F427002

General Info

Members Datasets Scaffolds Average Seq Length
375 212 375 194

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100249034|Ga0075434_1002490343
Length 218
Sequence MNTLSYLQFQLHFVFRKKCFDTPSGLLDYRNPSGPVEMNLSKRSEYALRALIDLGIAAELDRPILQVSELASKEQLPTKFLEQILTQLRLGGFVETKRGKLGGYSLGKPASQIKIGAVIRLLDGPLAPIPCVSKTAYERCTCPDEDHCGLRMLMFDVRNAIARILDHYTLAQIVDITLRKMRRDKVPVPFARRSFGLGEIIPGRAHQSDPSSKQKATL

Samples

Sample ID Description Type Environment
1 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
124 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 5.6
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1000209 3300002126 Bacteria 5348
2 rootH2_10015864 3300003320 Bacteria 6534
3 rootL2_10022543 3300003322 Bacteria 5379
4 Ga0065704_10052061 3300005289 Bacteria 766
5 Ga0065712_10080571 3300005290 Bacteria 3091
6 Ga0065712_10108388 3300005290 Bacteria 1876
7 Ga0065712_10450847 3300005290 Bacteria 686
8 Ga0065707_10010780 3300005295 Unclassified 2211
9 Ga0065707_10186776 3300005295 Bacteria 1384
10 Ga0070676_10003641 3300005328 Bacteria 8061
11 Ga0070676_10120872 3300005328 Bacteria 1644
12 Ga0070676_10137919 3300005328 Bacteria 1549
13 Ga0070683_100001147 3300005329 Bacteria 20017
14 Ga0070683_100016047 3300005329 Bacteria 6592
15 Ga0070683_100048641 3300005329 Bacteria 3921
16 Ga0070683_100094017 3300005329 Bacteria 2817
17 Ga0070690_100193058 3300005330 Bacteria 1413
18 Ga0070670_100024887 3300005331 Bacteria 5150
19 Ga0070670_100075660 3300005331 Bacteria 2893
20 Ga0070670_100100653 3300005331 Bacteria 2488
21 Ga0068869_100052818 3300005334 Unclassified 2952
22 Ga0070666_10102507 3300005335 Bacteria 1974
23 Ga0070682_100683088 3300005337 Unclassified 821
24 Ga0068868_100091308 3300005338 Bacteria 2454
25 Ga0068868_100370837 3300005338 Bacteria 1230
26 Ga0068868_100408252 3300005338 Bacteria 1173
27 Ga0070660_100031256 3300005339 Bacteria 3998
28 Ga0070689_100015452 3300005340 Bacteria 5567
29 Ga0070689_100130482 3300005340 Bacteria 2015
30 Ga0070661_100697360 3300005344 Unclassified 827
31 Ga0070692_10146710 3300005345 Bacteria 1340
32 Ga0070668_100108648 3300005347 Unclassified 2206
33 Ga0070668_100632514 3300005347 Bacteria 939
34 Ga0070669_100015906 3300005353 Bacteria 5366
35 Ga0070675_100001412 3300005354 Bacteria 17640
36 Ga0070675_100108363 3300005354 Bacteria 2346
37 Ga0070675_100245159 3300005354 Bacteria 1566
38 Ga0070675_100335862 3300005354 Unclassified 1337
39 Ga0070671_100009917 3300005355 Bacteria 7650
40 Ga0070671_100011519 3300005355 Bacteria 7110
41 Ga0070674_100194113 3300005356 Bacteria 1563
42 Ga0070673_100007562 3300005364 Bacteria 7182
43 Ga0070688_100109137 3300005365 Bacteria 1837
44 Ga0070659_100006232 3300005366 Bacteria 8617
45 Ga0070659_100307596 3300005366 Bacteria 1323
46 Ga0070667_100010413 3300005367 Bacteria 7675
47 Ga0070667_100011877 3300005367 Bacteria 7203
48 Ga0070667_100034528 3300005367 Unclassified 4232
49 Ga0070667_100049655 3300005367 Bacteria 3534
50 Ga0070714_100069356 3300005435 Bacteria 3044
51 Ga0070713_100099721 3300005436 Unclassified 2513
52 Ga0070710_10027832 3300005437 Unclassified 3018
53 Ga0070711_100066737 3300005439 Unclassified 2521
54 Ga0070711_100218294 3300005439 Bacteria 1481
55 Ga0070705_100098412 3300005440 Bacteria 1841
56 Ga0070700_100048124 3300005441 Bacteria 2642
57 Ga0070694_100044768 3300005444 Bacteria 2963
58 Ga0070708_100120118 3300005445 Bacteria 2424
59 Ga0070708_100651686 3300005445 Unclassified 992
60 Ga0070663_100205303 3300005455 Bacteria 1540
61 Ga0070663_100499968 3300005455 Unclassified 1009
62 Ga0070678_100083377 3300005456 Bacteria 2430
63 Ga0070662_100457885 3300005457 Unclassified 1060
64 Ga0070681_10328749 3300005458 Bacteria 1438
65 Ga0068867_100078135 3300005459 Bacteria 2489
66 Ga0070685_10057457 3300005466 Bacteria 2265
67 Ga0070685_10299155 3300005466 Bacteria 1084
68 Ga0070706_100273112 3300005467 Bacteria 1577
69 Ga0070706_100302329 3300005467 Bacteria 1493
70 Ga0070707_100579118 3300005468 Unclassified 1085
71 Ga0070707_100642466 3300005468 Unclassified 1024
72 Ga0070679_100074750 3300005530 Bacteria 3379
73 Ga0070684_100001034 3300005535 Bacteria 19854
74 Ga0070684_100425280 3300005535 Unclassified 1226
75 Ga0070672_100322438 3300005543 Bacteria 1313
76 Ga0070686_100212970 3300005544 Bacteria 1392
77 Ga0070696_100133284 3300005546 Bacteria 1810
78 Ga0070665_100166454 3300005548 Bacteria 2207
79 Ga0070665_100193985 3300005548 Bacteria 2032
80 Ga0070665_100516998 3300005548 Bacteria 1205
81 Ga0070704_100008156 3300005549 Bacteria 6264
82 Ga0070664_100022165 3300005564 Bacteria 5240
83 Ga0068856_100217694 3300005614 Unclassified 1925
84 Ga0068859_100040358 3300005617 Bacteria 4685
85 Ga0068866_10590180 3300005718 Unclassified 748
86 Ga0068863_100034903 3300005841 Bacteria 4791
87 Ga0068858_100020474 3300005842 Bacteria 6183
