F427030
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 375 | 271 | 750 | 547 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10163015|Ga0105248_101630152 |
| Length | 606 |
| Sequence | LVHALLRGAWAAICFVVVVAYDPAMPSSSASQLIHPDAARDERDQGGVTMRVMAQMGMVMNLDKCIGCQTCSVTCKQAWTNRAGTEYVWFNNVETRPGQGYPRRHEDQERWRGGWQLNRRGRLQXXTGGRLKRLLSIFASPVQPELADYYEPWTYDYKTLVEAPLGDDFPVARPKSLITGEDTQVTWSANWDDNLAGTYELGHLDPIVERVRRASEDRIRFELEQTFMFYLPRICEHCLNPSCMASCPSGAIYKRSEDGIVLVDQDRCRGWRQCITGCPYKKIYFNHKSGKAEKCTFCYPRVEVGIPTVCAETCVGRLRYLGLFLYDADAVTAAASVPDERDLYQAQLDLLLDPDDPAVAAAAREQGIPEDWLDAARRSPVYALAKTYGVALPLHPEYRTMPMVWYVPPLSPVVDLLSEQGHDAEDRDVLFGAIDALRIPVEYLAELFTAGDTSVVTGVLRKLAAMRSYMRGVNLGRSPDASIPESVGMTEETMYAMYRLMAIAKYDERYVIPKAHVEQAHDLEERGCSLDYDEGPGMYGSAAFGEASGRSVPVAVETFHALRQRQTSDVPAGDEQLRGRVNLLNWDGNGAPRGLFPPRRDEEERP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 106 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 112 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 113 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 114 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 127 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 130 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 131 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 132 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 133 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 158 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 162 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 163 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 166 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 167 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 168 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 169 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 170 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 173 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 174 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 175 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 176 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 177 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 210 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 213 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 214 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 215 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 216 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 217 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 218 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 219 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 220 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 221 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 222 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 223 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 224 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 225 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 226 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 227 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 228 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 229 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 230 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 231 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 232 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 233 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 234 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 235 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 236 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 237 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 238 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 239 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 240 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 241 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 242 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 243 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 244 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 245 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 246 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 247 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 248 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 249 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 250 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 251 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 252 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 253 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 254 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 255 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 256 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 257 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 258 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 259 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 260 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 261 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 262 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 263 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 264 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 265 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 266 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 267 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 268 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 269 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 270 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 271 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.93 |
