F427030

General Info

Members Datasets Scaffolds Average Seq Length
375 271 750 547

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10163015|Ga0105248_101630152
Length 606
Sequence LVHALLRGAWAAICFVVVVAYDPAMPSSSASQLIHPDAARDERDQGGVTMRVMAQMGMVMNLDKCIGCQTCSVTCKQAWTNRAGTEYVWFNNVETRPGQGYPRRHEDQERWRGGWQLNRRGRLQXXTGGRLKRLLSIFASPVQPELADYYEPWTYDYKTLVEAPLGDDFPVARPKSLITGEDTQVTWSANWDDNLAGTYELGHLDPIVERVRRASEDRIRFELEQTFMFYLPRICEHCLNPSCMASCPSGAIYKRSEDGIVLVDQDRCRGWRQCITGCPYKKIYFNHKSGKAEKCTFCYPRVEVGIPTVCAETCVGRLRYLGLFLYDADAVTAAASVPDERDLYQAQLDLLLDPDDPAVAAAAREQGIPEDWLDAARRSPVYALAKTYGVALPLHPEYRTMPMVWYVPPLSPVVDLLSEQGHDAEDRDVLFGAIDALRIPVEYLAELFTAGDTSVVTGVLRKLAAMRSYMRGVNLGRSPDASIPESVGMTEETMYAMYRLMAIAKYDERYVIPKAHVEQAHDLEERGCSLDYDEGPGMYGSAAFGEASGRSVPVAVETFHALRQRQTSDVPAGDEQLRGRVNLLNWDGNGAPRGLFPPRRDEEERP

