F427065

General Info

Members Datasets Scaffolds Average Seq Length
375 227 750 195

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10190690|Ga0207698_101906901
Length 216
Sequence VVTRSGPAAQGPTLFSTGPAVSVASVAAVEHSLAGAAHETPERDAPVVGVAVAAVIAAIGTNSTWALDFFHVAGGGIWTALDLFLGFVLGPILGRMSIPARIELTKKLMPKLVLIIPVLVTMTLAAGFQLARHNGMLDTSFSRHAWVVASFAVVGVMAVIAIGLLEPANIAVLFELRKPQPNPAVIEKLMRRFIFTAGITGAMQIGTLIIMTRLAS

Samples

Sample ID Description Type Environment
1 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 9.07
Rhizosphere 89.87
Stem 0
Stem Tuber 0
Unclassified 14.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207698_10190690 3300026142 Unclassified 1825
2 Ga0070690_100044514 3300005330 Bacteria 2817
3 Ga0070680_100275522 3300005336 Unclassified 1425
4 Ga0068868_100672468 3300005338 Bacteria 924
5 Ga0070660_100010441 3300005339 Bacteria 6562
6 Ga0070692_10158081 3300005345 Unclassified 1296
7 Ga0070692_10180252 3300005345 Bacteria 1224
8 Ga0070671_100306246 3300005355 Bacteria 1353
9 Ga0070688_100102099 3300005365 Bacteria 1892
10 Ga0070659_100244576 3300005366 Bacteria 1486
11 Ga0070709_10021953 3300005434 Bacteria 3726
12 Ga0070714_100013239 3300005435 Bacteria 6604
13 Ga0070714_100042144 3300005435 Bacteria 3855
14 Ga0070714_100052210 3300005435 Bacteria 3486
15 Ga0070713_100008076 3300005436 Bacteria 7440
16 Ga0070713_100256369 3300005436 Bacteria 1597
17 Ga0070713_100418719 3300005436 Bacteria 1254
18 Ga0070710_10000293 3300005437 Bacteria 23683
19 Ga0070710_10082879 3300005437 Bacteria 1876
20 Ga0070710_10854348 3300005437 Bacteria 654
21 Ga0070711_100000234 3300005439 Bacteria 28702
22 Ga0070711_100017400 3300005439 Bacteria 4576
23 Ga0070700_100035038 3300005441 Bacteria 3034
24 Ga0070700_100448072 3300005441 Bacteria 982
25 Ga0070678_100266149 3300005456 Bacteria 1444
26 Ga0070681_10376249 3300005458 Unclassified 1331
27 Ga0068867_100061842 3300005459 Bacteria 2781
28 Ga0070685_10119673 3300005466 Bacteria 1633
29 Ga0070706_100009933 3300005467 Bacteria 8838
30 Ga0070706_100206786 3300005467 Bacteria 1833
31 Ga0070707_100000099 3300005468 Bacteria 78915
32 Ga0070698_100000221 3300005471 Bacteria 56056
33 Ga0070698_100006449 3300005471 Bacteria 12725
34 Ga0070699_100166555 3300005518 Bacteria 1952
35 Ga0070679_100373315 3300005530 Unclassified 1373
36 Ga0070697_100486616 3300005536 Bacteria 1078
37 Ga0070686_100186354 3300005544 Unclassified 1478
38 Ga0070696_100091281 3300005546 Bacteria 2169
39 Ga0070693_100182838 3300005547 Bacteria 1351
40 Ga0070693_100443114 3300005547 Unclassified 910
41 Ga0070665_100198396 3300005548 Bacteria 2007
42 Ga0070704_100052859 3300005549 Bacteria 2868
43 Ga0068855_100147754 3300005563 Unclassified 2674
44 Ga0068854_100220988 3300005578 Unclassified 1499
45 Ga0068856_100071308 3300005614 Bacteria 3439
46 Ga0068856_100722757 3300005614 Unclassified 1016
47 Ga0070702_100220154 3300005615 Unclassified 1269
48 Ga0068852_100050554 3300005616 Bacteria 3562
49 Ga0068852_100117729 3300005616 Unclassified 2426
50 Ga0068859_100029823 3300005617 Bacteria 5472
51 Ga0068864_100028076 3300005618 Bacteria 4755
52 Ga0068866_10057326 3300005718 Bacteria 2007
53 Ga0068866_10058419 3300005718 Bacteria 1992
54 Ga0068861_100666151 3300005719 Unclassified 963
55 Ga0068863_100537741 3300005841 Bacteria 1153
56 Ga0068858_100078960 3300005842 Bacteria 3058
57 Ga0068858_100487898 3300005842 Bacteria 1190
58 Ga0068860_100153929 3300005843 Bacteria 2215
59 Ga0068862_100681557 3300005844 Bacteria 994
60 Ga0081540_1059285 3300005983 Bacteria 1838
61 Ga0070717_10031099 3300006028 Bacteria 4292
