F427019

General Info

Members Datasets Scaffolds Average Seq Length
375 228 371 158

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10010897|Ga0105247_100108974
Length 171
Sequence LAPRAEAHYLRLMGSECHHPDGAHPGLHGSVLQRALTVAEARCTATQERLTPPRRRVLQLLLEANAPLKAYDLIAVYGEPGVPAKPPTVYRALEFLERLGFAHRIESLNAYVPCRLAGETHSAAFLICDCCGTADEFEPDFQAQIAAADARGYDIRAVTLEVRGLCPACRA

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
200 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
213 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
222 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
225 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
226 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.27
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.27
Nodule 0.27
Rhizoplane 3.73
Rhizosphere 73.87
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1025612 3300002741 Bacteria 688
2 JGI25153J46596_10034885 3300003215 Bacteria 1637
3 Ga0055530_10001027 3300003791 Bacteria 22214
4 Ga0055531_10007760 3300003794 Bacteria 5785
5 Ga0065165_1000413 3300005262 Bacteria 67911
6 Ga0065165_1025996 3300005262 Bacteria 1934
7 Ga0065165_1040949 3300005262 Bacteria 1378
8 Ga0070658_10098364 3300005327 Bacteria 2417
9 Ga0070683_100893498 3300005329 Bacteria 852
10 Ga0070670_100000020 3300005331 Bacteria 215458
11 Ga0070670_100016359 3300005331 Bacteria 6370
12 Ga0070666_10116163 3300005335 Bacteria 1853
13 Ga0070666_10150747 3300005335 Bacteria 1622
14 Ga0070666_10348508 3300005335 Bacteria 1059
15 Ga0070666_10429590 3300005335 Bacteria 952
16 Ga0070666_10569288 3300005335 Bacteria 825
17 Ga0070680_100077277 3300005336 Bacteria 2742
18 Ga0068868_100102273 3300005338 Bacteria 2320
19 Ga0070660_100676296 3300005339 Bacteria 865
20 Ga0070668_100000108 3300005347 Bacteria 50828
21 Ga0070668_100005083 3300005347 Bacteria 9743
22 Ga0070669_100008310 3300005353 Bacteria 7412
23 Ga0070675_101163964 3300005354 Bacteria 710
24 Ga0070671_100022027 3300005355 Bacteria 5205
25 Ga0070671_100091626 3300005355 Bacteria 2546
26 Ga0070659_100776368 3300005366 Bacteria 832
27 Ga0070667_100000163 3300005367 Bacteria 83059
28 Ga0070667_100004064 3300005367 Bacteria 12375
29 Ga0070667_100006909 3300005367 Bacteria 9429
30 Ga0070663_100426154 3300005455 Bacteria 1089
31 Ga0070678_100066871 3300005456 Bacteria 2673
32 Ga0070662_100346721 3300005457 Bacteria 1216
33 Ga0070681_10170000 3300005458 Bacteria 2102
34 Ga0070698_100701523 3300005471 Bacteria 954
35 Ga0070679_100269795 3300005530 Bacteria 1656
36 Ga0068853_100268392 3300005539 Bacteria 1571
37 Ga0068853_100515538 3300005539 Bacteria 1130
38 Ga0070665_100000441 3300005548 Bacteria 60634
39 Ga0070665_100001115 3300005548 Bacteria 33073
40 Ga0070665_100053931 3300005548 Bacteria 4032
41 Ga0070665_100058690 3300005548 Bacteria 3857
42 Ga0068855_100174189 3300005563 Bacteria 2435
43 Ga0068855_100278618 3300005563 Bacteria 1858
44 Ga0070664_100333902 3300005564 Bacteria 1376
45 Ga0068856_101047178 3300005614 Bacteria 834
46 Ga0068859_100000671 3300005617 Bacteria 34266
47 Ga0068859_100159713 3300005617 Bacteria 2333
48 Ga0068864_100000071 3300005618 Bacteria 111481
49 Ga0068864_100220377 3300005618 Bacteria 1750
50 Ga0068861_100140563 3300005719 Bacteria 1970
51 Ga0068870_10532599 3300005840 Bacteria 788
52 Ga0068863_100000037 3300005841 Bacteria 162638
53 Ga0068863_100000451 3300005841 Bacteria 41841
54 Ga0068863_100021083 3300005841 Bacteria 6224
55 Ga0068863_100124153 3300005841 Bacteria 2463
56 Ga0068858_100000029 3300005842 Bacteria 144691
57 Ga0068858_100002275 3300005842 Bacteria 19425
58 Ga0068858_100006867 3300005842 Bacteria 11061
59 Ga0068858_100273687 3300005842 Bacteria 1607
60 Ga0068858_101539886 3300005842 Bacteria 656
61 Ga0068860_100001003 3300005843 Bacteria 31241
62 Ga0068860_100024705 3300005843 Bacteria 5803
63 Ga0068862_100001526 3300005844 Bacteria 21211
64 Ga0068862_100009403 3300005844 Bacteria 8086
65 Ga0070717_10017847 3300006028 Bacteria 5532
66 Ga0075368_10004613 3300006042 Bacteria 4684
67 Ga0075364_10020776 3300006051 Bacteria 4132
68 Ga0075369_10135700 3300006186 Bacteria 1120
69 Ga0097621_100674305 3300006237 Bacteria 950
70 Ga0075370_10044701 3300006353 Bacteria 2504
71 Ga0075370_10137822 3300006353 Bacteria 1426
72 Ga0097620_100000671 3300006931 Bacteria 34266
73 Ga0097620_100159714 3300006931 Bacteria 2333
74 Ga0079104_1011613 3300006946 Bacteria 2820
75 Ga0105251_10245690 3300009011 Bacteria 806
76 Ga0105250_10010104 3300009092 Bacteria 3940
77 Ga0105240_10010073 3300009093 Bacteria 13307
78 Ga0105240_10056843 3300009093 Bacteria 4894
79 Ga0105240_10095217 3300009093 Bacteria 3631
80 Ga0105245_10521686 3300009098 Bacteria 1207
81 Ga0105247_10010897 3300009101 Bacteria 5492
82 Ga0105247_10089876 3300009101 Bacteria 1948
83 Ga0105241_10236207 3300009174 Bacteria 1543
84 Ga0105248_10003631 3300009177 Bacteria 17121
85 Ga0105248_10010680 3300009177 Bacteria 10131
86 Ga0105248_10016560 3300009177 Bacteria 8118
87 Ga0105248_10065640 3300009177 Bacteria 4075
88 Ga0105248_10130271 3300009177 Bacteria 2837
89 Ga0105248_10195884 3300009177 Bacteria 2276
90 Ga0105248_10326723 3300009177 Bacteria 1728
91 Ga0105238_10034198 3300009551 Bacteria 5172
92 Ga0105238_10134611 3300009551 Bacteria 2449
93 Ga0105238_10208917 3300009551 Bacteria 1928
94 Ga0105249_10000792 3300009553 Bacteria 28363
95 Ga0105249_10295623 3300009553 Bacteria 1622