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
214 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
215 2547132424 Nocardia nova SH22a Isolate Unclassified
216 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
217 2643221692 Nocardia sp. Root136 Isolate Unclassified
218 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
219 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
220 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
221 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
222 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
223 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
224 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
225 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
226 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
227 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
228 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
229 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
230 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
231 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
232 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
233 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
234 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
235 2808606448 Streptomyces sp. 193411 Isolate Unclassified
236 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
237 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
238 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
239 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
240 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
241 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
242 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
243 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
244 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
245 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
246 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
247 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
248 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
249 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
250 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
251 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
252 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
253 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
254 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
255 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
256 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
257 2920879853 Kocuria salina CV6 Isolate Unclassified
258 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
259 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
260 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
261 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
262 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
263 649633069 Micromonospora sp. L5 Isolate Unclassified
264 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
265 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
266 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
267 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
268 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
269 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
270 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
271 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.93
Metatranscriptomes 0.53
Isolates 16.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 8.8
Rhizosphere 75.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10163015 3300009177 Bacteria 2514
2 Ga0007423J48922_100759 3300003285 Bacteria 8400
3 Ga0006562J51391_1019106 3300003578 Bacteria 8110
4 Ga0055540_1000224 3300003792 Bacteria 53433
5 Ga0065714_10002995 3300005288 Bacteria 14950
6 Ga0070658_10054766 3300005327 Bacteria 3238
7 Ga0070676_10003874 3300005328 Bacteria 7858
8 Ga0070683_100009449 3300005329 Bacteria 8340
9 Ga0070683_100052994 3300005329 Bacteria 3759
10 Ga0068869_100044502 3300005334 Bacteria 3193
11 Ga0070666_10002686 3300005335 Bacteria 10731
12 Ga0070680_100102517 3300005336 Bacteria 2377
13 Ga0070682_100034276 3300005337 Bacteria 3091
14 Ga0070668_100003230 3300005347 Bacteria 12013
15 Ga0070669_100006735 3300005353 Bacteria 8274
16 Ga0070675_100003512 3300005354 Bacteria 11887
17 Ga0070671_100042875 3300005355 Bacteria 3762
18 Ga0070667_100049824 3300005367 Bacteria 3529
19 Ga0070713_100015605 3300005436 Bacteria 5689
20 Ga0070678_100001262 3300005456 Bacteria 13426
21 Ga0070678_100003008 3300005456 Bacteria 9341
22 Ga0070662_100018888 3300005457 Bacteria 4671
23 Ga0070681_10000818 3300005458 Bacteria 25982
24 Ga0070679_100126154 3300005530 Bacteria 2542
25 Ga0070684_100000087 3300005535 Bacteria 60538
26 Ga0070684_100014559 3300005535 Bacteria 6376
27 Ga0068853_100153315 3300005539 Bacteria 2075