62 Ga0070717_10032716 3300006028 Bacteria 4192
63 Ga0070717_10048031 3300006028 Bacteria 3499
64 Ga0070717_10075726 3300006028 Bacteria 2815
65 Ga0070717_10253728 3300006028 Bacteria 1554
66 Ga0075363_100239480 3300006048 Bacteria 1043
67 Ga0070715_10083176 3300006163 Bacteria 1457
68 Ga0070715_10199229 3300006163 Bacteria 1016
69 Ga0070716_100017497 3300006173 Bacteria 3717
70 Ga0070716_100044141 3300006173 Bacteria 2496
71 Ga0070712_100001525 3300006175 Bacteria 14137
72 Ga0070712_100007850 3300006175 Bacteria 6685
73 Ga0075433_10295848 3300006852 Bacteria 1434
74 Ga0068865_100065242 3300006881 Bacteria 2564
75 Ga0068865_100311156 3300006881 Unclassified 1264
76 Ga0097620_100029823 3300006931 Bacteria 5472
77 Ga0105240_10008771 3300009093 Bacteria 14406
78 Ga0105245_10277151 3300009098 Unclassified 1638
79 Ga0105247_10005864 3300009101 Bacteria 7676
80 Ga0105243_10101714 3300009148 Bacteria 2386
81 Ga0105242_10344531 3300009176 Unclassified 1374
82 Ga0105249_10133545 3300009553 Bacteria 2372
83 Ga0105239_11344232 3300010375 Bacteria 824
84 Ga0105246_10043306 3300011119 Bacteria 3054
85 Ga0157370_10025248 3300013104 Bacteria 5882
86 Ga0157370_10435418 3300013104 Bacteria 1206
87 Ga0157369_10026902 3300013105 Bacteria 6379
88 Ga0157369_10030959 3300013105 Bacteria 5897
89 Ga0157369_10259023 3300013105 Unclassified 1814
90 Ga0157369_10912593 3300013105 Bacteria 901
91 Ga0157378_10425475 3300013297 Bacteria 1313
92 Ga0157378_11116606 3300013297 Archaea 826
93 Ga0163162_10709414 3300013306 Unclassified 1127
94 Ga0157372_10112579 3300013307 Unclassified 3118
95 Ga0157372_11107404 3300013307 Unclassified 916
96 Ga0157375_10071799 3300013308 Bacteria 3476
97 Ga0157375_10973066 3300013308 Bacteria 989
98 Ga0163163_10160801 3300014325 Bacteria 2291
99 Ga0182008_10404241 3300014497 Unclassified 734
100 Ga0157377_10226924 3300014745 Bacteria 1199
101 Ga0157376_10233322 3300014969 Bacteria 1710
102 Ga0207692_10000305 3300025898 Bacteria 16951
103 Ga0207692_10259553 3300025898 Bacteria 1044
104 Ga0207642_10143575 3300025899 Bacteria 1261
105 Ga0207688_10082209 3300025901 Bacteria 1840
106 Ga0207685_10052466 3300025905 Bacteria 1580
107 Ga0207685_10160372 3300025905 Bacteria 1026
108 Ga0207699_10002769 3300025906 Bacteria 8285
109 Ga0207699_10036664 3300025906 Bacteria 2797
110 Ga0207684_10004283 3300025910 Bacteria 13521
111 Ga0207684_10007882 3300025910 Bacteria 9525
112 Ga0207684_10144128 3300025910 Bacteria 2049
113 Ga0207684_10181839 3300025910 Bacteria 1813
114 Ga0207695_10183140 3300025913 Unclassified 2015
115 Ga0207693_10121800 3300025915 Bacteria 2049
116 Ga0207663_10017785 3300025916 Bacteria 3969
117 Ga0207663_10660422 3300025916 Unclassified 826
118 Ga0207657_10011951 3300025919 Bacteria 8591
119 Ga0207649_10213761 3300025920 Unclassified 1369
120 Ga0207649_10569125 3300025920 Unclassified 869
121 Ga0207652_10312265 3300025921 Unclassified 1419
122 Ga0207646_10000215 3300025922 Bacteria 78875
123 Ga0207700_10020175 3300025928 Bacteria 4519
124 Ga0207664_10100075 3300025929 Bacteria 2393
125 Ga0207664_10164352 3300025929 Bacteria 1895
126 Ga0207664_10618998 3300025929 Bacteria 973
127 Ga0207664_10637770 3300025929 Bacteria 957
128 Ga0207644_10189096 3300025931 Bacteria 1618
129 Ga0207690_10173064 3300025932 Bacteria 1619
130 Ga0207686_10273859 3300025934 Unclassified 1243
131 Ga0207709_10010833 3300025935 Bacteria 5022
132 Ga0207709_10249426 3300025935 Unclassified 1296
133 Ga0207665_10001104 3300025939 Bacteria 18146
134 Ga0207665_10001724 3300025939 Bacteria 14703
135 Ga0207711_10252549 3300025941 Bacteria 1619