88 Ga0068860_100036999 3300005843 Bacteria 4673
89 Ga0068860_100053308 3300005843 Bacteria 3846
90 Ga0068860_101203906 3300005843 Bacteria 778
91 Ga0081455_10130483 3300005937 Unclassified 1966
92 Ga0081455_10226653 3300005937 Unclassified 1382
93 Ga0081539_10044546 3300005985 Bacteria 2560
94 Ga0070717_10218486 3300006028 Bacteria 1674
95 Ga0070715_10025079 3300006163 Bacteria 2357
96 Ga0070712_100011045 3300006175 Bacteria 5715
97 Ga0097621_100019522 3300006237 Bacteria 5204
98 Ga0097621_100076368 3300006237 Bacteria 2779
99 Ga0097621_100780083 3300006237 Bacteria 884
100 Ga0068871_100010844 3300006358 Bacteria 6671
101 Ga0068871_100022934 3300006358 Bacteria 4819
102 Ga0075434_100249034 3300006871 Unclassified 1796
103 Ga0075434_100938519 3300006871 Unclassified 880
104 Ga0075434_100952456 3300006871 Bacteria 873
105 Ga0075434_101098177 3300006871 Unclassified 809
106 Ga0097620_100040357 3300006931 Bacteria 4685
107 Ga0075435_100510100 3300007076 Bacteria 1040
108 Ga0105245_10385478 3300009098 Bacteria 1397
109 Ga0114129_10004430 3300009147 Bacteria 19823
110 Ga0114129_11195956 3300009147 Unclassified 947
111 Ga0105249_10030822 3300009553 Bacteria 4848
112 Ga0105249_11399428 3300009553 Bacteria 771
113 Ga0105239_10072900 3300010375 Bacteria 3775
114 Ga0157374_10004858 3300013296 Bacteria 11282
115 Ga0157374_10012390 3300013296 Bacteria 7418
116 Ga0157374_10062126 3300013296 Bacteria 3500
117 Ga0157374_10120996 3300013296 Bacteria 2526
118 Ga0157374_10246690 3300013296 Unclassified 1757
119 Ga0157374_10309862 3300013296 Bacteria 1563
120 Ga0157374_10363128 3300013296 Bacteria 1440
121 Ga0157374_10875588 3300013296 Bacteria 915
122 Ga0157378_10034031 3300013297 Bacteria 4507
123 Ga0157378_10081463 3300013297 Bacteria 2925
124 Ga0157378_10092329 3300013297 Bacteria 2754
125 Ga0157378_10332044 3300013297 Unclassified 1480
126 Ga0157378_10655197 3300013297 Bacteria 1066
127 Ga0163162_10033588 3300013306 Bacteria 5099
128 Ga0163162_10194108 3300013306 Bacteria 2159
129 Ga0163162_10420447 3300013306 Bacteria 1469
130 Ga0163162_10945694 3300013306 Unclassified 973
131 Ga0157375_10004291 3300013308 Bacteria 12368
132 Ga0157375_10022759 3300013308 Bacteria 5770
133 Ga0157375_11470566 3300013308 Unclassified 804
134 Ga0163163_10635319 3300014325 Bacteria 1131
135 Ga0157377_10064880 3300014745 Bacteria 2096
136 Ga0157379_10016304 3300014968 Bacteria 6537
137 Ga0157376_10014931 3300014969 Bacteria 5852
138 Ga0157376_10027748 3300014969 Bacteria 4492
139 Ga0157376_10311908 3300014969 Bacteria 1493
140 Ga0207666_1004755 3300025271 Unclassified 1714
141 Ga0207697_10000049 3300025315 Bacteria 47645
142 Ga0207697_10000095 3300025315 Bacteria 40285
143 Ga0207697_10000159 3300025315 Bacteria 33779
144 Ga0207697_10011532 3300025315 Unclassified 3735
145 Ga0207692_10453286 3300025898 Unclassified 808
146 Ga0207642_10484536 3300025899 Unclassified 755
147 Ga0207688_10005856 3300025901 Bacteria 6687
148 Ga0207688_10035611 3300025901 Unclassified 2758
149 Ga0207647_10008407 3300025904 Bacteria 7402
150 Ga0207685_10076738 3300025905 Bacteria 1371
151 Ga0207699_10125109 3300025906 Viruses 1668
152 Ga0207645_10000188 3300025907 Bacteria 49705
153 Ga0207684_10000751 3300025910 Bacteria 37862
154 Ga0207684_10302322 3300025910 Bacteria 1379
155 Ga0207693_10008661 3300025915 Bacteria 8324
156 Ga0207693_10015357 3300025915 Bacteria 6145
157 Ga0207693_10038499 3300025915 Unclassified 3766
158 Ga0207693_10049358 3300025915 Bacteria 3305
159 Ga0207663_10001921 3300025916 Bacteria 9841
160 Ga0207663_10112747 3300025916 Bacteria 1848
161 Ga0207663_10156838 3300025916 Bacteria 1602
162 Ga0207646_10526597 3300025922 Unclassified 1064
163 Ga0207646_10590538 3300025922 Unclassified 997
164 Ga0207681_10011304 3300025923 Bacteria 5483
165 Ga0207681_10215510 3300025923 Bacteria 1482
166 Ga0207650_10033136 3300025925 Bacteria 3739
167 Ga0207650_10061351 3300025925 Bacteria 2807
168 Ga0207650_10153351 3300025925 Bacteria 1820
169 Ga0207659_10004515 3300025926 Bacteria 8416
170 Ga0207659_10005926 3300025926 Bacteria 7460
171 Ga0207659_10417826 3300025926 Bacteria 1124
172 Ga0207659_10425710 3300025926 Unclassified 1114
173 Ga0207700_10003381 3300025928 Bacteria 9260
174 Ga0207700_10543195 3300025928 Bacteria 1031
175 Ga0207664_10057513 3300025929 Unclassified 3091
176 Ga0207644_10010293 3300025931 Bacteria 6164
177 Ga0207644_10164667 3300025931 Bacteria 1726
178 Ga0207706_10208412 3300025933 Bacteria 1714
179 Ga0207670_10005685 3300025936 Bacteria 6867
180 Ga0207670_10043987 3300025936 Bacteria 2952
181 Ga0207691_10000155 3300025940 Bacteria 63923
182 Ga0207661_10007948 3300025944 Bacteria 7563
183 Ga0207661_10017756 3300025944 Bacteria 5272
184 Ga0207661_10019646 3300025944 Bacteria 5042
185 Ga0207661_10115683 3300025944 Bacteria 2275
186 Ga0207651_10366536 3300025960 Bacteria 1217