96 Ga0105239_10635125 3300010375 Bacteria 1219
97 Ga0105239_11735400 3300010375 Bacteria 723
98 Ga0105239_12691809 3300010375 Bacteria 580
99 Ga0157373_10003885 3300013100 Bacteria 11291
100 Ga0157370_10152054 3300013104 Bacteria 2153
101 Ga0157370_10413092 3300013104 Bacteria 1242
102 Ga0157374_10741499 3300013296 Bacteria 997
103 Ga0157378_10987766 3300013297 Bacteria 876
104 Ga0163162_10238020 3300013306 Bacteria 1951
105 Ga0157372_10015498 3300013307 Bacteria 8172
106 Ga0157375_10215194 3300013308 Bacteria 2079
107 Ga0163163_10002745 3300014325 Bacteria 14860
108 Ga0163163_10080460 3300014325 Bacteria 3258
109 Ga0163163_10158362 3300014325 Bacteria 2309
110 Ga0163163_10268839 3300014325 Bacteria 1756
111 Ga0163163_12127133 3300014325 Bacteria 621
112 Ga0157380_10636732 3300014326 Bacteria 1061
113 Ga0157379_10000579 3300014968 Bacteria 29639
114 Ga0157379_10032944 3300014968 Bacteria 4620
115 Ga0157379_10054090 3300014968 Bacteria 3587
116 Ga0157379_11789979 3300014968 Bacteria 603
117 Ga0157376_10818814 3300014969 Bacteria 945
118 Ga0163161_11102508 3300017792 Bacteria 682
119 Ga0206353_11242593 3300020082 Bacteria 640
120 Ga0213876_10019194 3300021384 Bacteria 3610
121 Ga0209026_1000474 3300025250 Bacteria 30684
122 Ga0209026_1022919 3300025250 Bacteria 954
123 Ga0209148_1002910 3300025254 Bacteria 5217
124 Ga0209758_1004816 3300025297 Bacteria 10893
125 Ga0209050_1000029 3300025298 Bacteria 465801
126 Ga0209257_1000152 3300025304 Bacteria 189432
127 Ga0209257_1000660 3300025304 Bacteria 54233
128 Ga0207713_1133657 3300025735 Bacteria 817
129 Ga0207710_10008377 3300025900 Bacteria 4361
130 Ga0207710_10168419 3300025900 Bacteria 1070
131 Ga0207680_10075806 3300025903 Bacteria 2099
132 Ga0207680_10144520 3300025903 Bacteria 1580
133 Ga0207680_10152048 3300025903 Bacteria 1544
134 Ga0207680_10318754 3300025903 Bacteria 1087
135 Ga0207705_10073434 3300025909 Bacteria 2482
136 Ga0207654_10469742 3300025911 Bacteria 885
137 Ga0207707_10109839 3300025912 Bacteria 2410
138 Ga0207695_10008153 3300025913 Bacteria 13172
139 Ga0207695_10045603 3300025913 Bacteria 4652
140 Ga0207695_10100658 3300025913 Bacteria 2885
141 Ga0207695_10300377 3300025913 Bacteria 1497
142 Ga0207671_10747390 3300025914 Bacteria 777
143 Ga0207652_10758731 3300025921 Bacteria 863
144 Ga0207681_10012022 3300025923 Bacteria 5332
145 Ga0207694_10010971 3300025924 Bacteria 6842
146 Ga0207694_10299789 3300025924 Bacteria 1323
147 Ga0207694_10394671 3300025924 Bacteria 1150
148 Ga0207650_10000175 3300025925 Bacteria 75521
149 Ga0207650_10499814 3300025925 Bacteria 1016
150 Ga0207650_10611520 3300025925 Bacteria 917
151 Ga0207687_10478567 3300025927 Bacteria 1036
152 Ga0207644_10029877 3300025931 Bacteria 3783
153 Ga0207644_10158429 3300025931 Bacteria 1757
154 Ga0207644_10178465 3300025931 Bacteria 1663
155 Ga0207706_10063615 3300025933 Bacteria 3248
156 Ga0207711_10000978 3300025941 Bacteria 27393
157 Ga0207711_10001642 3300025941 Bacteria 20636
158 Ga0207711_10003500 3300025941 Bacteria 13594
159 Ga0207711_10032153 3300025941 Bacteria 4436
160 Ga0207711_10073485 3300025941 Bacteria 2972
161 Ga0207711_10682129 3300025941 Bacteria 958
162 Ga0207711_11408344 3300025941 Bacteria 640
163 Ga0207661_11166549 3300025944 Bacteria 709
164 Ga0207667_10300818 3300025949 Bacteria 1639
165 Ga0207667_10426759 3300025949 Bacteria 1348
166 Ga0207667_10749283 3300025949 Bacteria 976
167 Ga0207651_10037154 3300025960 Bacteria 3188
168 Ga0207712_10000376 3300025961 Bacteria 39304
169 Ga0207668_10000001 3300025972 Bacteria 266091
170 Ga0207668_10000123 3300025972 Bacteria 54467
171 Ga0207658_10000118 3300025986 Bacteria 87228
172 Ga0207658_10006171 3300025986 Bacteria 8181
173 Ga0207658_10009958 3300025986 Bacteria 6460
174 Ga0207703_10000079 3300026035 Bacteria 112451
175 Ga0207703_10002421 3300026035 Bacteria 16199
176 Ga0207703_10002470 3300026035 Bacteria 16035
177 Ga0207703_10537367 3300026035 Bacteria 1101
178 Ga0207703_11135033 3300026035 Bacteria 751
179 Ga0207639_10041264 3300026041 Bacteria 3451
180 Ga0207678_10765829 3300026067 Bacteria 851
181 Ga0207702_10970906 3300026078 Bacteria 843
182 Ga0207641_10000034 3300026088 Bacteria 217752
183 Ga0207641_10001419 3300026088 Bacteria 23630
184 Ga0207641_10007520 3300026088 Bacteria 9066
185 Ga0207641_10104924 3300026088 Bacteria 2496
186 Ga0207641_10235200 3300026088 Bacteria 1705
187 Ga0207641_10274819 3300026088 Bacteria 1582
188 Ga0207641_11037919 3300026088 Bacteria 817
189 Ga0207676_10000376 3300026095 Bacteria 38031
190 Ga0207676_10000506 3300026095 Bacteria 32940
191 Ga0207676_10053642 3300026095 Bacteria 3156
192 Ga0207675_100039063 3300026118 Bacteria 4429
193 Ga0207675_100052311 3300026118 Bacteria 3811
194 Ga0207675_100350426 3300026118 Bacteria 1447
195 Ga0207675_100660415 3300026118 Bacteria 1052
196 Ga0207683_10066175 3300026121 Bacteria 3186
197 Ga0207698_11434861 3300026142 Bacteria 705
198 Ga0268266_10001669 3300028379 Bacteria 25581
199 Ga0268266_10008699 3300028379 Bacteria 9000
200 Ga0268266_10039683 3300028379 Bacteria 4010
201 Ga0268266_10711177 3300028379 Bacteria 968
202 Ga0268265_10000901 3300028380 Bacteria 27588
203 Ga0268265_10263523 3300028380 Bacteria 1533
204 Ga0268264_10000481 3300028381 Bacteria 53088
205 Ga0268264_10028199 3300028381 Bacteria 4591
206 Ga0307517_10001099 3300028786 Bacteria 45677
207 Ga0307517_10038132 3300028786 Bacteria 5338