28 Ga0070672_100087122 3300005543 Bacteria 2512
29 Ga0070686_100055927 3300005544 Bacteria 2529
30 Ga0070693_100001021 3300005547 Bacteria 12475
31 Ga0068855_100003922 3300005563 Bacteria 18156
32 Ga0070664_100036071 3300005564 Bacteria 4153
33 Ga0068856_100182406 3300005614 Bacteria 2112
34 Ga0068852_100027303 3300005616 Bacteria 4652
35 Ga0068864_100051307 3300005618 Bacteria 3553
36 Ga0068861_100025364 3300005719 Bacteria 4299
37 Ga0068863_100047666 3300005841 Bacteria 4064
38 Ga0081455_10001405 3300005937 Bacteria 29762
39 Ga0081455_10001616 3300005937 Bacteria 27541
40 Ga0081455_10012183 3300005937 Bacteria 8588
41 Ga0081455_10014115 3300005937 Bacteria 7851
42 Ga0081455_10018253 3300005937 Bacteria 6692
43 Ga0081455_10020183 3300005937 Bacteria 6284
44 Ga0081455_10115105 3300005937 Bacteria 2129
45 Ga0081538_10002619 3300005981 Bacteria 17401
46 Ga0081538_10013097 3300005981 Bacteria 6592
47 Ga0070717_10091258 3300006028 Bacteria 2572
48 Ga0075363_100003920 3300006048 Bacteria 6418
49 Ga0097621_100122424 3300006237 Bacteria 2207
50 Ga0068871_100058417 3300006358 Bacteria 3140
51 Ga0075431_100048515 3300006847 Bacteria 4380
52 Ga0068865_100108257 3300006881 Bacteria 2045
53 Ga0105251_10006813 3300009011 Bacteria 7193
54 Ga0105244_10036481 3300009036 Bacteria 2575
55 Ga0105240_10018129 3300009093 Bacteria 9464
56 Ga0111539_10132162 3300009094 Bacteria 2922
57 Ga0105245_10001441 3300009098 Bacteria 21578
58 Ga0114129_10002100 3300009147 Bacteria 27414
59 Ga0114129_10023615 3300009147 Bacteria 8714
60 Ga0105243_10000921 3300009148 Bacteria 27566
61 Ga0105243_10025147 3300009148 Bacteria 4547
62 Ga0105241_10003494 3300009174 Bacteria 11682
63 Ga0105241_10003691 3300009174 Bacteria 11376
64 Ga0105241_10026085 3300009174 Bacteria 4346
65 Ga0105248_10124619 3300009177 Bacteria 2906
66 Ga0105237_10061230 3300009545 Bacteria 3764
67 Ga0105237_10146871 3300009545 Bacteria 2353
68 Ga0105237_10295380 3300009545 Bacteria 1623
69 Ga0105238_10068675 3300009551 Bacteria 3545
70 Ga0105239_10001318 3300010375 Bacteria 33415
71 Ga0105239_10010801 3300010375 Bacteria 10201
72 Ga0105239_10031466 3300010375 Bacteria 5835
73 Ga0105246_10000827 3300011119 Bacteria 17608
74 Ga0157373_10003357 3300013100 Bacteria 12097
75 Ga0157369_10000499 3300013105 Bacteria 51849
76 Ga0157369_10014543 3300013105 Bacteria 8879
77 Ga0171462_1004 3300013250 Bacteria 678877
78 Ga0157374_10031852 3300013296 Bacteria 4796
79 Ga0157378_10138671 3300013297 Bacteria 2257
80 Ga0157372_10013196 3300013307 Bacteria 8815
81 Ga0157380_10015072 3300014326 Bacteria 5672
82 Ga0157379_10010469 3300014968 Bacteria 8084
83 Ga0183367_1001 3300015688 Bacteria 1225545
84 Ga0163161_10053869 3300017792 Bacteria 2918
85 Ga0213875_10000111 3300021388 Bacteria 92836
86 Ga0209051_1000014 3300025303 Bacteria 552732
87 Ga0207697_10001155 3300025315 Bacteria 14508
88 Ga0207655_1012131 3300025728 Bacteria 5065
89 Ga0207682_10001933 3300025893 Bacteria 9415
90 Ga0207710_10009283 3300025900 Bacteria 4137
91 Ga0207688_10005403 3300025901 Bacteria 6945
92 Ga0207647_10002646 3300025904 Bacteria 13528
93 Ga0207643_10071211 3300025908 Bacteria 2001
94 Ga0207705_10063650 3300025909 Bacteria 2665
95 Ga0207707_10014943 3300025912 Bacteria 6760
96 Ga0207707_10046692 3300025912 Bacteria 3772
97 Ga0207695_10079064 3300025913 Bacteria 3335
98 Ga0207671_10001563 3300025914 Bacteria 26157
99 Ga0207660_10014047 3300025917 Bacteria 5256
100 Ga0207662_10011473 3300025918 Bacteria 4917
101 Ga0207657_10071553 3300025919 Bacteria 2936
102 Ga0207652_10020501 3300025921 Bacteria 5445
103 Ga0207694_10001726 3300025924 Bacteria 18310
104 Ga0207650_10015817 3300025925 Bacteria 5260
105 Ga0207687_10000719 3300025927 Bacteria 22469
106 Ga0207690_10004881 3300025932 Bacteria 7910
107 Ga0207709_10001004 3300025935 Bacteria 20925
108 Ga0207709_10031875 3300025935 Bacteria 3083
109 Ga0207704_10094143 3300025938 Bacteria 1977
110 Ga0207691_10000237 3300025940 Bacteria 53889
111 Ga0207691_10085821 3300025940 Bacteria 2825
112 Ga0207711_10151826 3300025941 Bacteria 2091
113 Ga0207689_10014728 3300025942 Bacteria 6640
114 Ga0207661_10000222 3300025944 Bacteria 37035
115 Ga0207661_10029980 3300025944 Bacteria 4184
116 Ga0207661_10102886 3300025944 Bacteria 2402
117 Ga0207667_10028416 3300025949 Bacteria 6075
118 Ga0207651_10017506 3300025960 Bacteria 4237
119 Ga0207668_10005544 3300025972 Bacteria 7444
120 Ga0207668_10005865 3300025972 Bacteria 7234
121 Ga0207658_10078509 3300025986 Bacteria 2523
122 Ga0207639_10094973 3300026041 Bacteria 2395
123 Ga0207678_10000601 3300026067 Bacteria 33036
124 Ga0207708_10006134 3300026075 Bacteria 8911
125 Ga0207702_10007937 3300026078 Bacteria 8993
126 Ga0207674_10021160 3300026116 Bacteria 7011
127 Ga0207674_10021769 3300026116 Bacteria 6899
128 Ga0207675_100005802 3300026118 Bacteria 11804
129 Ga0207675_100053684 3300026118 Bacteria 3760