187 Ga0207712_10024847 3300025961 Bacteria 3974
188 Ga0207712_10125935 3300025961 Unclassified 1945
189 Ga0207668_10106832 3300025972 Unclassified 2092
190 Ga0207658_10039396 3300025986 Unclassified 3409
191 Ga0207658_10739407 3300025986 Bacteria 890
192 Ga0207677_10165817 3300026023 Bacteria 1722
193 Ga0207677_11154169 3300026023 Bacteria 708
194 Ga0207703_10022192 3300026035 Unclassified 4976
195 Ga0207639_10899654 3300026041 Unclassified 827
196 Ga0207678_10002007 3300026067 Bacteria 18524
197 Ga0207678_10921847 3300026067 Bacteria 773
198 Ga0207708_10025707 3300026075 Bacteria 4456
199 Ga0207641_10025166 3300026088 Bacteria 4907
200 Ga0207648_10090598 3300026089 Bacteria 2672
201 Ga0207676_10456224 3300026095 Unclassified 1206
202 Ga0207675_100191240 3300026118 Unclassified 1963
203 Ga0207683_10009196 3300026121 Bacteria 8419
204 Ga0268266_10382769 3300028379 Bacteria 1327
205 Ga0268264_10010917 3300028381 Bacteria 7505
206 Ga0268264_10077336 3300028381 Unclassified 2834
207 Ga0268264_10248998 3300028381 Bacteria 1650
208 Ga0265326_10055646 3300028558 Bacteria 1119
209 Ga0265319_1004596 3300028563 Bacteria 6793
210 Ga0265319_1012672 3300028563 Bacteria 3394
211 Ga0265334_10004173 3300028573 Bacteria 6462
212 Ga0265334_10005073 3300028573 Bacteria 5774
213 Ga0265334_10095351 3300028573 Bacteria 1082
214 Ga0265318_10000002 3300028577 Bacteria 428208
215 Ga0265318_10000063 3300028577 Bacteria 105280
216 Ga0265318_10001035 3300028577 Bacteria 17646
217 Ga0265318_10001375 3300028577 Bacteria 14452
218 Ga0265318_10024821 3300028577 Bacteria 2372
219 Ga0265323_10000260 3300028653 Bacteria 30902
220 Ga0265323_10069446 3300028653 Bacteria 1207
221 Ga0265322_10000298 3300028654 Bacteria 21119
222 Ga0265322_10022337 3300028654 Bacteria 1809
223 Ga0265336_10001462 3300028666 Bacteria 10748
224 Ga0265336_10043236 3300028666 Bacteria 1374
225 Ga0307515_10131864 3300028794 Bacteria 2746
226 Ga0265338_10001341 3300028800 Bacteria 40147
227 Ga0265338_10013274 3300028800 Bacteria 9315
228 Ga0265324_10000710 3300029957 Bacteria 22199
229 Ga0265324_10005271 3300029957 Bacteria 5621
230 Ga0265324_10113667 3300029957 Bacteria 919
231 Ga0265330_10076445 3300031235 Bacteria 1445
232 Ga0265328_10072758 3300031239 Bacteria 1264
233 Ga0265328_10108080 3300031239 Bacteria 1033
234 Ga0265320_10000564 3300031240 Bacteria 28607
235 Ga0265320_10002882 3300031240 Bacteria 11795
236 Ga0265320_10003032 3300031240 Bacteria 11405
237 Ga0265320_10004894 3300031240 Bacteria 8690
238 Ga0265320_10005889 3300031240 Bacteria 7804
239 Ga0265320_10019061 3300031240 Bacteria 3760
240 Ga0265325_10091273 3300031241 Bacteria 1502
241 Ga0265325_10294146 3300031241 Bacteria 726
242 Ga0265329_10069946 3300031242 Bacteria 1110
243 Ga0265339_10077065 3300031249 Bacteria 1767
244 Ga0265331_10070703 3300031250 Bacteria 1633
245 Ga0265331_10072921 3300031250 Bacteria 1603
246 Ga0265327_10000325 3300031251 Bacteria 90949
247 Ga0265327_10002415 3300031251 Bacteria 19800
248 Ga0265327_10002448 3300031251 Bacteria 19578
249 Ga0265316_10009437 3300031344 Bacteria 8989
250 Ga0265316_10018152 3300031344 Bacteria 6055
251 Ga0265313_10001431 3300031595 Bacteria 22353
252 Ga0265313_10002447 3300031595 Bacteria 16031
253 Ga0265313_10014573 3300031595 Bacteria 4637
254 Ga0307508_10000183 3300031616 Bacteria 75801
255 Ga0265314_10000861 3300031711 Bacteria 36066
256 Ga0265314_10003822 3300031711 Bacteria 14378
257 Ga0265314_10004826 3300031711 Bacteria 12330
258 Ga0265314_10005628 3300031711 Bacteria 11254
259 Ga0265314_10015734 3300031711 Bacteria 5993
260 Ga0265314_10070667 3300031711 Bacteria 2338
261 Ga0265314_10107544 3300031711 Bacteria 1779
262 Ga0265342_10023178 3300031712 Bacteria 3934
263 Ga0373957_0017447 3300035120 Unclassified 2500
264 Ga0373943_0089177 3300035170 Bacteria 1595
265 Ga0373943_0118394 3300035170 Bacteria 1405
266 Ga0373946_0199278 3300035171 Unclassified 958
267 Ga0373955_0154096 3300035172 Unclassified 1353
268 Ga0373935_0050934 3300035692 Bacteria 2629
269 Ga0373935_0440848 3300035692 Bacteria 940
270 Ga0373927_0124176 3300035695 Unclassified 1685
271 Ga0373947_0038549 3300035725 Bacteria 2840
272 Ga0373947_0452958 3300035725 Bacteria 869
273 Ga0373937_0228000 3300036401 Bacteria 1754
274 Ga0373937_0651447 3300036401 Bacteria 999
275 Ga0395899_0219681 3300037312 Bacteria 1317
276 Ga0395900_0013131 3300037418 Bacteria 8464
277 Ga0395898_0015572 3300037466 Bacteria 7796
278 Ga0395898_0059479 3300037466 Bacteria 3717
279 Ga0395905_0036631 3300037471 Unclassified 4608
280 Ga0395905_0459949 3300037471 Bacteria 1171
281 Ga0395901_0100204 3300038443 Bacteria 3038
282 Ga0395901_0254704 3300038443 Bacteria 1828
283 Ga0439458_0011588 3300042157 Bacteria 1974
284 Ga0451577_0190180 3300042876 Bacteria 1852
285 Ga0451577_0953499 3300042876 Unclassified 771
286 Ga0466964_0357235 3300044706 Unclassified 752