208 Ga0265327_10002690 3300031251 Bacteria 18258
209 Ga0265327_10015586 3300031251 Bacteria 4894
210 Ga0307513_10000348 3300031456 Bacteria 67217
211 Ga0307513_10001617 3300031456 Bacteria 32329
212 Ga0307513_10003966 3300031456 Bacteria 19876
213 Ga0307513_10020347 3300031456 Bacteria 7875
214 Ga0307513_10565712 3300031456 Bacteria 848
215 Ga0307508_10456057 3300031616 Bacteria 871
216 Ga0307413_10628714 3300031824 Bacteria 882
217 Ga0307416_100920855 3300032002 Bacteria 975
218 Ga0307414_11225234 3300032004 Bacteria 695
219 Ga0307411_10445556 3300032005 Bacteria 1082
220 Ga0307510_10472250 3300033180 Bacteria 696
221 Ga0373926_0257695 3300035083 Bacteria 677
222 Ga0373944_0029065 3300035089 Bacteria 1650
223 Ga0373936_0002059 3300035113 Bacteria 7453
224 Ga0373939_0174891 3300035114 Bacteria 797
225 Ga0373927_0000622 3300035695 Bacteria 26882
226 Ga0373947_0098964 3300035725 Bacteria 1830
227 Ga0373937_0658299 3300036401 Bacteria 993
228 Ga0373925_0000067 3300037068 Bacteria 110348
229 Ga0373925_0368368 3300037068 Bacteria 1169
230 Ga0395899_0000095 3300037312 Bacteria 152790
231 Ga0395900_0000006 3300037418 Bacteria 495364
232 Ga0395898_0006778 3300037466 Bacteria 12192
233 Ga0395898_1220744 3300037466 Bacteria 683
234 Ga0395905_0003726 3300037471 Bacteria 16150
235 Ga0395905_0143876 3300037471 Bacteria 2243
236 Ga0395905_0793710 3300037471 Bacteria 850
237 Ga0395905_1431718 3300037471 Bacteria 595
238 Ga0395901_0000001 3300038443 Bacteria 800383
239 Ga0395901_0392885 3300038443 Bacteria 1426
240 Ga0436365_1082675 3300039437 Bacteria 4050
241 Ga0436360_0911673 3300039438 Bacteria 1881
242 Ga0495629_0113986 3300046459 Bacteria 1884
243 Ga0495638_0567983 3300046460 Bacteria 561
244 Ga0495664_0638120 3300046477 Bacteria 632
245 Ga0495585_0162522 3300046492 Bacteria 1158
246 Ga0495585_0502401 3300046492 Bacteria 576
247 Ga0495583_0025976 3300046506 Bacteria 2914
248 Ga0495606_0326545 3300046507 Bacteria 822
249 Ga0495620_0135121 3300046515 Bacteria 966
250 Ga0495620_0184010 3300046515 Bacteria 807
251 Ga0495628_0372786 3300046516 Bacteria 1046
252 Ga0495630_0570134 3300046517 Bacteria 868
253 Ga0495631_0301432 3300046518 Bacteria 682
254 Ga0495637_0092500 3300046520 Bacteria 1191
255 Ga0495643_0014348 3300046522 Bacteria 4715
256 Ga0495642_0003606 3300046528 Bacteria 6084
257 Ga0495642_0107407 3300046528 Bacteria 1191
258 Ga0495621_0096014 3300046539 Bacteria 1123
259 Ga0495621_0219052 3300046539 Bacteria 770
260 Ga0495597_0002477 3300046542 Bacteria 11654
261 Ga0495622_0004680 3300046557 Bacteria 6347
262 Ga0495668_0072153 3300046616 Bacteria 1897
263 Ga0495668_0080688 3300046616 Bacteria 1785
264 Ga0495668_0126331 3300046616 Bacteria 1400
265 Ga0495668_0129365 3300046616 Bacteria 1382
266 Ga0495668_0236027 3300046616 Bacteria 1001
267 Ga0495668_0244274 3300046616 Bacteria 983
268 Ga0495668_0503747 3300046616 Bacteria 667
269 Ga0495611_0070074 3300046648 Bacteria 1602
270 Ga0495625_0131739 3300046660 Bacteria 1693
271 Ga0495625_0316696 3300046660 Bacteria 994
272 Ga0495625_0547856 3300046660 Bacteria 701
273 Ga0495659_0440278 3300046664 Bacteria 566
274 Ga0495669_0000020 3300046684 Bacteria 122868
275 Ga0495669_0000449 3300046684 Bacteria 19393
276 Ga0495669_0089716 3300046684 Bacteria 1418
277 Ga0495613_0417457 3300046689 Bacteria 913
278 Ga0495670_0318958 3300046691 Bacteria 834
279 Ga0495670_0390287 3300046691 Bacteria 752
280 Ga0495581_0494902 3300047315 Bacteria 711
281 Ga0495636_0118427 3300047318 Bacteria 1170
282 Ga0495674_0431987 3300047319 Bacteria 1060
283 Ga0495672_0083204 3300047320 Bacteria 1778
284 Ga0495672_0401543 3300047320 Bacteria 627
285 Ga0495687_046504 3300047443 Bacteria 1873
286 Ga0495677_0041697 3300047445 Bacteria 1680
287 Ga0495677_0085034 3300047445 Bacteria 1188
288 Ga0495685_076012 3300047447 Bacteria 1122
289 Ga0495681_0072148 3300047470 Bacteria 1562
290 Ga0495686_0027535 3300047472 Bacteria 3709
291 Ga0495593_0010957 3300047673 Bacteria 5221
292 Ga0495602_0177073 3300048088 Bacteria 1649
293 Ga0496101_0553116 3300048904 Bacteria 910
294 Ga0496101_0582214 3300048904 Bacteria 885
295 Ga0496101_0595693 3300048904 Bacteria 874
296 Ga0496102_0119738 3300048905 Bacteria 2458
297 Ga0496106_0177938 3300048909 Bacteria 1688
298 Ga0496106_0210667 3300048909 Bacteria 1548
299 Ga0496108_0071538 3300048911 Bacteria 2927
300 Ga0496109_0055818 3300048912 Bacteria 3603
301 Ga0496110_0283733 3300048913 Bacteria 1508
302 Ga0496110_1020006 3300048913 Bacteria 735
303 Ga0496111_0216791 3300048914 Bacteria 1422
304 Ga0496115_0001146 3300048918 Bacteria 19143
305 Ga0496115_0141478 3300048918 Bacteria 1985
306 Ga0496115_0443361 3300048918 Bacteria 1049
307 Ga0496117_0017711 3300048920 Bacteria 5941
308 Ga0496118_0177518 3300048921 Bacteria 1291
309 Ga0496120_0161393 3300048923 Bacteria 1117
310 Ga0496121_0000130 3300048924 Bacteria 168094
311 Ga0495682_0068117 3300049460 Bacteria 1282
312 Ga0501032_0384548 3300049569 Bacteria 902
313 Ga0501033_0040462 3300049570 Bacteria 3479
314 Ga0501034_0489749 3300049571 Bacteria 1144
315 Ga0501034_0910664 3300049571 Bacteria 767
316 Ga0501047_0000825 3300049581 Bacteria 32128
317 Ga0501047_0111604 3300049581 Bacteria 2617
318 Ga0501047_0214299 3300049581 Bacteria 1783
319 Ga0501048_0159793 3300049582 Bacteria 1594
320 Ga0501048_0589614 3300049582 Bacteria 798
321 Ga0501080_1116490 3300049742 Bacteria 680