130 Ga0207683_10001134 3300026121 Bacteria 24222
131 Ga0207683_10006261 3300026121 Bacteria 10197
132 Ga0207683_10008083 3300026121 Bacteria 8998
133 Ga0207683_10022038 3300026121 Bacteria 5465
134 Ga0207698_10044044 3300026142 Bacteria 3349
135 Ga0307515_10079363 3300028794 Bacteria 4300
136 Ga0307512_10015875 3300030522 Bacteria 6966
137 Ga0307512_10069889 3300030522 Bacteria 2620
138 Ga0265327_10001755 3300031251 Bacteria 25641
139 Ga0307408_100007514 3300031548 Bacteria 7205
140 Ga0307408_100031341 3300031548 Bacteria 3702
141 Ga0307508_10003253 3300031616 Bacteria 16595
142 Ga0307405_10001158 3300031731 Bacteria 10849
143 Ga0307413_10002422 3300031824 Bacteria 7580
144 Ga0307518_10000100 3300031838 Bacteria 59484
145 Ga0307410_10036149 3300031852 Bacteria 3214
146 Ga0307406_10000068 3300031901 Bacteria 57569
147 Ga0307406_10006749 3300031901 Bacteria 6349
148 Ga0307406_10015235 3300031901 Bacteria 4444
149 Ga0307406_10044130 3300031901 Bacteria 2793
150 Ga0307407_10003621 3300031903 Bacteria 6388
151 Ga0307407_10007350 3300031903 Bacteria 4983
152 Ga0307407_10010148 3300031903 Bacteria 4426
153 Ga0307412_10006147 3300031911 Bacteria 6768
154 Ga0307409_100000475 3300031995 Bacteria 17148
155 Ga0307409_100022973 3300031995 Bacteria 4310
156 Ga0307409_100053365 3300031995 Bacteria 3105
157 Ga0307409_100160280 3300031995 Bacteria 1967
158 Ga0307409_100163461 3300031995 Bacteria 1950
159 Ga0307416_100000212 3300032002 Bacteria 30433
160 Ga0307416_100133054 3300032002 Bacteria 2243
161 Ga0307416_100162241 3300032002 Bacteria 2067
162 Ga0307416_100204638 3300032002 Bacteria 1876
163 Ga0307414_10000982 3300032004 Bacteria 14543
164 Ga0307414_10078961 3300032004 Bacteria 2401
165 Ga0307411_10004079 3300032005 Bacteria 6921
166 Ga0307415_100005294 3300032126 Bacteria 6833
167 Ga0307415_100008531 3300032126 Bacteria 5688
168 Ga0307415_100029087 3300032126 Bacteria 3526
169 Ga0395899_0023220 3300037312 Bacteria 4701
170 Ga0395900_0025496 3300037418 Bacteria 6053
171 Ga0395905_0049727 3300037471 Bacteria 3929
172 Ga0436364_0896364 3300037853 Bacteria 68582
173 Ga0395901_0099790 3300038443 Bacteria 3045
174 Ga0436365_0290884 3300039437 Bacteria 4780
175 Ga0436365_1127254 3300039437 Bacteria 11055
176 Ga0451789_0644700 3300041443 Bacteria 2887
177 Ga0451793_0287747 3300041452 Bacteria 3024
178 Ga0451843_1502008 3300041509 Bacteria 1656
179 Ga0451853_0035046 3300041512 Bacteria 2797
180 Ga0439440_0003793 3300042993 Bacteria 2941
181 Ga0466965_0003121 3300044683 Bacteria 7224
182 Ga0466963_0052383 3300044694 Bacteria 2708
183 Ga0466967_0006934 3300045976 Bacteria 8102
184 Ga0466967_0021675 3300045976 Bacteria 5226
185 Ga0466967_0077051 3300045976 Bacteria 3001
186 Ga0495603_0032464 3300046455 Bacteria 3141
187 Ga0495641_0045479 3300046461 Bacteria 2022
188 Ga0495651_0005384 3300046462 Bacteria 9765
189 Ga0495580_0010950 3300046472 Bacteria 7036
190 Ga0495582_0044188 3300046473 Bacteria 2454
191 Ga0495582_0058489 3300046473 Bacteria 2126
192 Ga0495639_0002917 3300046475 Bacteria 7451
193 Ga0495664_0041658 3300046477 Bacteria 2718
194 Ga0495594_0036809 3300046499 Bacteria 2670
195 Ga0495631_0025632 3300046518 Bacteria 2713
196 Ga0495652_0002330 3300046529 Bacteria 19722
197 Ga0495665_0005931 3300046531 Bacteria 6582
198 Ga0495588_0003123 3300046674 Bacteria 7167
199 Ga0495588_0005945 3300046674 Bacteria 5470
200 Ga0495657_0041502 3300046675 Bacteria 3147
201 Ga0495613_0003422 3300046689 Bacteria 11860
202 Ga0495600_0002163 3300046809 Bacteria 11142
203 Ga0495604_0009447 3300047317 Bacteria 7712
204 Ga0496100_0000043 3300048903 Bacteria 89692
205 Ga0496101_0000149 3300048904 Bacteria 60550
206 Ga0496102_0000999 3300048905 Bacteria 26578
207 Ga0496102_0011546 3300048905 Bacteria 7620
208 Ga0496102_0021949 3300048905 Bacteria 5653
209 Ga0496102_0113422 3300048905 Bacteria 2528
210 Ga0496102_0220651 3300048905 Bacteria 1787
211 Ga0496103_0000152 3300048906 Bacteria 72428
212 Ga0496104_0001347 3300048907 Bacteria 21269
213 Ga0496104_0014573 3300048907 Bacteria 7103
214 Ga0496105_0015737 3300048908 Bacteria 6036
215 Ga0496106_0000382 3300048909 Bacteria 31520
216 Ga0496107_0005787 3300048910 Bacteria 8459
217 Ga0496108_0008087 3300048911 Bacteria 8532
218 Ga0496108_0023810 3300048911 Bacteria 5039
219 Ga0496109_0000194 3300048912 Bacteria 60448
220 Ga0496109_0010297 3300048912 Bacteria 7985
221 Ga0496110_0041003 3300048913 Bacteria 4037
222 Ga0496111_0000753 3300048914 Bacteria 17277
223 Ga0496111_0004274 3300048914 Bacteria 8999
224 Ga0496111_0014288 3300048914 Bacteria 5420
225 Ga0496111_0043511 3300048914 Bacteria 3227
226 Ga0496112_0028222 3300048915 Bacteria 5415
227 Ga0496112_0076684 3300048915 Bacteria 3306
228 Ga0496113_0089969 3300048916 Bacteria 2363
229 Ga0496114_0000340 3300048917 Bacteria 33974
230 Ga0496114_0000548 3300048917 Bacteria 27791
231 Ga0496114_0004467 3300048917 Bacteria 10856
