584 Ga0496102_0199299
585 Ga0496104_0000196
586 Ga0496104_0010964
587 Ga0496104_0529414
588 Ga0496105_0002093
589 Ga0496105_0002162
590 Ga0496108_0005096
591 Ga0496110_0078111
592 Ga0496110_0275378
593 Ga0496112_0074357
594 Ga0496112_0673104
595 Ga0496113_0008854
596 Ga0496114_0096399
597 Ga0496115_0004975
598 Ga0496115_0034568
599 Ga0496121_0053754
600 Ga0496124_0198885
601 Ga0496126_0069472
602 Ga0501032_0069093
603 Ga0501032_0084236
604 Ga0501033_0385011
605 Ga0501034_0001763
606 Ga0501034_0091876
607 Ga0501034_0101306
608 Ga0501034_0153641
609 Ga0501034_0180957
610 Ga0501034_0222474
611 Ga0501034_0391531
612 Ga0501034_0510310
613 Ga0501036_0113202
614 Ga0501036_0131532
615 Ga0501036_0310536
616 Ga0501036_0505356
617 Ga0501036_0507214
618 Ga0501037_0033331
619 Ga0501037_0112329
620 Ga0501037_0292104
621 Ga0501038_0119576
622 Ga0501038_0186426
623 Ga0501038_0204822
624 Ga0501038_0531404
625 Ga0501038_0840723
626 Ga0501039_0032885
627 Ga0501039_0064170
628 Ga0501039_0431813
629 Ga0501043_0057170
630 Ga0501043_0069537
631 Ga0501043_0114656
632 Ga0501046_0024652
633 Ga0501046_0213752
634 Ga0501047_0009728
635 Ga0501047_0025000
636 Ga0501047_0132411
637 Ga0501047_0212730
638 Ga0501047_0297201
639 Ga0501048_0063957
640 Ga0501048_0220581
641 Ga0501067_0073911
642 Ga0501068_0089815
643 Ga0501069_0035439
644 Ga0501069_0045127
645 Ga0501069_0092029
646 Ga0501070_0023404
647 Ga0501070_0046114
648 Ga0501070_0060355
649 Ga0501070_0230419
650 Ga0501070_0278759
651 Ga0501070_0434848
652 Ga0501073_0015709
653 Ga0501073_0023572
654 Ga0501073_0052713
655 Ga0501073_0156070
656 Ga0501074_0085492
657 Ga0501074_0093134
658 Ga0501074_0187587
659 Ga0501075_0455177
660 Ga0501259_053791
661 Ga0501079_0012709
662 Ga0501080_0017075
663 Ga0501080_0042433
664 Ga0501080_0122111
665 Ga0501080_0454853
666 Ga0501081_0117797
667 Ga0501083_0025179
668 Ga0501083_0083732
669 Ga0501083_0166790
670 Ga0501083_0183243
671 Ga0501044_0014560
672 Ga0501044_0129088
673 Ga0501044_0490131
674 Ga0501212_006171
675 nmdc:mga03n38_153557_c1
676 nmdc:mga00v17_118339_c1
677 nmdc:mga06z11_124850_c1
678 Ga0495601_0000456
679 Ga0495601_0005218
680 Ga0495601_0016464
681 Ga0495601_0032773
682 Ga0495612_0000989
683 Ga0495612_0142134
684 Ga0495595_0000429
685 Ga0495595_0002617
686 Ga0495595_0009276
687 Ga0495595_0063157
688 Ga0495619_0000043
689 Ga0495619_0000492
690 Ga0495619_0000551
691 Ga0495619_0047151
692 Ga0500566_0004313
693 Ga0500636_0019161
694 Ga0501084_0196382
695 Ga0501084_0264727
696 Ga0501084_0535643
697 Ga0501082_0029322
698 Ga0501082_0103827
699 Ga0501082_0200316
700 Ga0501082_0431360
701 Ga0466962_0073108
702 2508729951
703 2509074427
704 2528853384
705 2643755915
706 2776264857
707 2824671078
708 2842039983
709 2842047072
710 2857510393
711 2879109490
712 2888394816
713 2922373194
714 2932792010
715 2932814123
716 2932819389
717 2932833900
718 2935618568
719 2935644589
720 2935673520
721 2935678407
722 2935688164
723 2935698830
724 2935708444
725 2935715183
726 2935726252
727 2935734002
728 2935743381
729 2935754581
730 2935765360
731 2935805311
732 2935816609
733 2935833662
734 2935839652
735 2935856933
736 2935871237
737 2935876258
738 2935997779
739 2936007290
740 2936043129
741 2940560042
742 2941540341
743 8002061826
744 8016514529
745 8017061897
746 8019581432
747 8019589059
748 8019602174
749 8019616386
750 8019657269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ln1-assembly1.cif.gz_A-2 structure of ubiquitylated-rpn10 from yeast; 0.8123 51 208
8jtl-assembly1.cif.gz_B structure of oy phytoplasma sap05 binding with atrpn10 0.8035 51 209
1u8c-assembly1.cif.gz_B a novel adaptation of the integrin psi domain revealed from its crystal structure 0.8011 49 220
3n2n-assembly1.cif.gz_B the crystal structure of tumor endothelial marker 8 (tem8) extracellular domain 0.7997 51 196
6om1-assembly1.cif.gz_B crystal structure of an atypical integrin 0.7933 48 217
ID Description Score Start End Superfamily
af_Q54NA9_164_339_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8549 51 203 3.40.50.410
af_Q8T848_192_358_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8444 53 203 3.40.50.410
af_Q04857_817_1023_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8314 51 184 3.40.50.410
af_A0A0R4IHR3_369_544_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.818 53 206 3.40.50.410
af_Q551R4_1689_1843_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8161 51 138 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A433BN19-F1-model_v4 VWA domain-containing protein 0.9952 157 249
AF-A0A560K5Z4-F1-model_v4 VWA domain-containing protein 0.9931 62 249
AF-A0A560K5Z4-F1-model_v4 VWA domain-containing protein 0.9878 62 249
AF-A0A433BN19-F1-model_v4 VWA domain-containing protein 0.9847 157 249
AF-A0A0A0D8E2-F1-model_v4 VWA domain-containing protein 0.9846 49 248

Map