322 Ga0501035_0333203 3300049822 Bacteria 1273
323 Ga0501044_0009009 3300049823 Bacteria 10914
324 Ga0501044_0086941 3300049823 Bacteria 3158
325 Ga0501044_0540508 3300049823 Bacteria 1063
326 nmdc:mga00v17_2280_c1 3300050491 Bacteria 9840
327 nmdc:mga0k408_101762_c1 3300050493 Bacteria 1694
328 nmdc:mga06z11_97560_c1 3300050494 Bacteria 1607
329 nmdc:mga04h51_95263_c1 3300050495 Bacteria 1077
330 nmdc:mga07m45_1914_c1 3300050496 Bacteria 9617
331 nmdc:mga0sz30_124900_c1 3300050516 Bacteria 1132
332 Ga0495601_0457874 3300053077 Bacteria 825
333 Ga0500635_0000328 3300053080 Bacteria 16376
334 Ga0500578_0250265 3300053086 Bacteria 1068
335 Ga0500643_001289 3300053087 Bacteria 14770
336 Ga0500643_025236 3300053087 Bacteria 1877
337 Ga0500647_0096207 3300053091 Bacteria 1416
338 Ga0500651_0278724 3300053093 Bacteria 965
339 Ga0500566_0229716 3300053094 Bacteria 916
340 Ga0500641_0095903 3300053096 Bacteria 1269
341 Ga0500555_021013 3300053103 Bacteria 1880
342 Ga0500555_110432 3300053103 Bacteria 692
343 Ga0500556_0011407 3300053104 Bacteria 2632
344 Ga0500562_000461 3300053108 Bacteria 9854
345 Ga0500562_003674 3300053108 Bacteria 3854
346 Ga0500569_029265 3300053109 Bacteria 1533
347 Ga0500572_205786 3300053111 Bacteria 644
348 Ga0500595_037514 3300053119 Bacteria 1580
349 Ga0500595_040602 3300053119 Bacteria 1499
350 Ga0500607_106005 3300053121 Bacteria 1387
351 Ga0500608_001574 3300053122 Bacteria 8182
352 Ga0500608_041069 3300053122 Bacteria 2218
353 Ga0500614_001953 3300053123 Bacteria 4732
354 Ga0500642_0046847 3300053130 Bacteria 1892
355 Ga0500658_0095679 3300053134 Bacteria 1290
356 Ga0500559_0031621 3300053136 Bacteria 2271
357 Ga0500559_0123479 3300053136 Bacteria 1205
358 Ga0500577_0444043 3300053142 Bacteria 567
359 Ga0500590_084300 3300053148 Bacteria 1555
360 Ga0500616_0151720 3300053153 Bacteria 1072
361 Ga0500619_025601 3300053154 Bacteria 1749
362 Ga0500638_091524 3300053162 Bacteria 1431
363 Ga0500636_0086749 3300053177 Bacteria 1797
364 Ga0500636_0096453 3300053177 Bacteria 1687
365 Ga0500637_0113746 3300053178 Bacteria 1569
366 Ga0500637_0125061 3300053178 Bacteria 1491
367 Ga0500576_062057 3300053725 Bacteria 1632
368 Ga0500625_077787 3300053729 Bacteria 1456
369 Ga0500645_002611 3300053730 Bacteria 7899
370 Ga0500645_160443 3300053730 Bacteria 617
371 Ga0500596_002173 3300053735 Bacteria 3885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053103 Ga0500555_110432 Ga0500555_110432_229_636 134
2 3300053142 Ga0500577_0444043 Ga0500577_0444043_10_420 136
3 3300031251 Ga0265327_10015586 Ga0265327_100155868 140
4 3300005336 Ga0070680_100077277 Ga0070680_1000772772 146
5 3300013104 Ga0157370_10413092 Ga0157370_104130922 146
6 3300020082 Ga0206353_11242593 Ga0206353_112425931 146
7 3300031616 Ga0307508_10456057 Ga0307508_104560571 146
8 3300046459 Ga0495629_0113986 Ga0495629_0113986_461_904 146
9 3300046507 Ga0495606_0326545 Ga0495606_0326545_65_508 146
10 3300046515 Ga0495620_0135121 Ga0495620_0135121_369_812 146
11 3300046518 Ga0495631_0301432 Ga0495631_0301432_206_649 146
12 3300046520 Ga0495637_0092500 Ga0495637_0092500_475_918 146
13 3300046522 Ga0495643_0014348 Ga0495643_0014348_2882_3325 146
14 3300046542 Ga0495597_0002477 Ga0495597_0002477_654_1097 146
15 3300046557 Ga0495622_0004680 Ga0495622_0004680_3336_3779 146
16 3300046616 Ga0495668_0072153 Ga0495668_0072153_1027_1470 146
17 3300047443 Ga0495687_046504 Ga0495687_046504_235_678 146
18 3300047673 Ga0495593_0010957 Ga0495593_0010957_3497_3940 146
19 3300048088 Ga0495602_0177073 Ga0495602_0177073_607_1050 146
20 3300049460 Ga0495682_0068117 Ga0495682_0068117_468_911 146
21 3300053086 Ga0500578_0250265 Ga0500578_0250265_435_878 146
22 3300053094 Ga0500566_0229716 Ga0500566_0229716_216_659 146
23 3300053109 Ga0500569_029265 Ga0500569_029265_593_1036 146
24 3300053111 Ga0500572_205786 Ga0500572_205786_174_617 146
25 3300053119 Ga0500595_040602 Ga0500595_040602_615_1058 146
26 3300053122 Ga0500608_001574 Ga0500608_001574_7131_7574 146
27 3300053123 Ga0500614_001953 Ga0500614_001953_3663_4106 146
28 3300053130 Ga0500642_0046847 Ga0500642_0046847_1319_1762 146
29 3300053134 Ga0500658_0095679 Ga0500658_0095679_288_731 146
30 3300053136 Ga0500559_0031621 Ga0500559_0031621_1208_1651 146
31 3300053148 Ga0500590_084300 Ga0500590_084300_615_1058 146
32 3300053153 Ga0500616_0151720 Ga0500616_0151720_134_577 146
33 3300053154 Ga0500619_025601 Ga0500619_025601_679_1122 146
34 3300053177 Ga0500636_0096453 Ga0500636_0096453_626_1069 146
35 3300053178 Ga0500637_0113746 Ga0500637_0113746_455_898 146
36 3300053725 Ga0500576_062057 Ga0500576_062057_261_704 146
37 3300053729 Ga0500625_077787 Ga0500625_077787_609_1052 146
38 3300053730 Ga0500645_160443 Ga0500645_160443_91_534 146
39 3300053735 Ga0500596_002173 Ga0500596_002173_636_1079 146
40 3300053077 Ga0495601_0457874 Ga0495601_0457874_161_646 148
41 3300003215 JGI25153J46596_10034885 JGI25153J46596_100348852 150
42 3300003791 Ga0055530_10001027 Ga0055530_1000102720 150
43 3300003794 Ga0055531_10007760 Ga0055531_100077603 150
44 3300025297 Ga0209758_1004816 Ga0209758_10048164 150
45 3300025298 Ga0209050_1000029 Ga0209050_1000029144 150
46 3300025304 Ga0209257_1000152 Ga0209257_1000152172 150
47 3300037471 Ga0395905_1431718 Ga0395905_1431718_68_544 150
48 3300025900 Ga0207710_10168419 Ga0207710_101684192 151
49 3300014325 Ga0163163_12127133 Ga0163163_121271331 153