136 Ga0207689_10492629 3300025942 Bacteria 1026
137 Ga0207640_10177379 3300025981 Bacteria 1594
138 Ga0207677_10563984 3300026023 Bacteria 994
139 Ga0207703_10356399 3300026035 Bacteria 1348
140 Ga0207678_10207031 3300026067 Bacteria 1678
141 Ga0207708_10634788 3300026075 Unclassified 908
142 Ga0207702_10685322 3300026078 Unclassified 1009
143 Ga0207702_10693824 3300026078 Unclassified 1003
144 Ga0207641_10611129 3300026088 Bacteria 1068
145 Ga0207648_10073314 3300026089 Bacteria 2984
146 Ga0207648_10172819 3300026089 Bacteria 1910
147 Ga0207676_10609801 3300026095 Unclassified 1049
148 Ga0207675_100024224 3300026118 Bacteria 5644
149 Ga0207675_100432807 3300026118 Bacteria 1301
150 Ga0207683_10063418 3300026121 Bacteria 3255
151 Ga0207698_10090419 3300026142 Bacteria 2503
152 Ga0268264_10056930 3300028381 Bacteria 3268
153 Ga0268264_10125291 3300028381 Bacteria 2269
154 Ga0265326_10036098 3300028558 Bacteria 1405
155 Ga0265326_10112949 3300028558 Bacteria 772
156 Ga0265319_1009263 3300028563 Bacteria 4214
157 Ga0265319_1025978 3300028563 Bacteria 2090
158 Ga0265334_10047733 3300028573 Bacteria 1650
159 Ga0265318_10012343 3300028577 Bacteria 3642
160 Ga0265318_10014514 3300028577 Bacteria 3306
161 Ga0265336_10015246 3300028666 Bacteria 2531
162 Ga0265338_10014383 3300028800 Bacteria 8808
163 Ga0265338_10024712 3300028800 Bacteria 6129
164 Ga0265324_10026813 3300029957 Unclassified 2038
165 Ga0265330_10009461 3300031235 Bacteria 4628
166 Ga0265332_10008130 3300031238 Bacteria 4716
167 Ga0265328_10005664 3300031239 Bacteria 5337
168 Ga0265320_10023069 3300031240 Bacteria 3319
169 Ga0265320_10052513 3300031240 Bacteria 1973
170 Ga0265320_10070225 3300031240 Bacteria 1652
171 Ga0265325_10022701 3300031241 Bacteria 3433
172 Ga0265329_10007527 3300031242 Bacteria 4203
173 Ga0265340_10009216 3300031247 Bacteria 5302
174 Ga0265339_10014748 3300031249 Bacteria 4703
175 Ga0265331_10018483 3300031250 Unclassified 3613
176 Ga0265327_10016155 3300031251 Bacteria 4765
177 Ga0265316_10003729 3300031344 Bacteria 15319
178 Ga0265313_10022378 3300031595 Bacteria 3430
179 Ga0265342_10027110 3300031712 Unclassified 3585
180 Ga0307406_10689789 3300031901 Bacteria 852
181 Ga0307415_100485828 3300032126 Bacteria 1076
182 Ga0373934_0032085 3300035086 Bacteria 2059
183 Ga0373944_0077576 3300035089 Bacteria 1092
184 Ga0373923_0070621 3300035111 Bacteria 1499
185 Ga0373954_0024793 3300035118 Bacteria 2737
186 Ga0373957_0163364 3300035120 Bacteria 918
187 Ga0373943_0013832 3300035170 Bacteria 3649
188 Ga0373955_0029553 3300035172 Bacteria 2851
189 Ga0373924_0175835 3300035410 Bacteria 941
190 Ga0373933_0030119 3300035724 Bacteria 3141
191 Ga0373933_0245400 3300035724 Bacteria 1152
192 Ga0373937_0580700 3300036401 Bacteria 1064
193 Ga0373937_0828408 3300036401 Bacteria 873
194 Ga0395898_0036422 3300037466 Bacteria 4885
195 Ga0395905_0512604 3300037471 Bacteria 1100
196 Ga0436364_0762706 3300037853 Bacteria 2951
197 Ga0436364_1535400 3300037853 Bacteria 3168
198 Ga0395901_0109792 3300038443 Bacteria 2896
199 Ga0436360_0448584 3300039438 Unclassified 2763
200 Ga0436360_0757733 3300039438 Bacteria 869
201 Ga0436362_0955212 3300039453 Bacteria 6266
202 Ga0436362_1097159 3300039453 Bacteria 1069
203 Ga0451577_0889851 3300042876 Unclassified 802
204 Ga0466972_0028871 3300044658 Bacteria 2733
205 Ga0466965_0029983 3300044683 Bacteria 2649
206 Ga0466966_0030243 3300044684 Bacteria 3517
207 Ga0466966_0032493 3300044684 Bacteria 3382
208 Ga0466966_0055927 3300044684 Bacteria 2497
209 Ga0466966_0573913 3300044684 Unclassified 679