287 Ga0453684_0000045 3300044712 Bacteria 582917
288 Ga0453684_0695291 3300044712 Bacteria 1105
289 Ga0451576_0000214 3300045051 Bacteria 144183
290 Ga0451576_0011717 3300045051 Bacteria 9934
291 Ga0451576_0250055 3300045051 Bacteria 1853
292 Ga0451576_0639506 3300045051 Unclassified 1118
293 Ga0451576_1423544 3300045051 Bacteria 721
294 Ga0495592_0618550 3300046454 Unclassified 659
295 Ga0495651_0022880 3300046462 Unclassified 4860
296 Ga0495584_0237830 3300046491 Bacteria 926
297 Ga0495628_0109365 3300046516 Bacteria 2127
298 Ga0495630_0055471 3300046517 Bacteria 2970
299 Ga0495652_0567897 3300046529 Unclassified 778
300 Ga0495640_0247009 3300046533 Bacteria 1119
301 Ga0495598_0056328 3300046537 Bacteria 1200
302 Ga0495598_0189551 3300046537 Bacteria 738
303 Ga0495645_0202076 3300046543 Unclassified 1347
304 Ga0495645_0351867 3300046543 Unclassified 949
305 Ga0495667_0111657 3300046559 Unclassified 1766
306 Ga0495659_0179398 3300046664 Bacteria 862
307 Ga0495599_0057371 3300046678 Bacteria 2437
308 Ga0495647_0184518 3300046681 Bacteria 909
309 Ga0495669_0323068 3300046684 Unclassified 745
310 Ga0495674_0661971 3300047319 Unclassified 822
311 Ga0495675_0132381 3300047444 Bacteria 1549
312 Ga0496101_0146793 3300048904 Unclassified 1801
313 Ga0496102_0351508 3300048905 Bacteria 1388
314 Ga0496103_0532188 3300048906 Unclassified 751
315 Ga0496104_0035063 3300048907 Bacteria 4683
316 Ga0496104_0198397 3300048907 Bacteria 1919
317 Ga0496104_0280628 3300048907 Bacteria 1579
318 Ga0496105_0964737 3300048908 Bacteria 639
319 Ga0496106_0107570 3300048909 Bacteria 2169
320 Ga0496108_0867342 3300048911 Bacteria 776
321 Ga0496109_0432938 3300048912 Unclassified 1242
322 Ga0496109_0569108 3300048912 Bacteria 1068
323 Ga0496110_0026713 3300048913 Bacteria 4944
324 Ga0496110_0475188 3300048913 Bacteria 1139
325 Ga0496111_0779535 3300048914 Bacteria 693
326 Ga0496112_0022165 3300048915 Bacteria 6052
327 Ga0496112_0077711 3300048915 Unclassified 3283
328 Ga0496112_0271696 3300048915 Bacteria 1643
329 Ga0496112_0380197 3300048915 Bacteria 1353
330 Ga0496113_0383441 3300048916 Unclassified 1128
331 Ga0496115_0004910 3300048918 Bacteria 9707
332 Ga0496115_0264345 3300048918 Bacteria 1415
333 Ga0501032_0000570 3300049569 Bacteria 29860
334 Ga0501032_0023684 3300049569 Bacteria 4239
335 Ga0501033_0003823 3300049570 Bacteria 12252
336 Ga0501034_0194478 3300049571 Unclassified 1989
337 Ga0501034_0331886 3300049571 Bacteria 1452
338 Ga0501036_0032907 3300049572 Bacteria 4383
339 Ga0501036_0995478 3300049572 Bacteria 686
340 Ga0501037_0003745 3300049573 Bacteria 11033
341 Ga0501038_0018559 3300049574 Bacteria 6281
342 Ga0501038_0179454 3300049574 Unclassified 1709
343 Ga0501038_0866220 3300049574 Unclassified 668
344 Ga0501039_0139330 3300049575 Bacteria 1905
345 Ga0501042_0037587 3300049578 Bacteria 3436
346 Ga0501043_0083564 3300049579 Bacteria 2510
347 Ga0501043_0094968 3300049579 Bacteria 2343
348 Ga0501043_0401890 3300049579 Unclassified 1035
349 Ga0501046_0002983 3300049580 Bacteria 15641
350 Ga0501046_0009180 3300049580 Bacteria 8565
351 Ga0501046_0014500 3300049580 Bacteria 6646
352 Ga0501046_0015844 3300049580 Bacteria 6325
353 Ga0501046_0115442 3300049580 Bacteria 2047
354 Ga0501047_0007727 3300049581 Bacteria 10125
355 Ga0501047_0028975 3300049581 Bacteria 5340
356 Ga0501047_0044684 3300049581 Bacteria 4281
357 Ga0501047_0077361 3300049581 Bacteria 3201
358 Ga0501048_0017744 3300049582 Bacteria 5237
359 Ga0501080_0358065 3300049742 Bacteria 1317
360 Ga0501083_0136047 3300049744 Bacteria 1610
361 Ga0501035_0000478 3300049822 Bacteria 44866
362 Ga0501035_0006345 3300049822 Bacteria 11117
363 Ga0501035_0009703 3300049822 Bacteria 8955
364 Ga0501035_0094070 3300049822 Unclassified 2636
365 Ga0501044_0000551 3300049823 Bacteria 45564
366 Ga0501044_0007905 3300049823 Bacteria 11694
367 nmdc:mga05p37_7209_c1 3300050507 Bacteria 13119
368 nmdc:mga0n895_1023213_c1 3300050512 Bacteria 806
369 nmdc:mga0n895_254180_c1 3300050512 Unclassified 1783
370 nmdc:mga0rr50_611734_c1 3300050513 Bacteria 929
371 Ga0495595_0126283 3300053084 Bacteria 1248
372 Ga0495619_0038880 3300053085 Bacteria 3105
373 Ga0500568_0015309 3300053139 Bacteria 3435
374 Ga0500588_0019042 3300053146 Bacteria 1819
375 Ga0500622_0020281 3300053156 Bacteria 3530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031239 Ga0265328_10108080 Ga0265328_101080803 166
2 3300005439 Ga0070711_100218294 Ga0070711_1002182942 170
3 3300006358 Ga0068871_100010844 Ga0068871_1000108444 170
4 3300013296 Ga0157374_10120996 Ga0157374_101209963 170
5 3300025915 Ga0207693_10049358 Ga0207693_100493584 170
6 3300025916 Ga0207663_10112747 Ga0207663_101127474 170
7 3300046543 Ga0495645_0351867 Ga0495645_0351867_77_685 170
8 3300048904 Ga0496101_0146793 Ga0496101_0146793_1155_1763 170
9 3300048905 Ga0496102_0351508 Ga0496102_0351508_171_779 170