50 3300026118 Ga0207675_100660415 Ga0207675_1006604152 153
51 3300031824 Ga0307413_10628714 Ga0307413_106287142 153
52 3300032004 Ga0307414_11225234 Ga0307414_112252342 153
53 3300032005 Ga0307411_10445556 Ga0307411_104455562 153
54 3300046616 Ga0495668_0244274 Ga0495668_0244274_413_895 153
55 3300047472 Ga0495686_0027535 Ga0495686_0027535_2427_2909 153
56 3300053119 Ga0500595_037514 Ga0500595_037514_738_1220 153
57 3300005262 Ga0065165_1025996 Ga0065165_10259962 154
58 3300006353 Ga0075370_10137822 Ga0075370_101378222 154
59 3300046616 Ga0495668_0129365 Ga0495668_0129365_856_1338 154
60 3300046539 Ga0495621_0096014 Ga0495621_0096014_308_790 155
61 3300053730 Ga0500645_002611 Ga0500645_002611_177_659 155
62 iso_pu_bacteria 2643221598 2643999970 155
63 iso_pu_bacteria 2643221614 2644088398 155
64 iso_pu_bacteria 2643221661 2644343634 155
65 iso_pu_bacteria 2643221666 2644368888 155
66 3300005539 Ga0068853_100268392 Ga0068853_1002683922 156
67 3300005539 Ga0068853_100515538 Ga0068853_1005155383 156
68 3300013100 Ga0157373_10003885 Ga0157373_1000388510 156
69 3300026041 Ga0207639_10041264 Ga0207639_100412644 156
70 3300039438 Ga0436360_0911673 Ga0436360_0911673_1312_1785 156
71 3300049571 Ga0501034_0489749 Ga0501034_0489749_644_1117 156
72 3300005335 Ga0070666_10569288 Ga0070666_105692881 157
73 3300005338 Ga0068868_100102273 Ga0068868_1001022732 157
74 3300005354 Ga0070675_101163964 Ga0070675_1011639641 157
75 3300005355 Ga0070671_100091626 Ga0070671_1000916262 157
76 3300005455 Ga0070663_100426154 Ga0070663_1004261542 157
77 3300005456 Ga0070678_100066871 Ga0070678_1000668712 157
78 3300005457 Ga0070662_100346721 Ga0070662_1003467212 157
79 3300005458 Ga0070681_10170000 Ga0070681_101700003 157
80 3300005548 Ga0070665_100058690 Ga0070665_1000586905 157
81 3300005563 Ga0068855_100174189 Ga0068855_1001741893 157
82 3300005563 Ga0068855_100278618 Ga0068855_1002786183 157
83 3300005564 Ga0070664_100333902 Ga0070664_1003339022 157
84 3300006028 Ga0070717_10017847 Ga0070717_100178475 157
85 3300006237 Ga0097621_100674305 Ga0097621_1006743052 157
86 3300006946 Ga0079104_1011613 Ga0079104_10116133 157
87 3300009093 Ga0105240_10056843 Ga0105240_100568433 157
88 3300009177 Ga0105248_10195884 Ga0105248_101958843 157
89 3300009551 Ga0105238_10208917 Ga0105238_102089172 157
90 3300010375 Ga0105239_12691809 Ga0105239_126918091 157
91 3300013104 Ga0157370_10152054 Ga0157370_101520542 157
92 3300013297 Ga0157378_10987766 Ga0157378_109877661 157
93 3300013307 Ga0157372_10015498 Ga0157372_100154985 157
94 3300013308 Ga0157375_10215194 Ga0157375_102151942 157
95 3300014969 Ga0157376_10818814 Ga0157376_108188142 157
96 3300025903 Ga0207680_10144520 Ga0207680_101445202 157
97 3300025912 Ga0207707_10109839 Ga0207707_101098392 157
98 3300025913 Ga0207695_10045603 Ga0207695_100456034 157
99 3300025924 Ga0207694_10394671 Ga0207694_103946712 157
100 3300025925 Ga0207650_10611520 Ga0207650_106115202 157
101 3300025931 Ga0207644_10158429 Ga0207644_101584291 157
102 3300025931 Ga0207644_10178465 Ga0207644_101784652 157
103 3300025933 Ga0207706_10063615 Ga0207706_100636152 157
104 3300025941 Ga0207711_10682129 Ga0207711_106821292 157
105 3300025941 Ga0207711_11408344 Ga0207711_114083441 157
106 3300025949 Ga0207667_10426759 Ga0207667_104267592 157
107 3300025949 Ga0207667_10749283 Ga0207667_107492832 157
108 3300025960 Ga0207651_10037154 Ga0207651_100371542 157
109 3300026035 Ga0207703_10537367 Ga0207703_105373672 157
110 3300026067 Ga0207678_10765829 Ga0207678_107658291 157
111 3300026088 Ga0207641_10235200 Ga0207641_102352002 157
112 3300026088 Ga0207641_10274819 Ga0207641_102748192 157
113 3300026121 Ga0207683_10066175 Ga0207683_100661755 157
114 3300028379 Ga0268266_10711177 Ga0268266_107111772 157
115 3300028786 Ga0307517_10038132 Ga0307517_100381324 157
116 3300046477 Ga0495664_0638120 Ga0495664_0638120_71_547 157
117 3300046492 Ga0495585_0162522 Ga0495585_0162522_81_557 157
118 3300046492 Ga0495585_0502401 Ga0495585_0502401_12_488 157
119 3300046506 Ga0495583_0025976 Ga0495583_0025976_2201_2677 157
120 3300046515 Ga0495620_0184010 Ga0495620_0184010_77_553 157
121 3300046528 Ga0495642_0003606 Ga0495642_0003606_2700_3176 157
122 3300046528 Ga0495642_0107407 Ga0495642_0107407_661_1137 157
123 3300046539 Ga0495621_0219052 Ga0495621_0219052_121_597 157
124 3300046616 Ga0495668_0080688 Ga0495668_0080688_1262_1738 157
125 3300046616 Ga0495668_0126331 Ga0495668_0126331_497_973 157
126 3300046616 Ga0495668_0236027 Ga0495668_0236027_87_563 157
127 3300046616 Ga0495668_0503747 Ga0495668_0503747_95_571 157
128 3300046648 Ga0495611_0070074 Ga0495611_0070074_407_883 157
129 3300046660 Ga0495625_0547856 Ga0495625_0547856_53_529 157
130 3300046664 Ga0495659_0440278 Ga0495659_0440278_47_523 157
131 3300046684 Ga0495669_0089716 Ga0495669_0089716_416_892 157
132 3300046689 Ga0495613_0417457 Ga0495613_0417457_59_535 157
133 3300046691 Ga0495670_0318958 Ga0495670_0318958_291_767 157
134 3300046691 Ga0495670_0390287 Ga0495670_0390287_13_489 157
135 3300047315 Ga0495581_0494902 Ga0495581_0494902_220_696 157
136 3300047318 Ga0495636_0118427 Ga0495636_0118427_329_805 157
137 3300047320 Ga0495672_0401543 Ga0495672_0401543_104_580 157
138 3300047445 Ga0495677_0041697 Ga0495677_0041697_153_629 157
139 3300047447 Ga0495685_076012 Ga0495685_076012_611_1087 157
140 3300047470 Ga0495681_0072148 Ga0495681_0072148_1058_1534 157