210 Ga0466961_0068871 3300044693 Bacteria 2247
211 Ga0466961_0084567 3300044693 Bacteria 2006
212 Ga0466961_0149141 3300044693 Bacteria 1461
213 Ga0466961_0150157 3300044693 Bacteria 1455
214 Ga0466963_0020987 3300044694 Bacteria 4115
215 Ga0466963_0089420 3300044694 Bacteria 2095
216 Ga0466963_0090970 3300044694 Bacteria 2078
217 Ga0466963_0109227 3300044694 Bacteria 1897
218 Ga0466963_0163531 3300044694 Bacteria 1550
219 Ga0466964_0034404 3300044706 Bacteria 2022
220 Ga0466964_0113352 3300044706 Unclassified 1212
221 Ga0466964_0115231 3300044706 Bacteria 1204
222 Ga0466964_0134959 3300044706 Bacteria 1128
223 Ga0466971_0021803 3300044719 Bacteria 2851
224 Ga0466968_0146132 3300044735 Bacteria 1084
225 Ga0466968_0198106 3300044735 Bacteria 940
226 Ga0466970_0087249 3300044765 Bacteria 1692
227 Ga0466970_0291160 3300044765 Bacteria 920
228 Ga0466957_0003413 3300044842 Bacteria 8723
229 Ga0466957_0129316 3300044842 Bacteria 1616
230 Ga0466957_0201966 3300044842 Bacteria 1306
231 Ga0466957_0358970 3300044842 Unclassified 990
232 Ga0466960_0044882 3300044901 Bacteria 2109
233 Ga0466960_0132261 3300044901 Bacteria 1318
234 Ga0466960_0295087 3300044901 Bacteria 912
235 Ga0466960_0307384 3300044901 Bacteria 895
236 Ga0466960_0454465 3300044901 Bacteria 745
237 Ga0466959_0012253 3300045049 Bacteria 6188
238 Ga0466959_0047183 3300045049 Bacteria 3169
239 Ga0466959_0178318 3300045049 Bacteria 1487
240 Ga0466958_0016806 3300045836 Bacteria 4220
241 Ga0466958_0090131 3300045836 Bacteria 1897
242 Ga0466958_0099689 3300045836 Bacteria 1805
243 Ga0466958_0107826 3300045836 Bacteria 1737
244 Ga0466958_0141737 3300045836 Bacteria 1513
245 Ga0466958_0184460 3300045836 Bacteria 1325
246 Ga0466958_0218524 3300045836 Bacteria 1215
247 Ga0466967_0000073 3300045976 Bacteria 37163
248 Ga0466967_0000821 3300045976 Bacteria 16321
249 Ga0466967_0052736 3300045976 Bacteria 3572
250 Ga0466967_0068789 3300045976 Bacteria 3163
251 Ga0466967_0069704 3300045976 Bacteria 3143
252 Ga0466967_0126871 3300045976 Bacteria 2364
253 Ga0466967_0136351 3300045976 Bacteria 2282
254 Ga0466967_0154262 3300045976 Bacteria 2150
255 Ga0466967_0250363 3300045976 Bacteria 1692
256 Ga0466967_0355857 3300045976 Bacteria 1418
257 Ga0466967_0592036 3300045976 Unclassified 1094
258 Ga0466967_0655678 3300045976 Bacteria 1038
259 Ga0466967_0834799 3300045976 Bacteria 915
260 Ga0466967_1259727 3300045976 Bacteria 737
261 Ga0495603_0026817 3300046455 Bacteria 3480
262 Ga0495641_0143535 3300046461 Bacteria 1067
263 Ga0495653_0010545 3300046463 Bacteria 7566
264 Ga0495608_0070850 3300046511 Bacteria 2275
265 Ga0495618_0020531 3300046514 Bacteria 4066
266 Ga0495618_0314602 3300046514 Bacteria 971
267 Ga0495628_0089889 3300046516 Bacteria 2377
268 Ga0495630_0198952 3300046517 Bacteria 1529
269 Ga0495637_0180138 3300046520 Unclassified 784
270 Ga0495652_0038455 3300046529 Bacteria 4145
271 Ga0495652_0221391 3300046529 Bacteria 1422
272 Ga0495640_0016531 3300046533 Bacteria 5517
273 Ga0495586_0060738 3300046535 Bacteria 2056
274 Ga0495587_0035652 3300046536 Bacteria 2996
275 Ga0495634_0264497 3300046642 Bacteria 1048
276 Ga0495635_0096149 3300046663 Bacteria 2024
277 Ga0495599_0057655 3300046678 Bacteria 2430
278 Ga0495646_0290059 3300046680 Bacteria 867
279 Ga0495647_0188880 3300046681 Bacteria 899
280 Ga0495613_0321100 3300046689 Bacteria 1069
281 Ga0495624_0306680 3300046690 Bacteria 957
282 Ga0495624_0357026 3300046690 Unclassified 879
283 Ga0495600_0168066 3300046809 Bacteria 1416
284 Ga0495604_0370635 3300047317 Unclassified 948
285 Ga0495674_0228340 3300047319 Bacteria 1537