| Metatranscriptomes | 0.53 |
| Isolates | 16.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.07 |
| Nodule | 0 |
| Rhizoplane | 8.8 |
| Rhizosphere | 75.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10163015 | 3300009177 | Bacteria | 2514 |
| 2 | Ga0007423J48922_100759 | 3300003285 | Bacteria | 8400 |
| 3 | Ga0006562J51391_1019106 | 3300003578 | Bacteria | 8110 |
| 4 | Ga0055540_1000224 | 3300003792 | Bacteria | 53433 |
| 5 | Ga0065714_10002995 | 3300005288 | Bacteria | 14950 |
| 6 | Ga0070658_10054766 | 3300005327 | Bacteria | 3238 |
| 7 | Ga0070676_10003874 | 3300005328 | Bacteria | 7858 |
| 8 | Ga0070683_100009449 | 3300005329 | Bacteria | 8340 |
| 9 | Ga0070683_100052994 | 3300005329 | Bacteria | 3759 |
| 10 | Ga0068869_100044502 | 3300005334 | Bacteria | 3193 |
| 11 | Ga0070666_10002686 | 3300005335 | Bacteria | 10731 |
| 12 | Ga0070680_100102517 | 3300005336 | Bacteria | 2377 |
| 13 | Ga0070682_100034276 | 3300005337 | Bacteria | 3091 |
| 14 | Ga0070668_100003230 | 3300005347 | Bacteria | 12013 |
| 15 | Ga0070669_100006735 | 3300005353 | Bacteria | 8274 |
| 16 | Ga0070675_100003512 | 3300005354 | Bacteria | 11887 |
| 17 | Ga0070671_100042875 | 3300005355 | Bacteria | 3762 |
| 18 | Ga0070667_100049824 | 3300005367 | Bacteria | 3529 |
| 19 | Ga0070713_100015605 | 3300005436 | Bacteria | 5689 |
| 20 | Ga0070678_100001262 | 3300005456 | Bacteria | 13426 |
| 21 | Ga0070678_100003008 | 3300005456 | Bacteria | 9341 |
| 22 | Ga0070662_100018888 | 3300005457 | Bacteria | 4671 |
| 23 | Ga0070681_10000818 | 3300005458 | Bacteria | 25982 |
| 24 | Ga0070679_100126154 | 3300005530 | Bacteria | 2542 |
| 25 | Ga0070684_100000087 | 3300005535 | Bacteria | 60538 |
| 26 | Ga0070684_100014559 | 3300005535 | Bacteria | 6376 |
| 27 | Ga0068853_100153315 | 3300005539 | Bacteria | 2075 |
| 28 | Ga0070672_100087122 | 3300005543 | Bacteria | 2512 |
| 29 | Ga0070686_100055927 | 3300005544 | Bacteria | 2529 |
| 30 | Ga0070693_100001021 | 3300005547 | Bacteria | 12475 |
| 31 | Ga0068855_100003922 | 3300005563 | Bacteria | 18156 |
| 32 | Ga0070664_100036071 | 3300005564 | Bacteria | 4153 |
| 33 | Ga0068856_100182406 | 3300005614 | Bacteria | 2112 |
| 34 | Ga0068852_100027303 | 3300005616 | Bacteria | 4652 |
| 35 | Ga0068864_100051307 | 3300005618 | Bacteria | 3553 |
| 36 | Ga0068861_100025364 | 3300005719 | Bacteria | 4299 |
| 37 | Ga0068863_100047666 | 3300005841 | Bacteria | 4064 |
| 38 | Ga0081455_10001405 | 3300005937 | Bacteria | 29762 |
| 39 | Ga0081455_10001616 | 3300005937 | Bacteria | 27541 |
| 40 | Ga0081455_10012183 | 3300005937 | Bacteria | 8588 |
| 41 | Ga0081455_10014115 | 3300005937 | Bacteria | 7851 |
| 42 | Ga0081455_10018253 | 3300005937 | Bacteria | 6692 |
| 43 | Ga0081455_10020183 | 3300005937 | Bacteria | 6284 |
| 44 | Ga0081455_10115105 | 3300005937 | Bacteria | 2129 |
| 45 | Ga0081538_10002619 | 3300005981 | Bacteria | 17401 |
| 46 | Ga0081538_10013097 | 3300005981 | Bacteria | 6592 |
| 47 | Ga0070717_10091258 | 3300006028 | Bacteria | 2572 |
| 48 | Ga0075363_100003920 | 3300006048 | Bacteria | 6418 |
| 49 | Ga0097621_100122424 | 3300006237 | Bacteria | 2207 |
| 50 | Ga0068871_100058417 | 3300006358 | Bacteria | 3140 |
| 51 | Ga0075431_100048515 | 3300006847 | Bacteria | 4380 |
| 52 | Ga0068865_100108257 | 3300006881 | Bacteria | 2045 |
| 53 | Ga0105251_10006813 | 3300009011 | Bacteria | 7193 |
| 54 | Ga0105244_10036481 | 3300009036 | Bacteria | 2575 |
| 55 | Ga0105240_10018129 | 3300009093 | Bacteria | 9464 |
| 56 | Ga0111539_10132162 | 3300009094 | Bacteria | 2922 |
| 57 | Ga0105245_10001441 | 3300009098 | Bacteria | 21578 |
| 58 | Ga0114129_10002100 | 3300009147 | Bacteria | 27414 |
| 59 | Ga0114129_10023615 | 3300009147 | Bacteria | 8714 |
| 60 | Ga0105243_10000921 | 3300009148 | Bacteria | 27566 |
| 61 | Ga0105243_10025147 | 3300009148 | Bacteria | 4547 |
| 62 | Ga0105241_10003494 | 3300009174 | Bacteria | 11682 |
| 63 | Ga0105241_10003691 | 3300009174 | Bacteria | 11376 |
| 64 | Ga0105241_10026085 | 3300009174 | Bacteria | 4346 |
| 65 | Ga0105248_10124619 | 3300009177 | Bacteria | 2906 |
| 66 | Ga0105237_10061230 | 3300009545 | Bacteria | 3764 |
| 67 | Ga0105237_10146871 | 3300009545 | Bacteria | 2353 |
| 68 | Ga0105237_10295380 | 3300009545 | Bacteria | 1623 |
| 69 | Ga0105238_10068675 | 3300009551 | Bacteria | 3545 |
| 70 | Ga0105239_10001318 | 3300010375 | Bacteria | 33415 |
| 71 | Ga0105239_10010801 | 3300010375 | Bacteria | 10201 |
| 72 | Ga0105239_10031466 | 3300010375 | Bacteria | 5835 |
| 73 | Ga0105246_10000827 | 3300011119 | Bacteria | 17608 |
| 74 | Ga0157373_10003357 | 3300013100 | Bacteria | 12097 |
| 75 | Ga0157369_10000499 | 3300013105 | Bacteria | 51849 |
| 76 | Ga0157369_10014543 | 3300013105 | Bacteria | 8879 |
| 77 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 78 | Ga0157374_10031852 | 3300013296 | Bacteria | 4796 |