10 3300048907 Ga0496104_0035063 Ga0496104_0035063_1949_2557 170
11 3300048909 Ga0496106_0107570 Ga0496106_0107570_891_1499 170
12 3300048912 Ga0496109_0432938 Ga0496109_0432938_518_1126 170
13 3300048915 Ga0496112_0022165 Ga0496112_0022165_3940_4548 170
14 3300048918 Ga0496115_0004910 Ga0496115_0004910_6434_7042 170
15 3300006871 Ga0075434_100938519 Ga0075434_1009385191 174
16 3300005367 Ga0070667_100049655 Ga0070667_1000496556 175
17 3300005843 Ga0068860_100053308 Ga0068860_1000533083 175
18 3300028381 Ga0268264_10248998 Ga0268264_102489983 175
19 3300028573 Ga0265334_10004173 Ga0265334_100041732 176
20 3300028577 Ga0265318_10000063 Ga0265318_100000639 176
21 3300031240 Ga0265320_10005889 Ga0265320_100058893 176
22 3300031241 Ga0265325_10091273 Ga0265325_100912731 176
23 3300031249 Ga0265339_10077065 Ga0265339_100770652 176
24 3300031250 Ga0265331_10070703 Ga0265331_100707033 176
25 3300031595 Ga0265313_10014573 Ga0265313_100145733 176
26 3300031711 Ga0265314_10000861 Ga0265314_1000086125 176
27 3300005937 Ga0081455_10226653 Ga0081455_102266532 177
28 3300049579 Ga0501043_0083564 Ga0501043_0083564_836_1438 177
29 3300005530 Ga0070679_100074750 Ga0070679_1000747502 179
30 3300005290 Ga0065712_10080571 Ga0065712_100805714 180
31 3300005328 Ga0070676_10137919 Ga0070676_101379192 180
32 3300005330 Ga0070690_100193058 Ga0070690_1001930582 180
33 3300005331 Ga0070670_100024887 Ga0070670_1000248876 180
34 3300005331 Ga0070670_100075660 Ga0070670_1000756604 180
35 3300005335 Ga0070666_10102507 Ga0070666_101025072 180
36 3300005338 Ga0068868_100091308 Ga0068868_1000913083 180
37 3300005338 Ga0068868_100408252 Ga0068868_1004082522 180
38 3300005340 Ga0070689_100130482 Ga0070689_1001304822 180
39 3300005347 Ga0070668_100632514 Ga0070668_1006325141 180
40 3300005353 Ga0070669_100015906 Ga0070669_1000159062 180
41 3300005354 Ga0070675_100108363 Ga0070675_1001083633 180
42 3300005354 Ga0070675_100245159 Ga0070675_1002451593 180
43 3300005355 Ga0070671_100009917 Ga0070671_1000099176 180
44 3300005355 Ga0070671_100011519 Ga0070671_1000115195 180
45 3300005356 Ga0070674_100194113 Ga0070674_1001941133 180
46 3300005364 Ga0070673_100007562 Ga0070673_1000075624 180
47 3300005365 Ga0070688_100109137 Ga0070688_1001091373 180
48 3300005367 Ga0070667_100034528 Ga0070667_1000345282 180
49 3300005455 Ga0070663_100205303 Ga0070663_1002053032 180
50 3300005459 Ga0068867_100078135 Ga0068867_1000781353 180
51 3300005466 Ga0070685_10057457 Ga0070685_100574571 180
52 3300005543 Ga0070672_100322438 Ga0070672_1003224382 180
53 3300005544 Ga0070686_100212970 Ga0070686_1002129702 180
54 3300005548 Ga0070665_100193985 Ga0070665_1001939854 180
55 3300005548 Ga0070665_100516998 Ga0070665_1005169982 180
56 3300006237 Ga0097621_100019522 Ga0097621_1000195222 180
57 3300006237 Ga0097621_100076368 Ga0097621_1000763682 180
58 3300006358 Ga0068871_100022934 Ga0068871_1000229345 180
59 3300006871 Ga0075434_100249034 Ga0075434_1002490343 180
60 3300013296 Ga0157374_10004858 Ga0157374_100048585 180
61 3300013296 Ga0157374_10012390 Ga0157374_1001239012 180
62 3300013297 Ga0157378_10081463 Ga0157378_100814633 180
63 3300013306 Ga0163162_10033588 Ga0163162_100335885 180
64 3300013306 Ga0163162_10420447 Ga0163162_104204472 180
65 3300013308 Ga0157375_10004291 Ga0157375_1000429114 180
66 3300014325 Ga0163163_10635319 Ga0163163_106353192 180
67 3300014969 Ga0157376_10014931 Ga0157376_100149317 180
68 3300025315 Ga0207697_10000095 Ga0207697_1000009540 180
69 3300025901 Ga0207688_10005856 Ga0207688_100058562 180
70 3300025923 Ga0207681_10215510 Ga0207681_102155102 180
71 3300025925 Ga0207650_10033136 Ga0207650_100331363 180
72 3300025925 Ga0207650_10061351 Ga0207650_100613511 180
73 3300025925 Ga0207650_10153351 Ga0207650_101533512 180
74 3300025926 Ga0207659_10004515 Ga0207659_1000451510 180
75 3300025926 Ga0207659_10417826 Ga0207659_104178262 180
76 3300025931 Ga0207644_10010293 Ga0207644_100102932 180
77 3300025931 Ga0207644_10164667 Ga0207644_101646672 180
78 3300025936 Ga0207670_10043987 Ga0207670_100439873 180
79 3300025940 Ga0207691_10000155 Ga0207691_1000015543 180
80 3300025960 Ga0207651_10366536 Ga0207651_103665362 180
81 3300026067 Ga0207678_10921847 Ga0207678_109218471 180
82 3300026089 Ga0207648_10090598 Ga0207648_100905983 180
83 3300026121 Ga0207683_10009196 Ga0207683_1000919612 180
84 3300028379 Ga0268266_10382769 Ga0268266_103827692 180
85 3300035120 Ga0373957_0017447 Ga0373957_0017447_1045_1701 180
86 3300035171 Ga0373946_0199278 Ga0373946_0199278_29_685 180
87 3300035172 Ga0373955_0154096 Ga0373955_0154096_687_1343 180
88 3300035725 Ga0373947_0452958 Ga0373947_0452958_122_667 180
89 3300036401 Ga0373937_0651447 Ga0373937_0651447_123_668 180
90 3300046462 Ga0495651_0022880 Ga0495651_0022880_3908_4564 180
91 3300046516 Ga0495628_0109365 Ga0495628_0109365_594_1250 180