286 Ga0495676_0149027 3300047321 Bacteria 1668
287 Ga0495680_0056968 3300047322 Bacteria 3024
288 Ga0495684_0010735 3300047471 Bacteria 7081
289 Ga0495602_0043999 3300048088 Bacteria 4053
290 Ga0495602_0524981 3300048088 Bacteria 824
291 Ga0496100_0738310 3300048903 Bacteria 769
292 Ga0496101_0085159 3300048904 Unclassified 2342
293 Ga0496101_0452151 3300048904 Bacteria 1013
294 Ga0496102_0097808 3300048905 Bacteria 2722
295 Ga0496102_0799770 3300048905 Unclassified 865
296 Ga0496103_0162156 3300048906 Bacteria 1434
297 Ga0496104_0091967 3300048907 Unclassified 2900
298 Ga0496105_0048686 3300048908 Bacteria 3499
299 Ga0496105_0141128 3300048908 Bacteria 1983
300 Ga0496105_0284639 3300048908 Bacteria 1332
301 Ga0496106_0015607 3300048909 Bacteria 5617
302 Ga0496106_0062314 3300048909 Bacteria 2831
303 Ga0496107_0304048 3300048910 Bacteria 1187
304 Ga0496108_0016587 3300048911 Bacteria 6013
305 Ga0496108_0019593 3300048911 Bacteria 5557
306 Ga0496108_0061109 3300048911 Bacteria 3170
307 Ga0496108_0449359 3300048911 Unclassified 1126
308 Ga0496109_0010909 3300048912 Bacteria 7783
309 Ga0496109_0032705 3300048912 Bacteria 4677
310 Ga0496109_0383577 3300048912 Bacteria 1327
311 Ga0496110_0009399 3300048913 Bacteria 7915
312 Ga0496110_1203303 3300048913 Unclassified 666
313 Ga0496111_0002153 3300048914 Bacteria 11784
314 Ga0496112_0119511 3300048915 Bacteria 2605
315 Ga0496112_0134310 3300048915 Unclassified 2445
316 Ga0496112_0212162 3300048915 Unclassified 1893
317 Ga0496112_0257350 3300048915 Bacteria 1696
318 Ga0496112_0745910 3300048915 Bacteria 905
319 Ga0496113_0011278 3300048916 Bacteria 5953
320 Ga0496113_0127339 3300048916 Bacteria 1995
321 Ga0496113_0219200 3300048916 Bacteria 1516
322 Ga0496113_0311311 3300048916 Bacteria 1261
323 Ga0496114_0063986 3300048917 Bacteria 3080
324 Ga0496114_0193976 3300048917 Unclassified 1778
325 Ga0496126_0007744 3300048929 Bacteria 11710
326 Ga0501031_0127933 3300049568 Unclassified 1659
327 Ga0501033_0029183 3300049570 Bacteria 4145
328 Ga0501034_0025608 3300049571 Bacteria 6007
329 Ga0501034_0088112 3300049571 Bacteria 3102
330 Ga0501036_0005049 3300049572 Bacteria 10682
331 Ga0501037_0047251 3300049573 Bacteria 3155
332 Ga0501038_0007848 3300049574 Bacteria 9835
333 Ga0501039_0094584 3300049575 Bacteria 2329
334 Ga0501042_0108342 3300049578 Bacteria 2000
335 Ga0501046_0002231 3300049580 Bacteria 18278
336 Ga0501047_0048290 3300049581 Bacteria 4110
337 Ga0501047_0067143 3300049581 Bacteria 3456
338 Ga0501047_0067536 3300049581 Bacteria 3445
339 Ga0501047_0115951 3300049581 Bacteria 2560
340 Ga0501067_0005223 3300049583 Bacteria 7219
341 Ga0501067_0006852 3300049583 Bacteria 6322
342 Ga0501067_0085106 3300049583 Bacteria 1754
343 Ga0501068_0067093 3300049584 Bacteria 2185
344 Ga0501068_0233015 3300049584 Bacteria 1171
345 Ga0501069_0004476 3300049585 Bacteria 7217
346 Ga0501069_0012438 3300049585 Bacteria 4524
347 Ga0501069_0014988 3300049585 Bacteria 4152
348 Ga0501069_0065523 3300049585 Bacteria 2031
349 Ga0501069_0190235 3300049585 Bacteria 1187
350 Ga0501070_0104937 3300049586 Bacteria 2336
351 Ga0501070_0193985 3300049586 Bacteria 1669
352 Ga0501070_0391380 3300049586 Bacteria 1125
353 Ga0501071_0045379 3300049587 Bacteria 3155
354 Ga0501073_0016339 3300049589 Bacteria 5379
355 Ga0501074_0016994 3300049590 Bacteria 5277
356 Ga0501074_0020465 3300049590 Bacteria 4808
357 Ga0501074_0184983 3300049590 Bacteria 1486
358 Ga0501080_0092171 3300049742 Bacteria 2814
359 Ga0501080_0243092 3300049742 Bacteria 1642
360 Ga0501080_0409569 3300049742 Bacteria 1219