| 79 | Ga0157378_10138671 | 3300013297 | Bacteria | 2257 |
| 80 | Ga0157372_10013196 | 3300013307 | Bacteria | 8815 |
| 81 | Ga0157380_10015072 | 3300014326 | Bacteria | 5672 |
| 82 | Ga0157379_10010469 | 3300014968 | Bacteria | 8084 |
| 83 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 84 | Ga0163161_10053869 | 3300017792 | Bacteria | 2918 |
| 85 | Ga0213875_10000111 | 3300021388 | Bacteria | 92836 |
| 86 | Ga0209051_1000014 | 3300025303 | Bacteria | 552732 |
| 87 | Ga0207697_10001155 | 3300025315 | Bacteria | 14508 |
| 88 | Ga0207655_1012131 | 3300025728 | Bacteria | 5065 |
| 89 | Ga0207682_10001933 | 3300025893 | Bacteria | 9415 |
| 90 | Ga0207710_10009283 | 3300025900 | Bacteria | 4137 |
| 91 | Ga0207688_10005403 | 3300025901 | Bacteria | 6945 |
| 92 | Ga0207647_10002646 | 3300025904 | Bacteria | 13528 |
| 93 | Ga0207643_10071211 | 3300025908 | Bacteria | 2001 |
| 94 | Ga0207705_10063650 | 3300025909 | Bacteria | 2665 |
| 95 | Ga0207707_10014943 | 3300025912 | Bacteria | 6760 |
| 96 | Ga0207707_10046692 | 3300025912 | Bacteria | 3772 |
| 97 | Ga0207695_10079064 | 3300025913 | Bacteria | 3335 |
| 98 | Ga0207671_10001563 | 3300025914 | Bacteria | 26157 |
| 99 | Ga0207660_10014047 | 3300025917 | Bacteria | 5256 |
| 100 | Ga0207662_10011473 | 3300025918 | Bacteria | 4917 |
| 101 | Ga0207657_10071553 | 3300025919 | Bacteria | 2936 |
| 102 | Ga0207652_10020501 | 3300025921 | Bacteria | 5445 |
| 103 | Ga0207694_10001726 | 3300025924 | Bacteria | 18310 |
| 104 | Ga0207650_10015817 | 3300025925 | Bacteria | 5260 |
| 105 | Ga0207687_10000719 | 3300025927 | Bacteria | 22469 |
| 106 | Ga0207690_10004881 | 3300025932 | Bacteria | 7910 |
| 107 | Ga0207709_10001004 | 3300025935 | Bacteria | 20925 |
| 108 | Ga0207709_10031875 | 3300025935 | Bacteria | 3083 |
| 109 | Ga0207704_10094143 | 3300025938 | Bacteria | 1977 |
| 110 | Ga0207691_10000237 | 3300025940 | Bacteria | 53889 |
| 111 | Ga0207691_10085821 | 3300025940 | Bacteria | 2825 |
| 112 | Ga0207711_10151826 | 3300025941 | Bacteria | 2091 |
| 113 | Ga0207689_10014728 | 3300025942 | Bacteria | 6640 |
| 114 | Ga0207661_10000222 | 3300025944 | Bacteria | 37035 |
| 115 | Ga0207661_10029980 | 3300025944 | Bacteria | 4184 |
| 116 | Ga0207661_10102886 | 3300025944 | Bacteria | 2402 |
| 117 | Ga0207667_10028416 | 3300025949 | Bacteria | 6075 |
| 118 | Ga0207651_10017506 | 3300025960 | Bacteria | 4237 |
| 119 | Ga0207668_10005544 | 3300025972 | Bacteria | 7444 |
| 120 | Ga0207668_10005865 | 3300025972 | Bacteria | 7234 |
| 121 | Ga0207658_10078509 | 3300025986 | Bacteria | 2523 |
| 122 | Ga0207639_10094973 | 3300026041 | Bacteria | 2395 |
| 123 | Ga0207678_10000601 | 3300026067 | Bacteria | 33036 |
| 124 | Ga0207708_10006134 | 3300026075 | Bacteria | 8911 |
| 125 | Ga0207702_10007937 | 3300026078 | Bacteria | 8993 |
| 126 | Ga0207674_10021160 | 3300026116 | Bacteria | 7011 |
| 127 | Ga0207674_10021769 | 3300026116 | Bacteria | 6899 |
| 128 | Ga0207675_100005802 | 3300026118 | Bacteria | 11804 |
| 129 | Ga0207675_100053684 | 3300026118 | Bacteria | 3760 |
| 130 | Ga0207683_10001134 | 3300026121 | Bacteria | 24222 |
| 131 | Ga0207683_10006261 | 3300026121 | Bacteria | 10197 |
| 132 | Ga0207683_10008083 | 3300026121 | Bacteria | 8998 |
| 133 | Ga0207683_10022038 | 3300026121 | Bacteria | 5465 |
| 134 | Ga0207698_10044044 | 3300026142 | Bacteria | 3349 |
| 135 | Ga0307515_10079363 | 3300028794 | Bacteria | 4300 |
| 136 | Ga0307512_10015875 | 3300030522 | Bacteria | 6966 |
| 137 | Ga0307512_10069889 | 3300030522 | Bacteria | 2620 |
| 138 | Ga0265327_10001755 | 3300031251 | Bacteria | 25641 |
| 139 | Ga0307408_100007514 | 3300031548 | Bacteria | 7205 |
| 140 | Ga0307408_100031341 | 3300031548 | Bacteria | 3702 |
| 141 | Ga0307508_10003253 | 3300031616 | Bacteria | 16595 |
| 142 | Ga0307405_10001158 | 3300031731 | Bacteria | 10849 |
| 143 | Ga0307413_10002422 | 3300031824 | Bacteria | 7580 |
| 144 | Ga0307518_10000100 | 3300031838 | Bacteria | 59484 |
| 145 | Ga0307410_10036149 | 3300031852 | Bacteria | 3214 |
| 146 | Ga0307406_10000068 | 3300031901 | Bacteria | 57569 |
| 147 | Ga0307406_10006749 | 3300031901 | Bacteria | 6349 |
| 148 | Ga0307406_10015235 | 3300031901 | Bacteria | 4444 |
| 149 | Ga0307406_10044130 | 3300031901 | Bacteria | 2793 |
| 150 | Ga0307407_10003621 | 3300031903 | Bacteria | 6388 |
| 151 | Ga0307407_10007350 | 3300031903 | Bacteria | 4983 |
| 152 | Ga0307407_10010148 | 3300031903 | Bacteria | 4426 |
| 153 | Ga0307412_10006147 | 3300031911 | Bacteria | 6768 |
| 154 | Ga0307409_100000475 | 3300031995 | Bacteria | 17148 |
| 155 | Ga0307409_100022973 | 3300031995 | Bacteria | 4310 |
| 156 | Ga0307409_100053365 | 3300031995 | Bacteria | 3105 |
| 157 | Ga0307409_100160280 | 3300031995 | Bacteria | 1967 |
| 158 | Ga0307409_100163461 | 3300031995 | Bacteria | 1950 |
| 159 | Ga0307416_100000212 | 3300032002 | Bacteria | 30433 |
| 160 | Ga0307416_100133054 | 3300032002 | Bacteria | 2243 |
| 161 | Ga0307416_100162241 | 3300032002 | Bacteria | 2067 |
| 162 | Ga0307416_100204638 | 3300032002 | Bacteria | 1876 |
| 163 | Ga0307414_10000982 | 3300032004 | Bacteria | 14543 |
| 164 | Ga0307414_10078961 | 3300032004 | Bacteria | 2401 |