92 3300046517 Ga0495630_0055471 Ga0495630_0055471_1373_2029 180
93 3300046529 Ga0495652_0567897 Ga0495652_0567897_89_634 180
94 3300046543 Ga0495645_0202076 Ga0495645_0202076_156_812 180
95 3300046559 Ga0495667_0111657 Ga0495667_0111657_887_1543 180
96 3300046678 Ga0495599_0057371 Ga0495599_0057371_1787_2332 180
97 3300047319 Ga0495674_0661971 Ga0495674_0661971_187_732 180
98 3300047444 Ga0495675_0132381 Ga0495675_0132381_432_1088 180
99 3300048908 Ga0496105_0964737 Ga0496105_0964737_52_597 180
100 3300048911 Ga0496108_0867342 Ga0496108_0867342_114_659 180
101 3300048914 Ga0496111_0779535 Ga0496111_0779535_46_591 180
102 3300048915 Ga0496112_0077711 Ga0496112_0077711_458_1003 180
103 3300048915 Ga0496112_0380197 Ga0496112_0380197_604_1149 180
104 3300048916 Ga0496113_0383441 Ga0496113_0383441_325_870 180
105 3300050512 nmdc:mga0n895_254180_c1 nmdc:mga0n895_254180_c1_569_1114 180
106 3300003320 rootH2_10015864 rootH2_100158648 181
107 3300005329 Ga0070683_100016047 Ga0070683_1000160474 181
108 3300025944 Ga0207661_10019646 Ga0207661_100196465 181
109 3300026041 Ga0207639_10899654 Ga0207639_108996541 181
110 3300042876 Ga0451577_0190180 Ga0451577_0190180_1186_1761 181
111 3300044712 Ga0453684_0695291 Ga0453684_0695291_10_585 181
112 3300045051 Ga0451576_0250055 Ga0451576_0250055_1223_1798 181
113 3300049574 Ga0501038_0866220 Ga0501038_0866220_45_620 181
114 3300049579 Ga0501043_0401890 Ga0501043_0401890_66_641 181
115 3300049580 Ga0501046_0009180 Ga0501046_0009180_1592_2167 181
116 3300049580 Ga0501046_0014500 Ga0501046_0014500_2117_2692 181
117 3300049581 Ga0501047_0007727 Ga0501047_0007727_2879_3454 181
118 3300049581 Ga0501047_0044684 Ga0501047_0044684_941_1516 181
119 3300049744 Ga0501083_0136047 Ga0501083_0136047_982_1557 181
120 3300049822 Ga0501035_0000478 Ga0501035_0000478_8905_9480 181
121 3300049823 Ga0501044_0000551 Ga0501044_0000551_166_741 181
122 3300053146 Ga0500588_0019042 Ga0500588_0019042_245_820 181
123 3300003322 rootL2_10022543 rootL2_100225434 182
124 3300028573 Ga0265334_10005073 Ga0265334_100050732 182
125 3300028577 Ga0265318_10000002 Ga0265318_1000000284 182
126 3300028794 Ga0307515_10131864 Ga0307515_101318643 182
127 3300029957 Ga0265324_10005271 Ga0265324_100052712 182
128 3300031240 Ga0265320_10003032 Ga0265320_100030322 182
129 3300031242 Ga0265329_10069946 Ga0265329_100699461 182
130 3300031250 Ga0265331_10072921 Ga0265331_100729213 182
131 3300031251 Ga0265327_10000325 Ga0265327_1000032576 182
132 3300031251 Ga0265327_10002415 Ga0265327_1000241514 182
133 3300031595 Ga0265313_10001431 Ga0265313_1000143120 182
134 3300031616 Ga0307508_10000183 Ga0307508_1000018349 182
135 3300031711 Ga0265314_10004826 Ga0265314_100048262 182
136 3300049571 Ga0501034_0331886 Ga0501034_0331886_116_694 182
137 3300053139 Ga0500568_0015309 Ga0500568_0015309_1176_1754 182
138 3300053156 Ga0500622_0020281 Ga0500622_0020281_941_1519 182
139 3300028653 Ga0265323_10069446 Ga0265323_100694462 183
140 3300028577 Ga0265318_10001035 Ga0265318_1000103515 184
141 3300028653 Ga0265323_10000260 Ga0265323_1000026024 184
142 3300028654 Ga0265322_10000298 Ga0265322_1000029816 184
143 3300028666 Ga0265336_10043236 Ga0265336_100432361 184
144 3300028800 Ga0265338_10013274 Ga0265338_100132742 184
145 3300029957 Ga0265324_10113667 Ga0265324_101136671 184
146 3300031235 Ga0265330_10076445 Ga0265330_100764452 184
147 3300031240 Ga0265320_10000564 Ga0265320_1000056412 184
148 3300031241 Ga0265325_10294146 Ga0265325_102941461 184
149 3300031344 Ga0265316_10009437 Ga0265316_100094376 184
150 3300031711 Ga0265314_10005628 Ga0265314_100056282 184
151 3300042876 Ga0451577_0953499 Ga0451577_0953499_156_740 184
152 3300044712 Ga0453684_0000045 Ga0453684_0000045_421702_422286 184
153 3300005289 Ga0065704_10052061 Ga0065704_100520612 185
154 3300005290 Ga0065712_10108388 Ga0065712_101083883 185
155 3300005295 Ga0065707_10010780 Ga0065707_100107802 185
156 3300005328 Ga0070676_10120872 Ga0070676_101208723 185
157 3300005338 Ga0068868_100370837 Ga0068868_1003708372 185
158 3300005445 Ga0070708_100651686 Ga0070708_1006516861 185
159 3300005456 Ga0070678_100083377 Ga0070678_1000833773 185
160 3300005467 Ga0070706_100273112 Ga0070706_1002731123 185
161 3300005468 Ga0070707_100642466 Ga0070707_1006424661 185
162 3300005546 Ga0070696_100133284 Ga0070696_1001332844 185
163 3300006175 Ga0070712_100011045 Ga0070712_1000110456 185
164 3300007076 Ga0075435_100510100 Ga0075435_1005101002 185
165 3300013296 Ga0157374_10062126 Ga0157374_100621266 185
166 3300013297 Ga0157378_10655197 Ga0157378_106551972 185
167 3300013306 Ga0163162_10194108 Ga0163162_101941082 185
168 3300013308 Ga0157375_11470566 Ga0157375_114705662 185
169 3300014969 Ga0157376_10311908 Ga0157376_103119083 185
170 3300025915 Ga0207693_10008661 Ga0207693_100086616 185
171 3300025916 Ga0207663_10156838 Ga0207663_101568382 185