361 Ga0501083_0012525 3300049744 Bacteria 5933
362 Ga0501035_0089708 3300049822 Bacteria 2707
363 Ga0501035_0274028 3300049822 Bacteria 1427
364 Ga0501044_0212643 3300049823 Bacteria 1887
365 Ga0501044_0306468 3300049823 Unclassified 1515
366 Ga0495601_0629204 3300053077 Bacteria 687
367 Ga0495595_0133165 3300053084 Bacteria 1217
368 Ga0495619_0138647 3300053085 Bacteria 1674
369 Ga0501084_0074066 3300054114 Bacteria 2851
370 Ga0501084_0123544 3300054114 Bacteria 2177
371 Ga0501082_0012595 3300060353 Bacteria 7269
372 Ga0466962_0010154 3300061719 Bacteria 4522
373 Ga0466962_0099705 3300061719 Bacteria 1395
374 Ga0466962_0187992 3300061719 Bacteria 1007
375 Ga0530510_0047150 3300061734 Bacteria 3113
376 Ga0207698_10190690
377 Ga0070690_100044514
378 Ga0070680_100275522
379 Ga0068868_100672468
380 Ga0070660_100010441
381 Ga0070692_10158081
382 Ga0070692_10180252
383 Ga0070671_100306246
384 Ga0070688_100102099
385 Ga0070659_100244576
386 Ga0070709_10021953
387 Ga0070714_100013239
388 Ga0070714_100042144
389 Ga0070714_100052210
390 Ga0070713_100008076
391 Ga0070713_100256369
392 Ga0070713_100418719
393 Ga0070710_10000293
394 Ga0070710_10082879
395 Ga0070710_10854348
396 Ga0070711_100000234
397 Ga0070711_100017400
398 Ga0070700_100035038
399 Ga0070700_100448072
400 Ga0070678_100266149
401 Ga0070681_10376249
402 Ga0068867_100061842
403 Ga0070685_10119673
404 Ga0070706_100009933
405 Ga0070706_100206786
406 Ga0070707_100000099
407 Ga0070698_100000221
408 Ga0070698_100006449
409 Ga0070699_100166555
410 Ga0070679_100373315
411 Ga0070697_100486616
412 Ga0070686_100186354
413 Ga0070696_100091281
414 Ga0070693_100182838
415 Ga0070693_100443114
416 Ga0070665_100198396
417 Ga0070704_100052859
418 Ga0068855_100147754
419 Ga0068854_100220988
420 Ga0068856_100071308
421 Ga0068856_100722757
422 Ga0070702_100220154
423 Ga0068852_100050554
424 Ga0068852_100117729
425 Ga0068859_100029823
426 Ga0068864_100028076
427 Ga0068866_10057326
428 Ga0068866_10058419
429 Ga0068861_100666151
430 Ga0068863_100537741
431 Ga0068858_100078960
432 Ga0068858_100487898
433 Ga0068860_100153929
434 Ga0068862_100681557
435 Ga0081540_1059285
436 Ga0070717_10031099
437 Ga0070717_10032716
438 Ga0070717_10048031
439 Ga0070717_10075726
440 Ga0070717_10253728
441 Ga0075363_100239480
442 Ga0070715_10083176
443 Ga0070715_10199229
444 Ga0070716_100017497
445 Ga0070716_100044141
446 Ga0070712_100001525
447 Ga0070712_100007850
448 Ga0075433_10295848
449 Ga0068865_100065242
450 Ga0068865_100311156
451 Ga0097620_100029823
452 Ga0105240_10008771
453 Ga0105245_10277151
454 Ga0105247_10005864
455 Ga0105243_10101714
456 Ga0105242_10344531
457 Ga0105249_10133545
458 Ga0105239_11344232
459 Ga0105246_10043306
460 Ga0157370_10025248
461 Ga0157370_10435418
462 Ga0157369_10026902
463 Ga0157369_10030959
464 Ga0157369_10259023
465 Ga0157369_10912593
466 Ga0157378_10425475
467 Ga0157378_11116606
468 Ga0163162_10709414
469 Ga0157372_10112579
470 Ga0157372_11107404
471 Ga0157375_10071799
472 Ga0157375_10973066
473 Ga0163163_10160801
474 Ga0182008_10404241
475 Ga0157377_10226924
476 Ga0157376_10233322
477 Ga0207692_10000305
478 Ga0207692_10259553
479 Ga0207642_10143575
480 Ga0207688_10082209
481 Ga0207685_10052466
482 Ga0207685_10160372
483 Ga0207699_10002769
484 Ga0207699_10036664
485 Ga0207684_10004283
486 Ga0207684_10007882
487 Ga0207684_10144128
488 Ga0207684_10181839
489 Ga0207695_10183140
490 Ga0207693_10121800
491 Ga0207663_10017785
492 Ga0207663_10660422
493 Ga0207657_10011951
494 Ga0207649_10213761
495 Ga0207649_10569125
496 Ga0207652_10312265
497 Ga0207646_10000215
498 Ga0207700_10020175