| 165 | Ga0307411_10004079 | 3300032005 | Bacteria | 6921 |
| 166 | Ga0307415_100005294 | 3300032126 | Bacteria | 6833 |
| 167 | Ga0307415_100008531 | 3300032126 | Bacteria | 5688 |
| 168 | Ga0307415_100029087 | 3300032126 | Bacteria | 3526 |
| 169 | Ga0395899_0023220 | 3300037312 | Bacteria | 4701 |
| 170 | Ga0395900_0025496 | 3300037418 | Bacteria | 6053 |
| 171 | Ga0395905_0049727 | 3300037471 | Bacteria | 3929 |
| 172 | Ga0436364_0896364 | 3300037853 | Bacteria | 68582 |
| 173 | Ga0395901_0099790 | 3300038443 | Bacteria | 3045 |
| 174 | Ga0436365_0290884 | 3300039437 | Bacteria | 4780 |
| 175 | Ga0436365_1127254 | 3300039437 | Bacteria | 11055 |
| 176 | Ga0451789_0644700 | 3300041443 | Bacteria | 2887 |
| 177 | Ga0451793_0287747 | 3300041452 | Bacteria | 3024 |
| 178 | Ga0451843_1502008 | 3300041509 | Bacteria | 1656 |
| 179 | Ga0451853_0035046 | 3300041512 | Bacteria | 2797 |
| 180 | Ga0439440_0003793 | 3300042993 | Bacteria | 2941 |
| 181 | Ga0466965_0003121 | 3300044683 | Bacteria | 7224 |
| 182 | Ga0466963_0052383 | 3300044694 | Bacteria | 2708 |
| 183 | Ga0466967_0006934 | 3300045976 | Bacteria | 8102 |
| 184 | Ga0466967_0021675 | 3300045976 | Bacteria | 5226 |
| 185 | Ga0466967_0077051 | 3300045976 | Bacteria | 3001 |
| 186 | Ga0495603_0032464 | 3300046455 | Bacteria | 3141 |
| 187 | Ga0495641_0045479 | 3300046461 | Bacteria | 2022 |
| 188 | Ga0495651_0005384 | 3300046462 | Bacteria | 9765 |
| 189 | Ga0495580_0010950 | 3300046472 | Bacteria | 7036 |
| 190 | Ga0495582_0044188 | 3300046473 | Bacteria | 2454 |
| 191 | Ga0495582_0058489 | 3300046473 | Bacteria | 2126 |
| 192 | Ga0495639_0002917 | 3300046475 | Bacteria | 7451 |
| 193 | Ga0495664_0041658 | 3300046477 | Bacteria | 2718 |
| 194 | Ga0495594_0036809 | 3300046499 | Bacteria | 2670 |
| 195 | Ga0495631_0025632 | 3300046518 | Bacteria | 2713 |
| 196 | Ga0495652_0002330 | 3300046529 | Bacteria | 19722 |
| 197 | Ga0495665_0005931 | 3300046531 | Bacteria | 6582 |
| 198 | Ga0495588_0003123 | 3300046674 | Bacteria | 7167 |
| 199 | Ga0495588_0005945 | 3300046674 | Bacteria | 5470 |
| 200 | Ga0495657_0041502 | 3300046675 | Bacteria | 3147 |
| 201 | Ga0495613_0003422 | 3300046689 | Bacteria | 11860 |
| 202 | Ga0495600_0002163 | 3300046809 | Bacteria | 11142 |
| 203 | Ga0495604_0009447 | 3300047317 | Bacteria | 7712 |
| 204 | Ga0496100_0000043 | 3300048903 | Bacteria | 89692 |
| 205 | Ga0496101_0000149 | 3300048904 | Bacteria | 60550 |
| 206 | Ga0496102_0000999 | 3300048905 | Bacteria | 26578 |
| 207 | Ga0496102_0011546 | 3300048905 | Bacteria | 7620 |
| 208 | Ga0496102_0021949 | 3300048905 | Bacteria | 5653 |
| 209 | Ga0496102_0113422 | 3300048905 | Bacteria | 2528 |
| 210 | Ga0496102_0220651 | 3300048905 | Bacteria | 1787 |
| 211 | Ga0496103_0000152 | 3300048906 | Bacteria | 72428 |
| 212 | Ga0496104_0001347 | 3300048907 | Bacteria | 21269 |
| 213 | Ga0496104_0014573 | 3300048907 | Bacteria | 7103 |
| 214 | Ga0496105_0015737 | 3300048908 | Bacteria | 6036 |
| 215 | Ga0496106_0000382 | 3300048909 | Bacteria | 31520 |
| 216 | Ga0496107_0005787 | 3300048910 | Bacteria | 8459 |
| 217 | Ga0496108_0008087 | 3300048911 | Bacteria | 8532 |
| 218 | Ga0496108_0023810 | 3300048911 | Bacteria | 5039 |
| 219 | Ga0496109_0000194 | 3300048912 | Bacteria | 60448 |
| 220 | Ga0496109_0010297 | 3300048912 | Bacteria | 7985 |
| 221 | Ga0496110_0041003 | 3300048913 | Bacteria | 4037 |
| 222 | Ga0496111_0000753 | 3300048914 | Bacteria | 17277 |
| 223 | Ga0496111_0004274 | 3300048914 | Bacteria | 8999 |
| 224 | Ga0496111_0014288 | 3300048914 | Bacteria | 5420 |
| 225 | Ga0496111_0043511 | 3300048914 | Bacteria | 3227 |
| 226 | Ga0496112_0028222 | 3300048915 | Bacteria | 5415 |
| 227 | Ga0496112_0076684 | 3300048915 | Bacteria | 3306 |
| 228 | Ga0496113_0089969 | 3300048916 | Bacteria | 2363 |
| 229 | Ga0496114_0000340 | 3300048917 | Bacteria | 33974 |
| 230 | Ga0496114_0000548 | 3300048917 | Bacteria | 27791 |
| 231 | Ga0496114_0004467 | 3300048917 | Bacteria | 10856 |
| 232 | Ga0496115_0000409 | 3300048918 | Bacteria | 35229 |
| 233 | Ga0496115_0003608 | 3300048918 | Bacteria | 11128 |
| 234 | Ga0496115_0041904 | 3300048918 | Bacteria | 3646 |
| 235 | Ga0496116_0002353 | 3300048919 | Bacteria | 19979 |
| 236 | Ga0496117_0010318 | 3300048920 | Bacteria | 8538 |
| 237 | Ga0496118_0007789 | 3300048921 | Bacteria | 11246 |
| 238 | Ga0496119_0001288 | 3300048922 | Bacteria | 31010 |
| 239 | Ga0496121_0000048 | 3300048924 | Bacteria | 330242 |
| 240 | Ga0496122_0000301 | 3300048925 | Bacteria | 109636 |
| 241 | Ga0496123_0005449 | 3300048926 | Bacteria | 12811 |
| 242 | Ga0496124_0000044 | 3300048927 | Bacteria | 289064 |
| 243 | Ga0496125_0000037 | 3300048928 | Bacteria | 330242 |
| 244 | Ga0496126_0000046 | 3300048929 | Bacteria | 330242 |
| 245 | Ga0501031_0000082 | 3300049568 | Bacteria | 50347 |
| 246 | Ga0501031_0000943 | 3300049568 | Bacteria | 17580 |
| 247 | Ga0501031_0076762 | 3300049568 | Bacteria | 2176 |
| 248 | Ga0501032_0000035 | 3300049569 | Bacteria | 117554 |
| 249 | Ga0501032_0018886 | 3300049569 | Bacteria | 4824 |
| 250 | Ga0501032_0025297 | 3300049569 | Bacteria | 4093 |
| 251 | Ga0501033_0001072 | 3300049570 | Bacteria | 24844 |