141 3300048905 Ga0496102_0119738 Ga0496102_0119738_1911_2387 157
142 3300048911 Ga0496108_0071538 Ga0496108_0071538_1204_1680 157
143 3300048912 Ga0496109_0055818 Ga0496109_0055818_551_1027 157
144 3300048913 Ga0496110_0283733 Ga0496110_0283733_711_1187 157
145 3300048913 Ga0496110_1020006 Ga0496110_1020006_143_619 157
146 3300048914 Ga0496111_0216791 Ga0496111_0216791_417_893 157
147 3300048918 Ga0496115_0443361 Ga0496115_0443361_276_752 157
148 3300049581 Ga0501047_0000825 Ga0501047_0000825_27933_28409 157
149 3300049582 Ga0501048_0589614 Ga0501048_0589614_127_603 157
150 3300049822 Ga0501035_0333203 Ga0501035_0333203_338_814 157
151 3300049823 Ga0501044_0540508 Ga0501044_0540508_324_800 157
152 3300005331 Ga0070670_100000020 Ga0070670_100000020146 158
153 3300005331 Ga0070670_100016359 Ga0070670_1000163595 158
154 3300005335 Ga0070666_10116163 Ga0070666_101161632 158
155 3300005335 Ga0070666_10150747 Ga0070666_101507473 158
156 3300005335 Ga0070666_10348508 Ga0070666_103485082 158
157 3300005339 Ga0070660_100676296 Ga0070660_1006762961 158
158 3300005347 Ga0070668_100000108 Ga0070668_10000010838 158
159 3300005347 Ga0070668_100005083 Ga0070668_1000050832 158
160 3300005353 Ga0070669_100008310 Ga0070669_1000083105 158
161 3300005355 Ga0070671_100022027 Ga0070671_1000220275 158
162 3300005366 Ga0070659_100776368 Ga0070659_1007763682 158
163 3300005367 Ga0070667_100000163 Ga0070667_10000016343 158
164 3300005367 Ga0070667_100004064 Ga0070667_10000406410 158
165 3300005367 Ga0070667_100006909 Ga0070667_1000069096 158
166 3300005530 Ga0070679_100269795 Ga0070679_1002697952 158
167 3300005548 Ga0070665_100000441 Ga0070665_10000044153 158
168 3300005548 Ga0070665_100001115 Ga0070665_10000111522 158
169 3300005548 Ga0070665_100053931 Ga0070665_1000539315 158
170 3300005614 Ga0068856_101047178 Ga0068856_1010471782 158
171 3300005617 Ga0068859_100000671 Ga0068859_10000067131 158
172 3300005617 Ga0068859_100159713 Ga0068859_1001597133 158
173 3300005618 Ga0068864_100000071 Ga0068864_10000007126 158
174 3300005719 Ga0068861_100140563 Ga0068861_1001405633 158
175 3300005841 Ga0068863_100000037 Ga0068863_10000003797 158
176 3300005841 Ga0068863_100000451 Ga0068863_10000045134 158
177 3300005841 Ga0068863_100021083 Ga0068863_1000210836 158
178 3300005841 Ga0068863_100124153 Ga0068863_1001241532 158
179 3300005842 Ga0068858_100000029 Ga0068858_10000002948 158
180 3300005842 Ga0068858_100002275 Ga0068858_10000227511 158
181 3300005842 Ga0068858_100006867 Ga0068858_1000068675 158
182 3300005843 Ga0068860_100001003 Ga0068860_10000100326 158
183 3300005843 Ga0068860_100024705 Ga0068860_1000247057 158
184 3300005844 Ga0068862_100001526 Ga0068862_10000152623 158
185 3300005844 Ga0068862_100009403 Ga0068862_1000094038 158
186 3300006042 Ga0075368_10004613 Ga0075368_100046132 158
187 3300006051 Ga0075364_10020776 Ga0075364_100207763 158
188 3300006186 Ga0075369_10135700 Ga0075369_101357002 158
189 3300006353 Ga0075370_10044701 Ga0075370_100447012 158
190 3300006931 Ga0097620_100000671 Ga0097620_10000067131 158
191 3300006931 Ga0097620_100159714 Ga0097620_1001597143 158
192 3300009011 Ga0105251_10245690 Ga0105251_102456901 158
193 3300009092 Ga0105250_10010104 Ga0105250_100101045 158
194 3300009093 Ga0105240_10095217 Ga0105240_100952173 158
195 3300009101 Ga0105247_10010897 Ga0105247_100108974 158
196 3300009101 Ga0105247_10089876 Ga0105247_100898762 158
197 3300009177 Ga0105248_10003631 Ga0105248_1000363110 158
198 3300009177 Ga0105248_10010680 Ga0105248_100106802 158
199 3300009177 Ga0105248_10016560 Ga0105248_100165604 158
200 3300009177 Ga0105248_10065640 Ga0105248_100656404 158
201 3300009177 Ga0105248_10130271 Ga0105248_101302713 158
202 3300009553 Ga0105249_10000792 Ga0105249_100007927 158
203 3300009553 Ga0105249_10295623 Ga0105249_102956231 158
204 3300013306 Ga0163162_10238020 Ga0163162_102380202 158
205 3300014325 Ga0163163_10002745 Ga0163163_100027455 158
206 3300014325 Ga0163163_10080460 Ga0163163_100804603 158
207 3300014325 Ga0163163_10158362 Ga0163163_101583622 158
208 3300014325 Ga0163163_10268839 Ga0163163_102688392 158
209 3300014326 Ga0157380_10636732 Ga0157380_106367322 158
210 3300014968 Ga0157379_10000579 Ga0157379_1000057925 158
211 3300014968 Ga0157379_10032944 Ga0157379_100329444 158
212 3300014968 Ga0157379_10054090 Ga0157379_100540902 158
213 3300014968 Ga0157379_11789979 Ga0157379_117899791 158
214 3300017792 Ga0163161_11102508 Ga0163161_111025081 158
215 3300021384 Ga0213876_10019194 Ga0213876_100191945 158
216 3300025254 Ga0209148_1002910 Ga0209148_10029102 158
217 3300025735 Ga0207713_1133657 Ga0207713_11336572 158
218 3300025900 Ga0207710_10008377 Ga0207710_100083774 158
219 3300025903 Ga0207680_10075806 Ga0207680_100758063 158
220 3300025903 Ga0207680_10152048 Ga0207680_101520482 158
221 3300025903 Ga0207680_10318754 Ga0207680_103187542 158
222 3300025913 Ga0207695_10300377 Ga0207695_103003771 158
223 3300025921 Ga0207652_10758731 Ga0207652_107587312 158
224 3300025923 Ga0207681_10012022 Ga0207681_100120228 158
225 3300025925 Ga0207650_10000175 Ga0207650_1000017542 158
226 3300025925 Ga0207650_10499814 Ga0207650_104998142 158
227 3300025931 Ga0207644_10029877 Ga0207644_100298773 158
228 3300025941 Ga0207711_10001642 Ga0207711_1000164214 158
229 3300025941 Ga0207711_10003500 Ga0207711_100035008 158
230 3300025941 Ga0207711_10032153 Ga0207711_100321532 158