499 Ga0207664_10100075
500 Ga0207664_10164352
501 Ga0207664_10618998
502 Ga0207664_10637770
503 Ga0207644_10189096
504 Ga0207690_10173064
505 Ga0207686_10273859
506 Ga0207709_10010833
507 Ga0207709_10249426
508 Ga0207665_10001104
509 Ga0207665_10001724
510 Ga0207711_10252549
511 Ga0207689_10492629
512 Ga0207640_10177379
513 Ga0207677_10563984
514 Ga0207703_10356399
515 Ga0207678_10207031
516 Ga0207708_10634788
517 Ga0207702_10685322
518 Ga0207702_10693824
519 Ga0207641_10611129
520 Ga0207648_10073314
521 Ga0207648_10172819
522 Ga0207676_10609801
523 Ga0207675_100024224
524 Ga0207675_100432807
525 Ga0207683_10063418
526 Ga0207698_10090419
527 Ga0268264_10056930
528 Ga0268264_10125291
529 Ga0265326_10036098
530 Ga0265326_10112949
531 Ga0265319_1009263
532 Ga0265319_1025978
533 Ga0265334_10047733
534 Ga0265318_10012343
535 Ga0265318_10014514
536 Ga0265336_10015246
537 Ga0265338_10014383
538 Ga0265338_10024712
539 Ga0265324_10026813
540 Ga0265330_10009461
541 Ga0265332_10008130
542 Ga0265328_10005664
543 Ga0265320_10023069
544 Ga0265320_10052513
545 Ga0265320_10070225
546 Ga0265325_10022701
547 Ga0265329_10007527
548 Ga0265340_10009216
549 Ga0265339_10014748
550 Ga0265331_10018483
551 Ga0265327_10016155
552 Ga0265316_10003729
553 Ga0265313_10022378
554 Ga0265342_10027110
555 Ga0307406_10689789
556 Ga0307415_100485828
557 Ga0373934_0032085
558 Ga0373944_0077576
559 Ga0373923_0070621
560 Ga0373954_0024793
561 Ga0373957_0163364
562 Ga0373943_0013832
563 Ga0373955_0029553
564 Ga0373924_0175835
565 Ga0373933_0030119
566 Ga0373933_0245400
567 Ga0373937_0580700
568 Ga0373937_0828408
569 Ga0395898_0036422
570 Ga0395905_0512604
571 Ga0436364_0762706
572 Ga0436364_1535400
573 Ga0395901_0109792
574 Ga0436360_0448584
575 Ga0436360_0757733
576 Ga0436362_0955212
577 Ga0436362_1097159
578 Ga0451577_0889851
579 Ga0466972_0028871
580 Ga0466965_0029983
581 Ga0466966_0030243
582 Ga0466966_0032493
583 Ga0466966_0055927
584 Ga0466966_0573913
585 Ga0466961_0068871
586 Ga0466961_0084567
587 Ga0466961_0149141
588 Ga0466961_0150157
589 Ga0466963_0020987
590 Ga0466963_0089420
591 Ga0466963_0090970
592 Ga0466963_0109227
593 Ga0466963_0163531
594 Ga0466964_0034404
595 Ga0466964_0113352
596 Ga0466964_0115231
597 Ga0466964_0134959
598 Ga0466971_0021803
599 Ga0466968_0146132
600 Ga0466968_0198106
601 Ga0466970_0087249
602 Ga0466970_0291160
603 Ga0466957_0003413
604 Ga0466957_0129316
605 Ga0466957_0201966
606 Ga0466957_0358970
607 Ga0466960_0044882
608 Ga0466960_0132261
609 Ga0466960_0295087
610 Ga0466960_0307384
611 Ga0466960_0454465
612 Ga0466959_0012253
613 Ga0466959_0047183
614 Ga0466959_0178318
615 Ga0466958_0016806
616 Ga0466958_0090131
617 Ga0466958_0099689
618 Ga0466958_0107826
619 Ga0466958_0141737
620 Ga0466958_0184460
621 Ga0466958_0218524
622 Ga0466967_0000073
623 Ga0466967_0000821
624 Ga0466967_0052736
625 Ga0466967_0068789
626 Ga0466967_0069704
627 Ga0466967_0126871
628 Ga0466967_0136351
629 Ga0466967_0154262
630 Ga0466967_0250363
631 Ga0466967_0355857
632 Ga0466967_0592036
633 Ga0466967_0655678
634 Ga0466967_0834799
635 Ga0466967_1259727
636 Ga0495603_0026817
637 Ga0495641_0143535
638 Ga0495653_0010545
639 Ga0495608_0070850
640 Ga0495618_0020531
641 Ga0495618_0314602
642 Ga0495628_0089889
643 Ga0495630_0198952
644 Ga0495637_0180138
645 Ga0495652_0038455
646 Ga0495652_0221391
647 Ga0495640_0016531
648 Ga0495586_0060738
649 Ga0495587_0035652
650 Ga0495634_0264497
651 Ga0495635_0096149
652 Ga0495599_0057655
653 Ga0495646_0290059
654 Ga0495647_0188880
655 Ga0495613_0321100
656 Ga0495624_0306680
657 Ga0495624_0357026
658 Ga0495600_0168066