| 252 | Ga0501033_0011969 | 3300049570 | Bacteria | 6628 |
| 253 | Ga0501034_0000190 | 3300049571 | Bacteria | 115701 |
| 254 | Ga0501034_0000925 | 3300049571 | Bacteria | 42868 |
| 255 | Ga0501034_0016699 | 3300049571 | Bacteria | 7526 |
| 256 | Ga0501036_0064564 | 3300049572 | Bacteria | 3098 |
| 257 | Ga0501037_0000370 | 3300049573 | Bacteria | 37472 |
| 258 | Ga0501037_0012252 | 3300049573 | Bacteria | 6311 |
| 259 | Ga0501038_0000172 | 3300049574 | Bacteria | 55198 |
| 260 | Ga0501038_0002149 | 3300049574 | Bacteria | 18305 |
| 261 | Ga0501039_0000269 | 3300049575 | Bacteria | 37904 |
| 262 | Ga0501039_0009667 | 3300049575 | Bacteria | 7352 |
| 263 | Ga0501039_0026637 | 3300049575 | Bacteria | 4442 |
| 264 | Ga0501040_0004011 | 3300049576 | Bacteria | 9566 |
| 265 | Ga0501041_0007529 | 3300049577 | Bacteria | 6392 |
| 266 | Ga0501043_0000231 | 3300049579 | Bacteria | 50898 |
| 267 | Ga0501043_0016614 | 3300049579 | Bacteria | 5768 |
| 268 | Ga0501043_0035829 | 3300049579 | Bacteria | 3904 |
| 269 | Ga0501046_0000279 | 3300049580 | Bacteria | 51800 |
| 270 | Ga0501046_0042807 | 3300049580 | Bacteria | 3609 |
| 271 | Ga0501046_0045946 | 3300049580 | Bacteria | 3467 |
| 272 | Ga0501047_0000458 | 3300049581 | Bacteria | 45091 |
| 273 | Ga0501047_0009777 | 3300049581 | Bacteria | 9063 |
| 274 | Ga0501047_0032117 | 3300049581 | Bacteria | 5067 |
| 275 | Ga0501047_0080451 | 3300049581 | Bacteria | 3131 |
| 276 | Ga0501048_0000048 | 3300049582 | Bacteria | 59433 |
| 277 | Ga0501048_0048891 | 3300049582 | Bacteria | 3016 |
| 278 | Ga0501067_0013010 | 3300049583 | Bacteria | 4607 |
| 279 | Ga0501067_0013822 | 3300049583 | Bacteria | 4470 |
| 280 | Ga0501068_0039061 | 3300049584 | Bacteria | 2845 |
| 281 | Ga0501069_0000741 | 3300049585 | Bacteria | 15231 |
| 282 | Ga0501070_0000504 | 3300049586 | Bacteria | 35626 |
| 283 | Ga0501070_0134870 | 3300049586 | Bacteria | 2038 |
| 284 | Ga0501071_0004265 | 3300049587 | Bacteria | 9056 |
| 285 | Ga0501071_0013790 | 3300049587 | Bacteria | 5515 |
| 286 | Ga0501071_0017328 | 3300049587 | Bacteria | 4965 |
| 287 | Ga0501072_0015720 | 3300049588 | Bacteria | 5801 |
| 288 | Ga0501072_0051571 | 3300049588 | Bacteria | 3239 |
| 289 | Ga0501073_0001049 | 3300049589 | Bacteria | 19926 |
| 290 | Ga0501074_0000061 | 3300049590 | Bacteria | 53799 |
| 291 | Ga0501076_0004327 | 3300049592 | Bacteria | 10074 |
| 292 | Ga0501077_0051419 | 3300049593 | Bacteria | 2618 |
| 293 | Ga0501079_0007986 | 3300049741 | Bacteria | 8020 |
| 294 | Ga0501079_0120159 | 3300049741 | Bacteria | 2043 |
| 295 | Ga0501079_0120520 | 3300049741 | Bacteria | 2040 |
| 296 | Ga0501080_0000160 | 3300049742 | Bacteria | 48505 |
| 297 | Ga0501083_0043626 | 3300049744 | Bacteria | 3038 |
| 298 | Ga0501035_0000404 | 3300049822 | Bacteria | 49157 |
| 299 | Ga0501044_0000129 | 3300049823 | Bacteria | 92557 |
| 300 | Ga0501044_0000439 | 3300049823 | Bacteria | 50915 |
| 301 | Ga0501045_0032927 | 3300049824 | Bacteria | 3757 |
| 302 | Ga0501045_0098591 | 3300049824 | Bacteria | 2162 |
| 303 | nmdc:mga05p37_3967_c1 | 3300050507 | Bacteria | 17331 |
| 304 | nmdc:mga06r32_17198_c1 | 3300050510 | Bacteria | 6600 |
| 305 | nmdc:mga06r32_375_c5 | 3300050510 | Bacteria | 5461 |
| 306 | Ga0500651_0037049 | 3300053093 | Bacteria | 3073 |
| 307 | Ga0501084_0002451 | 3300054114 | Bacteria | 14931 |
| 308 | Ga0501084_0009697 | 3300054114 | Bacteria | 7964 |
| 309 | Ga0501084_0059253 | 3300054114 | Bacteria | 3205 |
| 310 | Ga0501082_0012469 | 3300060353 | Bacteria | 7302 |
| 311 | Ga0501082_0108681 | 3300060353 | Bacteria | 2400 |
| 312 | Ga0530510_0023662 | 3300061734 | Bacteria | 4380 |
| 313 | Ga0530510_0042828 | 3300061734 | Bacteria | 3270 |
| 314 | 2537900346 | 2537561592 | Bacteria | 4348607 |
| 315 | 2547410355 | 2547132111 | Bacteria | 8013147 |
| 316 | 2548693710 | 2547132424 | Bacteria | 8348532 |
| 317 | 2552110117 | 2551306166 | Bacteria | 9731570 |
| 318 | 2644513443 | 2643221692 | Bacteria | 7282860 |
| 319 | 2691515515 | 2690315906 | Bacteria | 4517044 |
| 320 | 2738663848 | 2738541264 | Bacteria | 5935393 |
| 321 | 2739142983 | 2738541356 | Bacteria | 5935017 |
| 322 | 2739235337 | 2738543011 | Bacteria | 5731169 |
| 323 | 2753037590 | 2751185725 | Bacteria | 5740550 |
| 324 | 2753325458 | 2751185792 | Bacteria | 5739090 |
| 325 | 2774393024 | 2773857762 | Bacteria | 5971770 |
| 326 | 2775654771 | 2775506735 | Bacteria | 4556596 |
| 327 | 2776370824 | 2775506925 | Bacteria | 7237746 |
| 328 | 2784591697 | 2784132148 | Bacteria | 8627943 |
| 329 | 2804848954 | 2802429296 | Bacteria | 7227771 |
| 330 | 2808828003 | 2808606357 | Bacteria | 4466944 |
| 331 | 2808853359 | 2808606360 | Bacteria | 4404006 |
| 332 | 2808878145 | 2808606366 | Bacteria | 4415912 |
| 333 | 2808890997 | 2808606370 | Bacteria | 4942454 |
| 334 | 2808897347 | 2808606371 | Bacteria | 4251511 |
| 335 | 2809196670 | 2808606439 | Bacteria | 5952208 |
| 336 | 2809235324 | 2808606448 | Bacteria | 8656184 |
| 337 | 2809591077 | 2808606522 | Bacteria | 9488490 |
| 338 | 2812320237 | 2811994871 | Bacteria | 4497550 |
| 339 | 2827631569 | 2827628540 | Bacteria | 6858585 |
| 340 | 2837269630 | 2837268691 | Bacteria | 7850704 |
| 341 | 2856863645 | 2856858025 | Bacteria | 7255264 |