232 Ga0496115_0000409 3300048918 Bacteria 35229
233 Ga0496115_0003608 3300048918 Bacteria 11128
234 Ga0496115_0041904 3300048918 Bacteria 3646
235 Ga0496116_0002353 3300048919 Bacteria 19979
236 Ga0496117_0010318 3300048920 Bacteria 8538
237 Ga0496118_0007789 3300048921 Bacteria 11246
238 Ga0496119_0001288 3300048922 Bacteria 31010
239 Ga0496121_0000048 3300048924 Bacteria 330242
240 Ga0496122_0000301 3300048925 Bacteria 109636
241 Ga0496123_0005449 3300048926 Bacteria 12811
242 Ga0496124_0000044 3300048927 Bacteria 289064
243 Ga0496125_0000037 3300048928 Bacteria 330242
244 Ga0496126_0000046 3300048929 Bacteria 330242
245 Ga0501031_0000082 3300049568 Bacteria 50347
246 Ga0501031_0000943 3300049568 Bacteria 17580
247 Ga0501031_0076762 3300049568 Bacteria 2176
248 Ga0501032_0000035 3300049569 Bacteria 117554
249 Ga0501032_0018886 3300049569 Bacteria 4824
250 Ga0501032_0025297 3300049569 Bacteria 4093
251 Ga0501033_0001072 3300049570 Bacteria 24844
252 Ga0501033_0011969 3300049570 Bacteria 6628
253 Ga0501034_0000190 3300049571 Bacteria 115701
254 Ga0501034_0000925 3300049571 Bacteria 42868
255 Ga0501034_0016699 3300049571 Bacteria 7526
256 Ga0501036_0064564 3300049572 Bacteria 3098
257 Ga0501037_0000370 3300049573 Bacteria 37472
258 Ga0501037_0012252 3300049573 Bacteria 6311
259 Ga0501038_0000172 3300049574 Bacteria 55198
260 Ga0501038_0002149 3300049574 Bacteria 18305
261 Ga0501039_0000269 3300049575 Bacteria 37904
262 Ga0501039_0009667 3300049575 Bacteria 7352
263 Ga0501039_0026637 3300049575 Bacteria 4442
264 Ga0501040_0004011 3300049576 Bacteria 9566
265 Ga0501041_0007529 3300049577 Bacteria 6392
266 Ga0501043_0000231 3300049579 Bacteria 50898
267 Ga0501043_0016614 3300049579 Bacteria 5768
268 Ga0501043_0035829 3300049579 Bacteria 3904
269 Ga0501046_0000279 3300049580 Bacteria 51800
270 Ga0501046_0042807 3300049580 Bacteria 3609
271 Ga0501046_0045946 3300049580 Bacteria 3467
272 Ga0501047_0000458 3300049581 Bacteria 45091
273 Ga0501047_0009777 3300049581 Bacteria 9063
274 Ga0501047_0032117 3300049581 Bacteria 5067
275 Ga0501047_0080451 3300049581 Bacteria 3131
276 Ga0501048_0000048 3300049582 Bacteria 59433
277 Ga0501048_0048891 3300049582 Bacteria 3016
278 Ga0501067_0013010 3300049583 Bacteria 4607
279 Ga0501067_0013822 3300049583 Bacteria 4470
280 Ga0501068_0039061 3300049584 Bacteria 2845
281 Ga0501069_0000741 3300049585 Bacteria 15231
282 Ga0501070_0000504 3300049586 Bacteria 35626
283 Ga0501070_0134870 3300049586 Bacteria 2038
284 Ga0501071_0004265 3300049587 Bacteria 9056
285 Ga0501071_0013790 3300049587 Bacteria 5515
286 Ga0501071_0017328 3300049587 Bacteria 4965
287 Ga0501072_0015720 3300049588 Bacteria 5801
288 Ga0501072_0051571 3300049588 Bacteria 3239
289 Ga0501073_0001049 3300049589 Bacteria 19926
290 Ga0501074_0000061 3300049590 Bacteria 53799
291 Ga0501076_0004327 3300049592 Bacteria 10074
292 Ga0501077_0051419 3300049593 Bacteria 2618
293 Ga0501079_0007986 3300049741 Bacteria 8020
294 Ga0501079_0120159 3300049741 Bacteria 2043
295 Ga0501079_0120520 3300049741 Bacteria 2040
296 Ga0501080_0000160 3300049742 Bacteria 48505
297 Ga0501083_0043626 3300049744 Bacteria 3038
298 Ga0501035_0000404 3300049822 Bacteria 49157
299 Ga0501044_0000129 3300049823 Bacteria 92557
300 Ga0501044_0000439 3300049823 Bacteria 50915
301 Ga0501045_0032927 3300049824 Bacteria 3757
302 Ga0501045_0098591 3300049824 Bacteria 2162
303 nmdc:mga05p37_3967_c1 3300050507 Bacteria 17331
304 nmdc:mga06r32_17198_c1 3300050510 Bacteria 6600
305 nmdc:mga06r32_375_c5 3300050510 Bacteria 5461
306 Ga0500651_0037049 3300053093 Bacteria 3073
307 Ga0501084_0002451 3300054114 Bacteria 14931
308 Ga0501084_0009697 3300054114 Bacteria 7964
309 Ga0501084_0059253 3300054114 Bacteria 3205
310 Ga0501082_0012469 3300060353 Bacteria 7302
311 Ga0501082_0108681 3300060353 Bacteria 2400
312 Ga0530510_0023662 3300061734 Bacteria 4380
313 Ga0530510_0042828 3300061734 Bacteria 3270
314 2537900346 2537561592 Bacteria 4348607
315 2547410355 2547132111 Bacteria 8013147
316 2548693710 2547132424 Bacteria 8348532
317 2552110117 2551306166 Bacteria 9731570
318 2644513443 2643221692 Bacteria 7282860
319 2691515515 2690315906 Bacteria 4517044
320 2738663848 2738541264 Bacteria 5935393
321 2739142983 2738541356 Bacteria 5935017
322 2739235337 2738543011 Bacteria 5731169
323 2753037590 2751185725 Bacteria 5740550
324 2753325458 2751185792 Bacteria 5739090
325 2774393024 2773857762 Bacteria 5971770
326 2775654771 2775506735 Bacteria 4556596
327 2776370824 2775506925 Bacteria 7237746
328 2784591697 2784132148 Bacteria 8627943
329 2804848954 2802429296 Bacteria 7227771
330 2808828003 2808606357 Bacteria 4466944
331 2808853359 2808606360 Bacteria 4404006
332 2808878145 2808606366 Bacteria 4415912
333 2808890997 2808606370 Bacteria 4942454
334 2808897347 2808606371 Bacteria 4251511
335 2809196670 2808606439 Bacteria 5952208
336 2809235324 2808606448 Bacteria 8656184