231 3300025941 Ga0207711_10073485 Ga0207711_100734854 158
232 3300025961 Ga0207712_10000376 Ga0207712_1000037633 158
233 3300025972 Ga0207668_10000001 Ga0207668_10000001221 158
234 3300025972 Ga0207668_10000123 Ga0207668_1000012328 158
235 3300025986 Ga0207658_10000118 Ga0207658_1000011857 158
236 3300025986 Ga0207658_10006171 Ga0207658_1000617110 158
237 3300025986 Ga0207658_10009958 Ga0207658_100099588 158
238 3300026035 Ga0207703_10000079 Ga0207703_1000007999 158
239 3300026035 Ga0207703_10002421 Ga0207703_1000242115 158
240 3300026035 Ga0207703_10002470 Ga0207703_1000247011 158
241 3300026078 Ga0207702_10970906 Ga0207702_109709061 158
242 3300026088 Ga0207641_10000034 Ga0207641_10000034103 158
243 3300026088 Ga0207641_10001419 Ga0207641_1000141914 158
244 3300026088 Ga0207641_10007520 Ga0207641_1000752010 158
245 3300026088 Ga0207641_10104924 Ga0207641_101049244 158
246 3300026088 Ga0207641_11037919 Ga0207641_110379191 158
247 3300026095 Ga0207676_10000376 Ga0207676_1000037633 158
248 3300026095 Ga0207676_10000506 Ga0207676_1000050630 158
249 3300026118 Ga0207675_100039063 Ga0207675_1000390635 158
250 3300026118 Ga0207675_100052311 Ga0207675_1000523114 158
251 3300026118 Ga0207675_100350426 Ga0207675_1003504263 158
252 3300028379 Ga0268266_10001669 Ga0268266_1000166914 158
253 3300028379 Ga0268266_10008699 Ga0268266_100086998 158
254 3300028379 Ga0268266_10039683 Ga0268266_100396835 158
255 3300028380 Ga0268265_10000901 Ga0268265_100009015 158
256 3300028380 Ga0268265_10263523 Ga0268265_102635232 158
257 3300028381 Ga0268264_10000481 Ga0268264_1000048117 158
258 3300028381 Ga0268264_10028199 Ga0268264_100281994 158
259 3300028786 Ga0307517_10001099 Ga0307517_1000109939 158
260 3300031456 Ga0307513_10001617 Ga0307513_1000161715 158
261 3300031456 Ga0307513_10003966 Ga0307513_100039664 158
262 3300035083 Ga0373926_0257695 Ga0373926_0257695_149_631 158
263 3300035114 Ga0373939_0174891 Ga0373939_0174891_156_635 158
264 3300035725 Ga0373947_0098964 Ga0373947_0098964_212_694 158
265 3300036401 Ga0373937_0658299 Ga0373937_0658299_96_578 158
266 3300037068 Ga0373925_0368368 Ga0373925_0368368_268_747 158
267 3300037471 Ga0395905_0143876 Ga0395905_0143876_1112_1594 158
268 3300037471 Ga0395905_0793710 Ga0395905_0793710_259_741 158
269 3300038443 Ga0395901_0392885 Ga0395901_0392885_548_1030 158
270 3300039437 Ga0436365_1082675 Ga0436365_1082675_346_825 158
271 3300046660 Ga0495625_0131739 Ga0495625_0131739_515_994 158
272 3300048904 Ga0496101_0582214 Ga0496101_0582214_301_780 158
273 3300048904 Ga0496101_0595693 Ga0496101_0595693_310_789 158
274 3300048909 Ga0496106_0177938 Ga0496106_0177938_989_1468 158
275 3300048909 Ga0496106_0210667 Ga0496106_0210667_238_753 158
276 3300048920 Ga0496117_0017711 Ga0496117_0017711_4896_5375 158
277 3300048921 Ga0496118_0177518 Ga0496118_0177518_760_1239 158
278 3300048923 Ga0496120_0161393 Ga0496120_0161393_193_672 158
279 3300048924 Ga0496121_0000130 Ga0496121_0000130_2873_3352 158
280 3300049581 Ga0501047_0111604 Ga0501047_0111604_1649_2131 158
281 3300049582 Ga0501048_0159793 Ga0501048_0159793_306_788 158
282 3300049823 Ga0501044_0086941 Ga0501044_0086941_1248_1730 158
283 3300050491 nmdc:mga00v17_2280_c1 nmdc:mga00v17_2280_c1_7946_8425 158
284 3300050493 nmdc:mga0k408_101762_c1 nmdc:mga0k408_101762_c1_979_1458 158
285 3300050494 nmdc:mga06z11_97560_c1 nmdc:mga06z11_97560_c1_165_644 158
286 3300050495 nmdc:mga04h51_95263_c1 nmdc:mga04h51_95263_c1_37_516 158
287 3300050496 nmdc:mga07m45_1914_c1 nmdc:mga07m45_1914_c1_5064_5543 158
288 3300050516 nmdc:mga0sz30_124900_c1 nmdc:mga0sz30_124900_c1_248_727 158
289 3300053080 Ga0500635_0000328 Ga0500635_0000328_15206_15685 158
290 3300053087 Ga0500643_001289 Ga0500643_001289_11619_12101 158
291 3300053087 Ga0500643_025236 Ga0500643_025236_831_1310 158
292 3300053091 Ga0500647_0096207 Ga0500647_0096207_671_1150 158
293 3300053104 Ga0500556_0011407 Ga0500556_0011407_2141_2620 158
294 3300053121 Ga0500607_106005 Ga0500607_106005_506_985 158
295 3300053136 Ga0500559_0123479 Ga0500559_0123479_505_984 158
296 3300053162 Ga0500638_091524 Ga0500638_091524_535_1014 158
297 3300053177 Ga0500636_0086749 Ga0500636_0086749_633_1112 158
298 3300053178 Ga0500637_0125061 Ga0500637_0125061_717_1196 158
299 3300005327 Ga0070658_10098364 Ga0070658_100983642 159
300 3300005329 Ga0070683_100893498 Ga0070683_1008934981 159
301 3300005840 Ga0068870_10532599 Ga0068870_105325992 159
302 3300005842 Ga0068858_101539886 Ga0068858_1015398861 159
303 3300009093 Ga0105240_10010073 Ga0105240_100100733 159
304 3300009098 Ga0105245_10521686 Ga0105245_105216863 159
305 3300009551 Ga0105238_10134611 Ga0105238_101346113 159
306 3300010375 Ga0105239_10635125 Ga0105239_106351253 159
307 3300013296 Ga0157374_10741499 Ga0157374_107414992 159
308 3300025250 Ga0209026_1022919 Ga0209026_10229192 159
309 3300025909 Ga0207705_10073434 Ga0207705_100734342 159
310 3300025913 Ga0207695_10008153 Ga0207695_1000815312 159
311 3300025913 Ga0207695_10100658 Ga0207695_101006583 159
312 3300025914 Ga0207671_10747390 Ga0207671_107473902 159
313 3300025924 Ga0207694_10299789 Ga0207694_102997891 159
314 3300025927 Ga0207687_10478567 Ga0207687_104785672 159
315 3300025941 Ga0207711_10000978 Ga0207711_1000097821 159
316 3300025944 Ga0207661_11166549 Ga0207661_111665492 159
317 3300025949 Ga0207667_10300818 Ga0207667_103008182 159
318 3300026035 Ga0207703_11135033 Ga0207703_111350331 159