172 3300025922 Ga0207646_10526597 Ga0207646_105265971 185
173 3300025928 Ga0207700_10543195 Ga0207700_105431952 185
174 3300028563 Ga0265319_1004596 Ga0265319_10045964 185
175 3300031595 Ga0265313_10002447 Ga0265313_100024473 185
176 3300031711 Ga0265314_10015734 Ga0265314_100157343 185
177 3300035170 Ga0373943_0118394 Ga0373943_0118394_416_976 185
178 3300035692 Ga0373935_0050934 Ga0373935_0050934_123_683 185
179 3300035695 Ga0373927_0124176 Ga0373927_0124176_573_1133 185
180 3300035725 Ga0373947_0038549 Ga0373947_0038549_1601_2161 185
181 3300046491 Ga0495584_0237830 Ga0495584_0237830_201_761 185
182 3300046537 Ga0495598_0056328 Ga0495598_0056328_333_893 185
183 3300046664 Ga0495659_0179398 Ga0495659_0179398_138_698 185
184 3300046681 Ga0495647_0184518 Ga0495647_0184518_301_861 185
185 3300046684 Ga0495669_0323068 Ga0495669_0323068_160_720 185
186 3300048907 Ga0496104_0198397 Ga0496104_0198397_932_1492 185
187 3300048912 Ga0496109_0569108 Ga0496109_0569108_153_713 185
188 3300048913 Ga0496110_0475188 Ga0496110_0475188_253_813 185
189 3300048915 Ga0496112_0271696 Ga0496112_0271696_613_1173 185
190 3300050513 nmdc:mga0rr50_611734_c1 nmdc:mga0rr50_611734_c1_156_716 185
191 3300031240 Ga0265320_10002882 Ga0265320_100028829 186
192 3300037312 Ga0395899_0219681 Ga0395899_0219681_308_874 186
193 3300037466 Ga0395898_0059479 Ga0395898_0059479_79_645 186
194 3300037471 Ga0395905_0459949 Ga0395905_0459949_301_867 186
195 3300038443 Ga0395901_0254704 Ga0395901_0254704_355_921 186
196 3300005329 Ga0070683_100048641 Ga0070683_1000486414 187
197 3300005458 Ga0070681_10328749 Ga0070681_103287493 187
198 3300049580 Ga0501046_0002983 Ga0501046_0002983_11767_12363 187
199 3300049581 Ga0501047_0028975 Ga0501047_0028975_401_997 187
200 3300013296 Ga0157374_10875588 Ga0157374_108755882 188
201 3300013297 Ga0157378_10332044 Ga0157378_103320441 188
202 3300005535 Ga0070684_100425280 Ga0070684_1004252802 189
203 3300005614 Ga0068856_100217694 Ga0068856_1002176942 189
204 3300005718 Ga0068866_10590180 Ga0068866_105901801 189
205 3300025899 Ga0207642_10484536 Ga0207642_104845361 189
206 3300025910 Ga0207684_10000751 Ga0207684_1000075142 189
207 3300025944 Ga0207661_10007948 Ga0207661_100079483 189
208 3300028573 Ga0265334_10095351 Ga0265334_100953511 189
209 3300031711 Ga0265314_10107544 Ga0265314_101075442 189
210 3300049569 Ga0501032_0000570 Ga0501032_0000570_27165_27764 189
211 3300049571 Ga0501034_0194478 Ga0501034_0194478_290_889 189
212 3300049572 Ga0501036_0032907 Ga0501036_0032907_2623_3222 189
213 3300049573 Ga0501037_0003745 Ga0501037_0003745_4790_5389 189
214 3300049574 Ga0501038_0018559 Ga0501038_0018559_1260_1859 189
215 3300049575 Ga0501039_0139330 Ga0501039_0139330_665_1264 189
216 3300049578 Ga0501042_0037587 Ga0501042_0037587_302_901 189
217 3300049579 Ga0501043_0094968 Ga0501043_0094968_860_1459 189
218 3300049580 Ga0501046_0115442 Ga0501046_0115442_1146_1745 189
219 3300049582 Ga0501048_0017744 Ga0501048_0017744_3790_4389 189
220 3300049822 Ga0501035_0006345 Ga0501035_0006345_687_1286 189
221 3300049822 Ga0501035_0009703 Ga0501035_0009703_5095_5694 189
222 3300045051 Ga0451576_0000214 Ga0451576_0000214_41163_41765 190
223 3300045051 Ga0451576_0011717 Ga0451576_0011717_3754_4356 190
224 3300045051 Ga0451576_1423544 Ga0451576_1423544_101_703 190
225 3300049569 Ga0501032_0023684 Ga0501032_0023684_1532_2134 190
226 3300049570 Ga0501033_0003823 Ga0501033_0003823_8598_9200 190
227 3300049572 Ga0501036_0995478 Ga0501036_0995478_24_626 190
228 3300049574 Ga0501038_0179454 Ga0501038_0179454_81_683 190
229 3300049580 Ga0501046_0015844 Ga0501046_0015844_2577_3179 190
230 3300049581 Ga0501047_0077361 Ga0501047_0077361_2399_3001 190
231 3300049742 Ga0501080_0358065 Ga0501080_0358065_581_1183 190
232 3300049822 Ga0501035_0094070 Ga0501035_0094070_935_1537 190
233 3300049823 Ga0501044_0007905 Ga0501044_0007905_9744_10346 190
234 3300006237 Ga0097621_100780083 Ga0097621_1007800832 191
235 3300009098 Ga0105245_10385478 Ga0105245_103854782 191
236 3300013296 Ga0157374_10363128 Ga0157374_103631282 191
237 3300026023 Ga0207677_10165817 Ga0207677_101658173 191
238 3300028563 Ga0265319_1012672 Ga0265319_10126723 191
239 3300031711 Ga0265314_10070667 Ga0265314_100706671 191
240 3300028558 Ga0265326_10055646 Ga0265326_100556462 192
241 3300028577 Ga0265318_10001375 Ga0265318_1000137513 192
242 3300028577 Ga0265318_10024821 Ga0265318_100248213 192
243 3300028654 Ga0265322_10022337 Ga0265322_100223372 192
244 3300028666 Ga0265336_10001462 Ga0265336_1000146213 192
245 3300028800 Ga0265338_10001341 Ga0265338_1000134136 192
246 3300029957 Ga0265324_10000710 Ga0265324_1000071015 192
247 3300031239 Ga0265328_10072758 Ga0265328_100727582 192
248 3300031240 Ga0265320_10004894 Ga0265320_100048943 192
249 3300031240 Ga0265320_10019061 Ga0265320_100190615 192