337 2809591077 2808606522 Bacteria 9488490
338 2812320237 2811994871 Bacteria 4497550
339 2827631569 2827628540 Bacteria 6858585
340 2837269630 2837268691 Bacteria 7850704
341 2856863645 2856858025 Bacteria 7255264
342 2861521391 2861520306 Bacteria 8348283
343 2862283340 2862281513 Bacteria 9621493
344 2862295985 2862290372 Bacteria 7471434
345 2863073133 2863067949 Bacteria 8541735
346 2863073210 2863067949 Bacteria 8541735
347 2866617901 2866612099 Bacteria 7543886
348 2873152838 2873151551 Bacteria 8625867
349 2883826440 2883821847 Bacteria 5121194
350 2884994218 2884994152 Bacteria 4492978
351 2889301665 2889300758 Bacteria 5690814
352 2893686043 2893684298 Bacteria 2897960
353 2899367877 2899359706 Bacteria 10940472
354 2902801065 2902799365 Bacteria 5419524
355 2912723640 2912715099 Bacteria 9460473
356 2919052551 2919051321 Bacteria 4210889
357 2919536566 2919534386 Bacteria 4577686
358 2919719069 2919713450 Bacteria 7431245
359 2920880640 2920879853 Bacteria 4216831
360 2920883211 2920879853 Bacteria 4216831
361 2928146570 2928142448 Bacteria 5288925
362 2939601985 2939598168 Bacteria 4687164
363 2939747611 2939743619 Bacteria 5762299
364 3006327632 3006321560 Bacteria 8247479
365 3006494276 3006493962 Bacteria 8825450
366 3006497645 3006493962 Bacteria 8825450
367 649814595 649633069 Bacteria 6962533
368 8003858346 8003856774 Bacteria 7675274
369 8004023557 8004021418 Bacteria 4313954
370 8004028382 8004025490 Bacteria 4327753
371 8023628806 8023623736 Bacteria 8593882
372 8025417564 8025413630 Bacteria 7014048
373 8056058928 8056054917 Bacteria 5736694
374 8056061579 8056060235 Bacteria 7259403
375 8056215376 8056207758 Bacteria 8639239
376 Ga0105248_10163015
377 Ga0007423J48922_100759
378 Ga0006562J51391_1019106
379 Ga0055540_1000224
380 Ga0065714_10002995
381 Ga0070658_10054766
382 Ga0070676_10003874
383 Ga0070683_100009449
384 Ga0070683_100052994
385 Ga0068869_100044502
386 Ga0070666_10002686
387 Ga0070680_100102517
388 Ga0070682_100034276
389 Ga0070668_100003230
390 Ga0070669_100006735
391 Ga0070675_100003512
392 Ga0070671_100042875
393 Ga0070667_100049824
394 Ga0070713_100015605
395 Ga0070678_100001262
396 Ga0070678_100003008
397 Ga0070662_100018888
398 Ga0070681_10000818
399 Ga0070679_100126154
400 Ga0070684_100000087
401 Ga0070684_100014559
402 Ga0068853_100153315
403 Ga0070672_100087122
404 Ga0070686_100055927
405 Ga0070693_100001021
406 Ga0068855_100003922
407 Ga0070664_100036071
408 Ga0068856_100182406
409 Ga0068852_100027303
410 Ga0068864_100051307
411 Ga0068861_100025364
412 Ga0068863_100047666
413 Ga0081455_10001405
414 Ga0081455_10001616
415 Ga0081455_10012183
416 Ga0081455_10014115
417 Ga0081455_10018253
418 Ga0081455_10020183
419 Ga0081455_10115105
420 Ga0081538_10002619
421 Ga0081538_10013097
422 Ga0070717_10091258
423 Ga0075363_100003920
424 Ga0097621_100122424
425 Ga0068871_100058417
426 Ga0075431_100048515
427 Ga0068865_100108257
428 Ga0105251_10006813
429 Ga0105244_10036481
430 Ga0105240_10018129
431 Ga0111539_10132162
432 Ga0105245_10001441
433 Ga0114129_10002100
434 Ga0114129_10023615
435 Ga0105243_10000921
436 Ga0105243_10025147
437 Ga0105241_10003494
438 Ga0105241_10003691
439 Ga0105241_10026085
440 Ga0105248_10124619
441 Ga0105237_10061230
442 Ga0105237_10146871
443 Ga0105237_10295380
444 Ga0105238_10068675
445 Ga0105239_10001318
446 Ga0105239_10010801
447 Ga0105239_10031466
448 Ga0105246_10000827
449 Ga0157373_10003357
450 Ga0157369_10000499
451 Ga0157369_10014543
452 Ga0171462_1004
453 Ga0157374_10031852
454 Ga0157378_10138671
455 Ga0157372_10013196
456 Ga0157380_10015072
457 Ga0157379_10010469
458 Ga0183367_1001
459 Ga0163161_10053869
460 Ga0213875_10000111
461 Ga0209051_1000014
462 Ga0207697_10001155
463 Ga0207655_1012131
464 Ga0207682_10001933
465 Ga0207710_10009283
466 Ga0207688_10005403
467 Ga0207647_10002646
468 Ga0207643_10071211
469 Ga0207705_10063650
470 Ga0207707_10014943
471 Ga0207707_10046692
472 Ga0207695_10079064
473 Ga0207671_10001563
474 Ga0207660_10014047
475 Ga0207662_10011473
476 Ga0207657_10071553
477 Ga0207652_10020501
478 Ga0207694_10001726
479 Ga0207650_10015817
480 Ga0207687_10000719
481 Ga0207690_10004881
482 Ga0207709_10001004
483 Ga0207709_10031875
484 Ga0207704_10094143
485 Ga0207691_10000237
486 Ga0207691_10085821
487 Ga0207711_10151826
488 Ga0207689_10014728
489 Ga0207661_10000222
490 Ga0207661_10029980
491 Ga0207661_10102886
492 Ga0207667_10028416
493 Ga0207651_10017506
494 Ga0207668_10005544
495 Ga0207668_10005865
496 Ga0207658_10078509
497 Ga0207639_10094973
498 Ga0207678_10000601
499 Ga0207708_10006134
500 Ga0207702_10007937
501 Ga0207674_10021160
502 Ga0207674_10021769
503 Ga0207675_100005802
504 Ga0207675_100053684
505 Ga0207683_10001134
506 Ga0207683_10006261
507 Ga0207683_10008083
508 Ga0207683_10022038
509 Ga0207698_10044044
510 Ga0307515_10079363
511 Ga0307512_10015875
512 Ga0307512_10069889