| 342 | 2861521391 | 2861520306 | Bacteria | 8348283 |
| 343 | 2862283340 | 2862281513 | Bacteria | 9621493 |
| 344 | 2862295985 | 2862290372 | Bacteria | 7471434 |
| 345 | 2863073133 | 2863067949 | Bacteria | 8541735 |
| 346 | 2863073210 | 2863067949 | Bacteria | 8541735 |
| 347 | 2866617901 | 2866612099 | Bacteria | 7543886 |
| 348 | 2873152838 | 2873151551 | Bacteria | 8625867 |
| 349 | 2883826440 | 2883821847 | Bacteria | 5121194 |
| 350 | 2884994218 | 2884994152 | Bacteria | 4492978 |
| 351 | 2889301665 | 2889300758 | Bacteria | 5690814 |
| 352 | 2893686043 | 2893684298 | Bacteria | 2897960 |
| 353 | 2899367877 | 2899359706 | Bacteria | 10940472 |
| 354 | 2902801065 | 2902799365 | Bacteria | 5419524 |
| 355 | 2912723640 | 2912715099 | Bacteria | 9460473 |
| 356 | 2919052551 | 2919051321 | Bacteria | 4210889 |
| 357 | 2919536566 | 2919534386 | Bacteria | 4577686 |
| 358 | 2919719069 | 2919713450 | Bacteria | 7431245 |
| 359 | 2920880640 | 2920879853 | Bacteria | 4216831 |
| 360 | 2920883211 | 2920879853 | Bacteria | 4216831 |
| 361 | 2928146570 | 2928142448 | Bacteria | 5288925 |
| 362 | 2939601985 | 2939598168 | Bacteria | 4687164 |
| 363 | 2939747611 | 2939743619 | Bacteria | 5762299 |
| 364 | 3006327632 | 3006321560 | Bacteria | 8247479 |
| 365 | 3006494276 | 3006493962 | Bacteria | 8825450 |
| 366 | 3006497645 | 3006493962 | Bacteria | 8825450 |
| 367 | 649814595 | 649633069 | Bacteria | 6962533 |
| 368 | 8003858346 | 8003856774 | Bacteria | 7675274 |
| 369 | 8004023557 | 8004021418 | Bacteria | 4313954 |
| 370 | 8004028382 | 8004025490 | Bacteria | 4327753 |
| 371 | 8023628806 | 8023623736 | Bacteria | 8593882 |
| 372 | 8025417564 | 8025413630 | Bacteria | 7014048 |
| 373 | 8056058928 | 8056054917 | Bacteria | 5736694 |
| 374 | 8056061579 | 8056060235 | Bacteria | 7259403 |
| 375 | 8056215376 | 8056207758 | Bacteria | 8639239 |
| 376 | Ga0105248_10163015 | |||
| 377 | Ga0007423J48922_100759 | |||
| 378 | Ga0006562J51391_1019106 | |||
| 379 | Ga0055540_1000224 | |||
| 380 | Ga0065714_10002995 | |||
| 381 | Ga0070658_10054766 | |||
| 382 | Ga0070676_10003874 | |||
| 383 | Ga0070683_100009449 | |||
| 384 | Ga0070683_100052994 | |||
| 385 | Ga0068869_100044502 | |||
| 386 | Ga0070666_10002686 | |||
| 387 | Ga0070680_100102517 | |||
| 388 | Ga0070682_100034276 | |||
| 389 | Ga0070668_100003230 | |||
| 390 | Ga0070669_100006735 | |||
| 391 | Ga0070675_100003512 | |||
| 392 | Ga0070671_100042875 | |||
| 393 | Ga0070667_100049824 | |||
| 394 | Ga0070713_100015605 | |||
| 395 | Ga0070678_100001262 | |||
| 396 | Ga0070678_100003008 | |||
| 397 | Ga0070662_100018888 | |||
| 398 | Ga0070681_10000818 | |||
| 399 | Ga0070679_100126154 | |||
| 400 | Ga0070684_100000087 | |||
| 401 | Ga0070684_100014559 | |||
| 402 | Ga0068853_100153315 | |||
| 403 | Ga0070672_100087122 | |||
| 404 | Ga0070686_100055927 | |||
| 405 | Ga0070693_100001021 | |||
| 406 | Ga0068855_100003922 | |||
| 407 | Ga0070664_100036071 | |||
| 408 | Ga0068856_100182406 | |||
| 409 | Ga0068852_100027303 | |||
| 410 | Ga0068864_100051307 | |||
| 411 | Ga0068861_100025364 | |||
| 412 | Ga0068863_100047666 | |||
| 413 | Ga0081455_10001405 | |||
| 414 | Ga0081455_10001616 | |||
| 415 | Ga0081455_10012183 | |||
| 416 | Ga0081455_10014115 | |||
| 417 | Ga0081455_10018253 | |||
| 418 | Ga0081455_10020183 | |||
| 419 | Ga0081455_10115105 | |||
| 420 | Ga0081538_10002619 | |||
| 421 | Ga0081538_10013097 | |||
| 422 | Ga0070717_10091258 | |||
| 423 | Ga0075363_100003920 | |||
| 424 | Ga0097621_100122424 | |||
| 425 | Ga0068871_100058417 | |||
| 426 | Ga0075431_100048515 | |||
| 427 | Ga0068865_100108257 | |||
| 428 | Ga0105251_10006813 | |||
| 429 | Ga0105244_10036481 | |||
| 430 | Ga0105240_10018129 | |||
| 431 | Ga0111539_10132162 | |||
| 432 | Ga0105245_10001441 | |||
| 433 | Ga0114129_10002100 | |||
| 434 | Ga0114129_10023615 | |||
| 435 | Ga0105243_10000921 | |||
| 436 | Ga0105243_10025147 | |||
| 437 | Ga0105241_10003494 | |||
| 438 | Ga0105241_10003691 | |||
| 439 | Ga0105241_10026085 | |||
| 440 | Ga0105248_10124619 | |||
| 441 | Ga0105237_10061230 | |||
| 442 | Ga0105237_10146871 | |||
| 443 | Ga0105237_10295380 | |||
| 444 | Ga0105238_10068675 | |||
| 445 | Ga0105239_10001318 | |||
| 446 | Ga0105239_10010801 | |||
| 447 | Ga0105239_10031466 | |||
| 448 | Ga0105246_10000827 | |||
| 449 | Ga0157373_10003357 | |||
| 450 | Ga0157369_10000499 | |||
| 451 | Ga0157369_10014543 | |||
| 452 | Ga0171462_1004 | |||
| 453 | Ga0157374_10031852 | |||
| 454 | Ga0157378_10138671 | |||
| 455 | Ga0157372_10013196 | |||
| 456 | Ga0157380_10015072 | |||
| 457 | Ga0157379_10010469 | |||
| 458 | Ga0183367_1001 | |||
| 459 | Ga0163161_10053869 | |||
| 460 | Ga0213875_10000111 | |||
| 461 | Ga0209051_1000014 | |||
| 462 | Ga0207697_10001155 | |||
| 463 | Ga0207655_1012131 | |||
| 464 | Ga0207682_10001933 | |||
| 465 | Ga0207710_10009283 | |||
| 466 | Ga0207688_10005403 | |||
| 467 | Ga0207647_10002646 | |||
| 468 | Ga0207643_10071211 | |||
| 469 | Ga0207705_10063650 | |||
| 470 | Ga0207707_10014943 | |||
| 471 | Ga0207707_10046692 | |||
| 472 | Ga0207695_10079064 | |||
| 473 | Ga0207671_10001563 | |||
| 474 | Ga0207660_10014047 | |||
| 475 | Ga0207662_10011473 | |||