319 3300026142 Ga0207698_11434861 Ga0207698_114348612 159
320 3300031456 Ga0307513_10000348 Ga0307513_1000034846 159
321 3300031456 Ga0307513_10020347 Ga0307513_100203472 159
322 3300033180 Ga0307510_10472250 Ga0307510_104722501 159
323 3300035113 Ga0373936_0002059 Ga0373936_0002059_3246_3731 159
324 3300037312 Ga0395899_0000095 Ga0395899_0000095_80186_80671 159
325 3300037418 Ga0395900_0000006 Ga0395900_0000006_305670_306155 159
326 3300037466 Ga0395898_0006778 Ga0395898_0006778_2652_3137 159
327 3300037466 Ga0395898_1220744 Ga0395898_1220744_166_651 159
328 3300037471 Ga0395905_0003726 Ga0395905_0003726_6717_7202 159
329 3300038443 Ga0395901_0000001 Ga0395901_0000001_348918_349403 159
330 3300046460 Ga0495638_0567983 Ga0495638_0567983_46_528 159
331 3300046516 Ga0495628_0372786 Ga0495628_0372786_389_874 159
332 3300046517 Ga0495630_0570134 Ga0495630_0570134_176_661 159
333 3300046660 Ga0495625_0316696 Ga0495625_0316696_247_729 159
334 3300046684 Ga0495669_0000020 Ga0495669_0000020_8828_9310 159
335 3300046684 Ga0495669_0000449 Ga0495669_0000449_413_895 159
336 3300047319 Ga0495674_0431987 Ga0495674_0431987_407_892 159
337 3300047320 Ga0495672_0083204 Ga0495672_0083204_225_707 159
338 3300047445 Ga0495677_0085034 Ga0495677_0085034_307_789 159
339 3300048904 Ga0496101_0553116 Ga0496101_0553116_386_868 159
340 3300048918 Ga0496115_0001146 Ga0496115_0001146_288_773 159
341 3300048918 Ga0496115_0141478 Ga0496115_0141478_453_944 159
342 3300053096 Ga0500641_0095903 Ga0500641_0095903_280_762 159
343 3300053108 Ga0500562_003674 Ga0500562_003674_2293_2775 159
344 3300053122 Ga0500608_041069 Ga0500608_041069_1125_1613 159
345 3300005262 Ga0065165_1000413 Ga0065165_100041341 160
346 3300005262 Ga0065165_1040949 Ga0065165_10409492 160
347 3300005335 Ga0070666_10429590 Ga0070666_104295901 160
348 3300005471 Ga0070698_100701523 Ga0070698_1007015232 160
349 3300005618 Ga0068864_100220377 Ga0068864_1002203773 160
350 3300005842 Ga0068858_100273687 Ga0068858_1002736872 160
351 3300009174 Ga0105241_10236207 Ga0105241_102362072 160
352 3300009177 Ga0105248_10326723 Ga0105248_103267232 160
353 3300009551 Ga0105238_10034198 Ga0105238_100341982 160
354 3300010375 Ga0105239_11735400 Ga0105239_117354001 160
355 3300025304 Ga0209257_1000660 Ga0209257_100066026 160
356 3300025911 Ga0207654_10469742 Ga0207654_104697421 160
357 3300025924 Ga0207694_10010971 Ga0207694_100109717 160
358 3300026095 Ga0207676_10053642 Ga0207676_100536423 160
359 3300031251 Ga0265327_10002690 Ga0265327_100026909 160
360 3300031456 Ga0307513_10565712 Ga0307513_105657122 160
361 3300032002 Ga0307416_100920855 Ga0307416_1009208552 160
362 3300035089 Ga0373944_0029065 Ga0373944_0029065_601_1116 160
363 3300035695 Ga0373927_0000622 Ga0373927_0000622_8023_8538 160
364 3300037068 Ga0373925_0000067 Ga0373925_0000067_30797_31312 160
365 3300049569 Ga0501032_0384548 Ga0501032_0384548_319_801 160
366 3300049570 Ga0501033_0040462 Ga0501033_0040462_2463_2945 160
367 3300049571 Ga0501034_0910664 Ga0501034_0910664_89_571 160
368 3300049581 Ga0501047_0214299 Ga0501047_0214299_678_1160 160
369 3300049742 Ga0501080_1116490 Ga0501080_1116490_49_531 160
370 3300049823 Ga0501044_0009009 Ga0501044_0009009_8454_8936 160
371 3300053093 Ga0500651_0278724 Ga0500651_0278724_381_866 160
372 3300053103 Ga0500555_021013 Ga0500555_021013_678_1163 160
373 3300053108 Ga0500562_000461 Ga0500562_000461_4206_4691 160
374 3300002741 JGI25157J39369_1025612 JGI25157J39369_10256121 161
375 3300025250 Ga0209026_1000474 Ga0209026_100047416 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

45

163

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qwp-assembly1.cif.gz_M cryoem structure of bacterial transcription close complex (rpc) 0.701 39 94
6ty0-assembly1.cif.gz_B nt part crystal structure of the rymv-encoded viral rna silencing suppressor p1 0.6396 106 153
6xv2-assembly1.cif.gz_A full structure of rymv p1 protein, derived from crystallographic and nmr data. 0.6327 106 156
4v4n-assembly1.cif.gz_BG structure of the methanococcus jannaschii ribosome-secyebeta channel complex 0.6088 104 131
6skf-assembly1.cif.gz_Ah cryo-em structure of t. kodakarensis 70s ribosome 0.5782 106 129
ID Description Score Start End Superfamily
4mteC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.924 17 85 1.10.10.10
4mtdB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9138 14 85 1.10.10.10
2w57B02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Ferric-uptake regulator, C-terminal dimerisarion domain 0.8629 107 150 3.30.1490.190
2xigC02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Ferric-uptake regulator, C-terminal dimerisarion domain 0.8476 107 154 3.30.1490.190
2fe3B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8367 19 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A350UAA5-F1-model_v4 Transcriptional repressor 0.8853 107 156 GO:0003677
GO:0003700
GO:0005737
GO:0046872
AF-A0A0S7ZWL0-F1-model_v4 Fur family transcriptional regulator 0.8312 6 85 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A3B8UF65-F1-model_v4 Fur family transcriptional regulator 0.8311 1 86
AF-I3X517-F1-model_v4 Uncharacterized protein 0.8127 94 153 GO:0003677
GO:0003700
GO:0046872
AF-A0A3B8UF65-F1-model_v4 Fur family transcriptional regulator 0.7961 1 86

Feature Viewer

pLDDT pTM Quality
83.36 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map