513 Ga0265327_10001755
514 Ga0307408_100007514
515 Ga0307408_100031341
516 Ga0307508_10003253
517 Ga0307405_10001158
518 Ga0307413_10002422
519 Ga0307518_10000100
520 Ga0307410_10036149
521 Ga0307406_10000068
522 Ga0307406_10006749
523 Ga0307406_10015235
524 Ga0307406_10044130
525 Ga0307407_10003621
526 Ga0307407_10007350
527 Ga0307407_10010148
528 Ga0307412_10006147
529 Ga0307409_100000475
530 Ga0307409_100022973
531 Ga0307409_100053365
532 Ga0307409_100160280
533 Ga0307409_100163461
534 Ga0307416_100000212
535 Ga0307416_100133054
536 Ga0307416_100162241
537 Ga0307416_100204638
538 Ga0307414_10000982
539 Ga0307414_10078961
540 Ga0307411_10004079
541 Ga0307415_100005294
542 Ga0307415_100008531
543 Ga0307415_100029087
544 Ga0395899_0023220
545 Ga0395900_0025496
546 Ga0395905_0049727
547 Ga0436364_0896364
548 Ga0395901_0099790
549 Ga0436365_0290884
550 Ga0436365_1127254
551 Ga0451789_0644700
552 Ga0451793_0287747
553 Ga0451843_1502008
554 Ga0451853_0035046
555 Ga0439440_0003793
556 Ga0466965_0003121
557 Ga0466963_0052383
558 Ga0466967_0006934
559 Ga0466967_0021675
560 Ga0466967_0077051
561 Ga0495603_0032464
562 Ga0495641_0045479
563 Ga0495651_0005384
564 Ga0495580_0010950
565 Ga0495582_0044188
566 Ga0495582_0058489
567 Ga0495639_0002917
568 Ga0495664_0041658
569 Ga0495594_0036809
570 Ga0495631_0025632
571 Ga0495652_0002330
572 Ga0495665_0005931
573 Ga0495588_0003123
574 Ga0495588_0005945
575 Ga0495657_0041502
576 Ga0495613_0003422
577 Ga0495600_0002163
578 Ga0495604_0009447
579 Ga0496100_0000043
580 Ga0496101_0000149
581 Ga0496102_0000999
582 Ga0496102_0011546
583 Ga0496102_0021949
584 Ga0496102_0113422
585 Ga0496102_0220651
586 Ga0496103_0000152
587 Ga0496104_0001347
588 Ga0496104_0014573
589 Ga0496105_0015737
590 Ga0496106_0000382
591 Ga0496107_0005787
592 Ga0496108_0008087
593 Ga0496108_0023810
594 Ga0496109_0000194
595 Ga0496109_0010297
596 Ga0496110_0041003
597 Ga0496111_0000753
598 Ga0496111_0004274
599 Ga0496111_0014288
600 Ga0496111_0043511
601 Ga0496112_0028222
602 Ga0496112_0076684
603 Ga0496113_0089969
604 Ga0496114_0000340
605 Ga0496114_0000548
606 Ga0496114_0004467
607 Ga0496115_0000409
608 Ga0496115_0003608
609 Ga0496115_0041904
610 Ga0496116_0002353
611 Ga0496117_0010318
612 Ga0496118_0007789
613 Ga0496119_0001288
614 Ga0496121_0000048
615 Ga0496122_0000301
616 Ga0496123_0005449
617 Ga0496124_0000044
618 Ga0496125_0000037
619 Ga0496126_0000046
620 Ga0501031_0000082
621 Ga0501031_0000943
622 Ga0501031_0076762
623 Ga0501032_0000035
624 Ga0501032_0018886
625 Ga0501032_0025297
626 Ga0501033_0001072
627 Ga0501033_0011969
628 Ga0501034_0000190
629 Ga0501034_0000925
630 Ga0501034_0016699
631 Ga0501036_0064564
632 Ga0501037_0000370
633 Ga0501037_0012252
634 Ga0501038_0000172
635 Ga0501038_0002149
636 Ga0501039_0000269
637 Ga0501039_0009667
638 Ga0501039_0026637
639 Ga0501040_0004011
640 Ga0501041_0007529
641 Ga0501043_0000231
642 Ga0501043_0016614
643 Ga0501043_0035829
644 Ga0501046_0000279
645 Ga0501046_0042807
646 Ga0501046_0045946
647 Ga0501047_0000458
648 Ga0501047_0009777
649 Ga0501047_0032117
650 Ga0501047_0080451
651 Ga0501048_0000048
652 Ga0501048_0048891
653 Ga0501067_0013010
654 Ga0501067_0013822
655 Ga0501068_0039061
656 Ga0501069_0000741
657 Ga0501070_0000504
658 Ga0501070_0134870
659 Ga0501071_0004265
660 Ga0501071_0013790
661 Ga0501071_0017328
662 Ga0501072_0015720
663 Ga0501072_0051571
664 Ga0501073_0001049
665 Ga0501074_0000061
666 Ga0501076_0004327
667 Ga0501077_0051419
668 Ga0501079_0007986
669 Ga0501079_0120159
670 Ga0501079_0120520
671 Ga0501080_0000160
672 Ga0501083_0043626
673 Ga0501035_0000404
674 Ga0501044_0000129
675 Ga0501044_0000439
676 Ga0501045_0032927
677 Ga0501045_0098591
678 nmdc:mga05p37_3967_c1
679 nmdc:mga06r32_17198_c1
680 nmdc:mga06r32_375_c5
681 Ga0500651_0037049
682 Ga0501084_0002451
683 Ga0501084_0009697
684 Ga0501084_0059253
685 Ga0501082_0012469
686 Ga0501082_0108681
687 Ga0530510_0023662
688 Ga0530510_0042828
689 2537900346
690 2547410355
691 2548693710
692 2552110117
693 2644513443
694 2691515515
695 2738663848
696 2739142983
697 2739235337
698 2753037590
699 2753325458
700 2774393024
701 2775654771
702 2776370824
703 2784591697
704 2804848954
705 2808828003
706 2808853359
707 2808878145
708 2808890997
709 2808897347
710 2809196670
711 2809235324
712 2809591077
713 2812320237
714 2827631569
715 2837269630
716 2856863645
717 2861521391
718 2862283340
719 2862295985
720 2863073133
721 2863073210
722 2866617901
723 2873152838
724 2883826440
725 2884994218
726 2889301665
727 2893686043
728 2899367877
729 2902801065
730 2912723640
731 2919052551
732 2919536566
733 2919719069
734 2920880640
735 2920883211
736 2928146570
737 2939601985
738 2939747611
739 3006327632
740 3006494276
741 3006497645
742 649814595
743 8003858346
744 8004023557
745 8004028382
746 8023628806
747 8025417564
748 8056058928
749 8056061579
750 8056215376