| 476 | Ga0207657_10071553 | |||
| 477 | Ga0207652_10020501 | |||
| 478 | Ga0207694_10001726 | |||
| 479 | Ga0207650_10015817 | |||
| 480 | Ga0207687_10000719 | |||
| 481 | Ga0207690_10004881 | |||
| 482 | Ga0207709_10001004 | |||
| 483 | Ga0207709_10031875 | |||
| 484 | Ga0207704_10094143 | |||
| 485 | Ga0207691_10000237 | |||
| 486 | Ga0207691_10085821 | |||
| 487 | Ga0207711_10151826 | |||
| 488 | Ga0207689_10014728 | |||
| 489 | Ga0207661_10000222 | |||
| 490 | Ga0207661_10029980 | |||
| 491 | Ga0207661_10102886 | |||
| 492 | Ga0207667_10028416 | |||
| 493 | Ga0207651_10017506 | |||
| 494 | Ga0207668_10005544 | |||
| 495 | Ga0207668_10005865 | |||
| 496 | Ga0207658_10078509 | |||
| 497 | Ga0207639_10094973 | |||
| 498 | Ga0207678_10000601 | |||
| 499 | Ga0207708_10006134 | |||
| 500 | Ga0207702_10007937 | |||
| 501 | Ga0207674_10021160 | |||
| 502 | Ga0207674_10021769 | |||
| 503 | Ga0207675_100005802 | |||
| 504 | Ga0207675_100053684 | |||
| 505 | Ga0207683_10001134 | |||
| 506 | Ga0207683_10006261 | |||
| 507 | Ga0207683_10008083 | |||
| 508 | Ga0207683_10022038 | |||
| 509 | Ga0207698_10044044 | |||
| 510 | Ga0307515_10079363 | |||
| 511 | Ga0307512_10015875 | |||
| 512 | Ga0307512_10069889 | |||
| 513 | Ga0265327_10001755 | |||
| 514 | Ga0307408_100007514 | |||
| 515 | Ga0307408_100031341 | |||
| 516 | Ga0307508_10003253 | |||
| 517 | Ga0307405_10001158 | |||
| 518 | Ga0307413_10002422 | |||
| 519 | Ga0307518_10000100 | |||
| 520 | Ga0307410_10036149 | |||
| 521 | Ga0307406_10000068 | |||
| 522 | Ga0307406_10006749 | |||
| 523 | Ga0307406_10015235 | |||
| 524 | Ga0307406_10044130 | |||
| 525 | Ga0307407_10003621 | |||
| 526 | Ga0307407_10007350 | |||
| 527 | Ga0307407_10010148 | |||
| 528 | Ga0307412_10006147 | |||
| 529 | Ga0307409_100000475 | |||
| 530 | Ga0307409_100022973 | |||
| 531 | Ga0307409_100053365 | |||
| 532 | Ga0307409_100160280 | |||
| 533 | Ga0307409_100163461 | |||
| 534 | Ga0307416_100000212 | |||
| 535 | Ga0307416_100133054 | |||
| 536 | Ga0307416_100162241 | |||
| 537 | Ga0307416_100204638 | |||
| 538 | Ga0307414_10000982 | |||
| 539 | Ga0307414_10078961 | |||
| 540 | Ga0307411_10004079 | |||
| 541 | Ga0307415_100005294 | |||
| 542 | Ga0307415_100008531 | |||
| 543 | Ga0307415_100029087 | |||
| 544 | Ga0395899_0023220 | |||
| 545 | Ga0395900_0025496 | |||
| 546 | Ga0395905_0049727 | |||
| 547 | Ga0436364_0896364 | |||
| 548 | Ga0395901_0099790 | |||
| 549 | Ga0436365_0290884 | |||
| 550 | Ga0436365_1127254 | |||
| 551 | Ga0451789_0644700 | |||
| 552 | Ga0451793_0287747 | |||
| 553 | Ga0451843_1502008 | |||
| 554 | Ga0451853_0035046 | |||
| 555 | Ga0439440_0003793 | |||
| 556 | Ga0466965_0003121 | |||
| 557 | Ga0466963_0052383 | |||
| 558 | Ga0466967_0006934 | |||
| 559 | Ga0466967_0021675 | |||
| 560 | Ga0466967_0077051 | |||
| 561 | Ga0495603_0032464 | |||
| 562 | Ga0495641_0045479 | |||
| 563 | Ga0495651_0005384 | |||
| 564 | Ga0495580_0010950 | |||
| 565 | Ga0495582_0044188 | |||
| 566 | Ga0495582_0058489 | |||
| 567 | Ga0495639_0002917 | |||
| 568 | Ga0495664_0041658 | |||
| 569 | Ga0495594_0036809 | |||
| 570 | Ga0495631_0025632 | |||
| 571 | Ga0495652_0002330 | |||
| 572 | Ga0495665_0005931 | |||
| 573 | Ga0495588_0003123 | |||
| 574 | Ga0495588_0005945 | |||
| 575 | Ga0495657_0041502 | |||
| 576 | Ga0495613_0003422 | |||
| 577 | Ga0495600_0002163 | |||
| 578 | Ga0495604_0009447 | |||
| 579 | Ga0496100_0000043 | |||
| 580 | Ga0496101_0000149 | |||
| 581 | Ga0496102_0000999 | |||
| 582 | Ga0496102_0011546 | |||
| 583 | Ga0496102_0021949 | |||
| 584 | Ga0496102_0113422 | |||
| 585 | Ga0496102_0220651 | |||
| 586 | Ga0496103_0000152 | |||
| 587 | Ga0496104_0001347 | |||
| 588 | Ga0496104_0014573 | |||
| 589 | Ga0496105_0015737 | |||
| 590 | Ga0496106_0000382 | |||
| 591 | Ga0496107_0005787 | |||
| 592 | Ga0496108_0008087 | |||
| 593 | Ga0496108_0023810 | |||
| 594 | Ga0496109_0000194 | |||
| 595 | Ga0496109_0010297 | |||
| 596 | Ga0496110_0041003 | |||
| 597 | Ga0496111_0000753 | |||
| 598 | Ga0496111_0004274 | |||
| 599 | Ga0496111_0014288 | |||
| 600 | Ga0496111_0043511 | |||
| 601 | Ga0496112_0028222 | |||
| 602 | Ga0496112_0076684 | |||
| 603 | Ga0496113_0089969 | |||
| 604 | Ga0496114_0000340 | |||
| 605 | Ga0496114_0000548 | |||
| 606 | Ga0496114_0004467 | |||
| 607 | Ga0496115_0000409 | |||
| 608 | Ga0496115_0003608 | |||
| 609 | Ga0496115_0041904 | |||
| 610 | Ga0496116_0002353 | |||
| 611 | Ga0496117_0010318 | |||
| 612 | Ga0496118_0007789 | |||
| 613 | Ga0496119_0001288 | |||
| 614 | Ga0496121_0000048 | |||
| 615 | Ga0496122_0000301 | |||
| 616 | Ga0496123_0005449 | |||
| 617 | Ga0496124_0000044 | |||
| 618 | Ga0496125_0000037 | |||
| 619 | Ga0496126_0000046 | |||
| 620 | Ga0501031_0000082 | |||
| 621 | Ga0501031_0000943 | |||
| 622 | Ga0501031_0076762 | |||
| 623 | Ga0501032_0000035 | |||
| 624 | Ga0501032_0018886 | |||
| 625 | Ga0501032_0025297 | |||
| 626 | Ga0501033_0001072 | |||
| 627 | Ga0501033_0011969 | |||
| 628 | Ga0501034_0000190 | |||
| 629 | Ga0501034_0000925 | |||
| 630 | Ga0501034_0016699 | |||
| 631 | Ga0501036_0064564 | |||
| 632 | Ga0501037_0000370 | |||
| 633 | Ga0501037_0012252 | |||
| 634 | Ga0501038_0000172 | |||
| 635 | Ga0501038_0002149 | |||