659 Ga0495604_0370635
660 Ga0495674_0228340
661 Ga0495676_0149027
662 Ga0495680_0056968
663 Ga0495684_0010735
664 Ga0495602_0043999
665 Ga0495602_0524981
666 Ga0496100_0738310
667 Ga0496101_0085159
668 Ga0496101_0452151
669 Ga0496102_0097808
670 Ga0496102_0799770
671 Ga0496103_0162156
672 Ga0496104_0091967
673 Ga0496105_0048686
674 Ga0496105_0141128
675 Ga0496105_0284639
676 Ga0496106_0015607
677 Ga0496106_0062314
678 Ga0496107_0304048
679 Ga0496108_0016587
680 Ga0496108_0019593
681 Ga0496108_0061109
682 Ga0496108_0449359
683 Ga0496109_0010909
684 Ga0496109_0032705
685 Ga0496109_0383577
686 Ga0496110_0009399
687 Ga0496110_1203303
688 Ga0496111_0002153
689 Ga0496112_0119511
690 Ga0496112_0134310
691 Ga0496112_0212162
692 Ga0496112_0257350
693 Ga0496112_0745910
694 Ga0496113_0011278
695 Ga0496113_0127339
696 Ga0496113_0219200
697 Ga0496113_0311311
698 Ga0496114_0063986
699 Ga0496114_0193976
700 Ga0496126_0007744
701 Ga0501031_0127933
702 Ga0501033_0029183
703 Ga0501034_0025608
704 Ga0501034_0088112
705 Ga0501036_0005049
706 Ga0501037_0047251
707 Ga0501038_0007848
708 Ga0501039_0094584
709 Ga0501042_0108342
710 Ga0501046_0002231
711 Ga0501047_0048290
712 Ga0501047_0067143
713 Ga0501047_0067536
714 Ga0501047_0115951
715 Ga0501067_0005223
716 Ga0501067_0006852
717 Ga0501067_0085106
718 Ga0501068_0067093
719 Ga0501068_0233015
720 Ga0501069_0004476
721 Ga0501069_0012438
722 Ga0501069_0014988
723 Ga0501069_0065523
724 Ga0501069_0190235
725 Ga0501070_0104937
726 Ga0501070_0193985
727 Ga0501070_0391380
728 Ga0501071_0045379
729 Ga0501073_0016339
730 Ga0501074_0016994
731 Ga0501074_0020465
732 Ga0501074_0184983
733 Ga0501080_0092171
734 Ga0501080_0243092
735 Ga0501080_0409569
736 Ga0501083_0012525
737 Ga0501035_0089708
738 Ga0501035_0274028
739 Ga0501044_0212643
740 Ga0501044_0306468
741 Ga0495601_0629204
742 Ga0495595_0133165
743 Ga0495619_0138647
744 Ga0501084_0074066
745 Ga0501084_0123544
746 Ga0501082_0012595
747 Ga0466962_0010154
748 Ga0466962_0099705
749 Ga0466962_0187992
750 Ga0530510_0047150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ap3-assembly1.cif.gz_A 1.6 a crystal structure of a conserved protein of unknown function from staphylococcus aureus 0.5765 32 200
8ejc-assembly1.cif.gz_R structure of ffar1-gq complex bound to tak-875 0.5586 83 188
1k40-assembly1.cif.gz_A crystal structure of the fat domain of focal adhesion kinase 0.5462 62 197
1ow8-assembly1.cif.gz_A paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase 0.5422 82 197
7xxh-assembly1.cif.gz_R cryo-em structure of the purinergic receptor p2y1r in complex with 2mesadp and g11 0.529 79 195
ID Description Score Start End Superfamily
af_Q7YXB0_4_304_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6678 93 188 1.20.1070.10
af_A0A2R8RHH7_17_319_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6361 91 194 1.20.1070.10
af_Q22115_13_315_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6244 96 194 1.20.1070.10
af_Q9Y2T6_3_303_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6238 86 197 1.20.1070.10
af_B0S6P9_14_323_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6203 93 195 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A257RSX5-F1-model_v4 DUF4149 domain-containing protein 0.9855 16 201 GO:0016020
AF-A0A257RSX5-F1-model_v4 DUF4149 domain-containing protein 0.9752 16 201 GO:0016020
AF-A0A6I3WP36-F1-model_v4 Uncharacterized protein 0.9611 25 201 GO:0016020
AF-A0A6I3WP36-F1-model_v4 Uncharacterized protein 0.9507 25 201 GO:0016020
AF-A0A2R6AMG8-F1-model_v4 DUF4149 domain-containing protein 0.9409 26 200 GO:0016020

Map