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13247

Fer4_11

4Fe-4S dicluster domain

226

324

0.98

PF14711

Nitr_red_bet_C

Respiratory nitrate reductase beta C-terminal

410

491

0.98

PF13237

Fer4_10

4Fe-4S dicluster domain

227

279

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r27-assembly1.cif.gz_B crystal structure of nargh complex 0.624 1 469
1r27-assembly1.cif.gz_B crystal structure of nargh complex 0.6215 1 469
3ir5-assembly1.cif.gz_B crystal structure of narghi mutant narg-h49c 0.6098 1 496
3ir5-assembly1.cif.gz_B crystal structure of narghi mutant narg-h49c 0.5918 1 496
3egw-assembly1.cif.gz_B the crystal structure of the narghi mutant narh - c16a 0.5829 1 499
ID Description Score Start End Superfamily
af_P19318_241_361_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9307 244 360 3.30.70.20
af_P19318_241_361_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8939 244 360 3.30.70.20
1y4zB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8767 246 469 3.30.70.20
1y4zB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7786 246 469 3.30.70.20
af_O06560_187_241_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6284 188 242 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A380DWX5-F1-model_v4 Respiratory nitrate reductase beta chain (EC 1.7.99.4) 0.9699 269 359 GO:0009055
GO:0009061
GO:0016020
GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A5C5RJT0-F1-model_v4 Nitrate reductase subunit beta 0.9627 261 469 GO:0009055
GO:0009061
GO:0016020
GO:0030313
GO:0046872
GO:0051539
AF-A0A377K8Q3-F1-model_v4 Respiratory nitrate reductase 2 subunit beta (EC 1.7.99.4) 0.9619 260 360 GO:0009055
GO:0009061
GO:0016020
GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A447U377-F1-model_v4 Respiratory nitrate reductase 2 subunit beta (EC 1.7.99.4) 0.9585 270 360 GO:0009055
GO:0009061
GO:0016020
GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A5C5RJT0-F1-model_v4 Nitrate reductase subunit beta 0.9279 261 469 GO:0009055
GO:0009061
GO:0016020
GO:0030313
GO:0046872
GO:0051539

Map