| 636 | Ga0501039_0000269 | |||
| 637 | Ga0501039_0009667 | |||
| 638 | Ga0501039_0026637 | |||
| 639 | Ga0501040_0004011 | |||
| 640 | Ga0501041_0007529 | |||
| 641 | Ga0501043_0000231 | |||
| 642 | Ga0501043_0016614 | |||
| 643 | Ga0501043_0035829 | |||
| 644 | Ga0501046_0000279 | |||
| 645 | Ga0501046_0042807 | |||
| 646 | Ga0501046_0045946 | |||
| 647 | Ga0501047_0000458 | |||
| 648 | Ga0501047_0009777 | |||
| 649 | Ga0501047_0032117 | |||
| 650 | Ga0501047_0080451 | |||
| 651 | Ga0501048_0000048 | |||
| 652 | Ga0501048_0048891 | |||
| 653 | Ga0501067_0013010 | |||
| 654 | Ga0501067_0013822 | |||
| 655 | Ga0501068_0039061 | |||
| 656 | Ga0501069_0000741 | |||
| 657 | Ga0501070_0000504 | |||
| 658 | Ga0501070_0134870 | |||
| 659 | Ga0501071_0004265 | |||
| 660 | Ga0501071_0013790 | |||
| 661 | Ga0501071_0017328 | |||
| 662 | Ga0501072_0015720 | |||
| 663 | Ga0501072_0051571 | |||
| 664 | Ga0501073_0001049 | |||
| 665 | Ga0501074_0000061 | |||
| 666 | Ga0501076_0004327 | |||
| 667 | Ga0501077_0051419 | |||
| 668 | Ga0501079_0007986 | |||
| 669 | Ga0501079_0120159 | |||
| 670 | Ga0501079_0120520 | |||
| 671 | Ga0501080_0000160 | |||
| 672 | Ga0501083_0043626 | |||
| 673 | Ga0501035_0000404 | |||
| 674 | Ga0501044_0000129 | |||
| 675 | Ga0501044_0000439 | |||
| 676 | Ga0501045_0032927 | |||
| 677 | Ga0501045_0098591 | |||
| 678 | nmdc:mga05p37_3967_c1 | |||
| 679 | nmdc:mga06r32_17198_c1 | |||
| 680 | nmdc:mga06r32_375_c5 | |||
| 681 | Ga0500651_0037049 | |||
| 682 | Ga0501084_0002451 | |||
| 683 | Ga0501084_0009697 | |||
| 684 | Ga0501084_0059253 | |||
| 685 | Ga0501082_0012469 | |||
| 686 | Ga0501082_0108681 | |||
| 687 | Ga0530510_0023662 | |||
| 688 | Ga0530510_0042828 | |||
| 689 | 2537900346 | |||
| 690 | 2547410355 | |||
| 691 | 2548693710 | |||
| 692 | 2552110117 | |||
| 693 | 2644513443 | |||
| 694 | 2691515515 | |||
| 695 | 2738663848 | |||
| 696 | 2739142983 | |||
| 697 | 2739235337 | |||
| 698 | 2753037590 | |||
| 699 | 2753325458 | |||
| 700 | 2774393024 | |||
| 701 | 2775654771 | |||
| 702 | 2776370824 | |||
| 703 | 2784591697 | |||
| 704 | 2804848954 | |||
| 705 | 2808828003 | |||
| 706 | 2808853359 | |||
| 707 | 2808878145 | |||
| 708 | 2808890997 | |||
| 709 | 2808897347 | |||
| 710 | 2809196670 | |||
| 711 | 2809235324 | |||
| 712 | 2809591077 | |||
| 713 | 2812320237 | |||
| 714 | 2827631569 | |||
| 715 | 2837269630 | |||
| 716 | 2856863645 | |||
| 717 | 2861521391 | |||
| 718 | 2862283340 | |||
| 719 | 2862295985 | |||
| 720 | 2863073133 | |||
| 721 | 2863073210 | |||
| 722 | 2866617901 | |||
| 723 | 2873152838 | |||
| 724 | 2883826440 | |||
| 725 | 2884994218 | |||
| 726 | 2889301665 | |||
| 727 | 2893686043 | |||
| 728 | 2899367877 | |||
| 729 | 2902801065 | |||
| 730 | 2912723640 | |||
| 731 | 2919052551 | |||
| 732 | 2919536566 | |||
| 733 | 2919719069 | |||
| 734 | 2920880640 | |||
| 735 | 2920883211 | |||
| 736 | 2928146570 | |||
| 737 | 2939601985 | |||
| 738 | 2939747611 | |||
| 739 | 3006327632 | |||
| 740 | 3006494276 | |||
| 741 | 3006497645 | |||
| 742 | 649814595 | |||
| 743 | 8003858346 | |||
| 744 | 8004023557 | |||
| 745 | 8004028382 | |||
| 746 | 8023628806 | |||
| 747 | 8025417564 | |||
| 748 | 8056058928 | |||
| 749 | 8056061579 | |||
| 750 | 8056215376 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r27-assembly1.cif.gz_B | crystal structure of nargh complex | 0.624 | 1 | 469 |
| 1r27-assembly1.cif.gz_B | crystal structure of nargh complex | 0.6215 | 1 | 469 |
| 3ir5-assembly1.cif.gz_B | crystal structure of narghi mutant narg-h49c | 0.6098 | 1 | 496 |
| 3ir5-assembly1.cif.gz_B | crystal structure of narghi mutant narg-h49c | 0.5918 | 1 | 496 |
| 3egw-assembly1.cif.gz_B | the crystal structure of the narghi mutant narh - c16a | 0.5829 | 1 | 499 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P19318_241_361_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9307 | 244 | 360 | 3.30.70.20 |
| af_P19318_241_361_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8939 | 244 | 360 | 3.30.70.20 |
| 1y4zB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8767 | 246 | 469 | 3.30.70.20 |
| 1y4zB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7786 | 246 | 469 | 3.30.70.20 |
| af_O06560_187_241_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6284 | 188 | 242 | 3.30.70.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A380DWX5-F1-model_v4 | Respiratory nitrate reductase beta chain (EC 1.7.99.4) | 0.9699 | 269 | 359 |
GO:0009055
GO:0009061 GO:0016020 GO:0016491 GO:0030313 GO:0046872 GO:0051539 |
| AF-A0A5C5RJT0-F1-model_v4 | Nitrate reductase subunit beta | 0.9627 | 261 | 469 |
GO:0009055
GO:0009061 GO:0016020 GO:0030313 GO:0046872 GO:0051539 |
| AF-A0A377K8Q3-F1-model_v4 | Respiratory nitrate reductase 2 subunit beta (EC 1.7.99.4) | 0.9619 | 260 | 360 |
GO:0009055
GO:0009061 GO:0016020 GO:0016491 GO:0030313 GO:0046872 GO:0051539 |
| AF-A0A447U377-F1-model_v4 | Respiratory nitrate reductase 2 subunit beta (EC 1.7.99.4) | 0.9585 | 270 | 360 |
GO:0009055
GO:0009061 GO:0016020 GO:0016491 GO:0030313 GO:0046872 GO:0051539 |
| AF-A0A5C5RJT0-F1-model_v4 | Nitrate reductase subunit beta | 0.9279 | 261 | 469 |
GO:0009055
GO:0009061 GO:0016020 GO:0030313 GO:0046872 GO:0051539 |