250 3300031251 Ga0265327_10002448 Ga0265327_1000244818 192
251 3300031344 Ga0265316_10018152 Ga0265316_100181522 192
252 3300031711 Ga0265314_10003822 Ga0265314_1000382211 192
253 3300031712 Ga0265342_10023178 Ga0265342_100231782 192
254 3300005937 Ga0081455_10130483 Ga0081455_101304832 193
255 3300009147 Ga0114129_11195956 Ga0114129_111959562 195
256 3300005290 Ga0065712_10450847 Ga0065712_104508471 196
257 3300005328 Ga0070676_10003641 Ga0070676_100036415 196
258 3300005347 Ga0070668_100108648 Ga0070668_1001086482 196
259 3300005354 Ga0070675_100335862 Ga0070675_1003358622 196
260 3300005366 Ga0070659_100307596 Ga0070659_1003075962 196
261 3300005367 Ga0070667_100011877 Ga0070667_1000118774 196
262 3300013296 Ga0157374_10246690 Ga0157374_102466901 196
263 3300013297 Ga0157378_10092329 Ga0157378_100923292 196
264 3300025271 Ga0207666_1004755 Ga0207666_10047552 196
265 3300025901 Ga0207688_10035611 Ga0207688_100356112 196
266 3300025907 Ga0207645_10000188 Ga0207645_1000018832 196
267 3300025923 Ga0207681_10011304 Ga0207681_100113045 196
268 3300025926 Ga0207659_10425710 Ga0207659_104257102 196
269 3300025986 Ga0207658_10039396 Ga0207658_100393962 196
270 3300026118 Ga0207675_100191240 Ga0207675_1001912402 196
271 3300028381 Ga0268264_10077336 Ga0268264_100773362 196
272 3300045051 Ga0451576_0639506 Ga0451576_0639506_240_833 196
273 3300005445 Ga0070708_100120118 Ga0070708_1001201182 197
274 3300005467 Ga0070706_100302329 Ga0070706_1003023292 197
275 3300005468 Ga0070707_100579118 Ga0070707_1005791182 197
276 3300025910 Ga0207684_10302322 Ga0207684_103023221 197
277 3300025922 Ga0207646_10590538 Ga0207646_105905382 197
278 3300005337 Ga0070682_100683088 Ga0070682_1006830882 198
279 3300044706 Ga0466964_0357235 Ga0466964_0357235_107_703 198
280 3300002126 JGI24035J26624_1000209 JGI24035J26624_10002092 199
281 3300005295 Ga0065707_10186776 Ga0065707_101867761 199
282 3300005329 Ga0070683_100001147 Ga0070683_1000011472 199
283 3300005329 Ga0070683_100094017 Ga0070683_1000940173 199
284 3300005331 Ga0070670_100100653 Ga0070670_1001006531 199
285 3300005334 Ga0068869_100052818 Ga0068869_1000528183 199
286 3300005339 Ga0070660_100031256 Ga0070660_1000312561 199
287 3300005340 Ga0070689_100015452 Ga0070689_1000154521 199
288 3300005344 Ga0070661_100697360 Ga0070661_1006973602 199
289 3300005345 Ga0070692_10146710 Ga0070692_101467102 199
290 3300005354 Ga0070675_100001412 Ga0070675_1000014126 199
291 3300005366 Ga0070659_100006232 Ga0070659_1000062323 199
292 3300005367 Ga0070667_100010413 Ga0070667_1000104139 199
293 3300005435 Ga0070714_100069356 Ga0070714_1000693563 199
294 3300005436 Ga0070713_100099721 Ga0070713_1000997212 199
295 3300005437 Ga0070710_10027832 Ga0070710_100278322 199
296 3300005439 Ga0070711_100066737 Ga0070711_1000667372 199
297 3300005440 Ga0070705_100098412 Ga0070705_1000984122 199
298 3300005441 Ga0070700_100048124 Ga0070700_1000481242 199
299 3300005444 Ga0070694_100044768 Ga0070694_1000447682 199
300 3300005455 Ga0070663_100499968 Ga0070663_1004999682 199
301 3300005457 Ga0070662_100457885 Ga0070662_1004578852 199
302 3300005466 Ga0070685_10299155 Ga0070685_102991552 199
303 3300005535 Ga0070684_100001034 Ga0070684_1000010347 199
304 3300005548 Ga0070665_100166454 Ga0070665_1001664542 199
305 3300005549 Ga0070704_100008156 Ga0070704_1000081564 199
306 3300005564 Ga0070664_100022165 Ga0070664_1000221657 199
307 3300005617 Ga0068859_100040358 Ga0068859_1000403582 199
308 3300005841 Ga0068863_100034903 Ga0068863_1000349033 199
309 3300005842 Ga0068858_100020474 Ga0068858_1000204742 199
310 3300005843 Ga0068860_100036999 Ga0068860_1000369993 199
311 3300005843 Ga0068860_101203906 Ga0068860_1012039061 199
312 3300005985 Ga0081539_10044546 Ga0081539_100445462 199
313 3300006028 Ga0070717_10218486 Ga0070717_102184862 199
314 3300006163 Ga0070715_10025079 Ga0070715_100250792 199
315 3300006871 Ga0075434_100952456 Ga0075434_1009524562 199
316 3300006871 Ga0075434_101098177 Ga0075434_1010981772 199
317 3300006931 Ga0097620_100040357 Ga0097620_1000403572 199
318 3300009147 Ga0114129_10004430 Ga0114129_100044308 199
319 3300009553 Ga0105249_10030822 Ga0105249_100308222 199
320 3300009553 Ga0105249_11399428 Ga0105249_113994281 199
321 3300010375 Ga0105239_10072900 Ga0105239_100729003 199
322 3300013296 Ga0157374_10309862 Ga0157374_103098622 199
323 3300013297 Ga0157378_10034031 Ga0157378_100340313 199
324 3300013306 Ga0163162_10945694 Ga0163162_109456941 199
325 3300013308 Ga0157375_10022759 Ga0157375_100227595 199
326 3300014745 Ga0157377_10064880 Ga0157377_100648802 199
327 3300014968 Ga0157379_10016304 Ga0157379_100163044 199
328 3300014969 Ga0157376_10027748 Ga0157376_100277485 199
329 3300025315 Ga0207697_10000049 Ga0207697_1000004913 199
330 3300025315 Ga0207697_10000159 Ga0207697_1000015932 199
331 3300025315 Ga0207697_10011532 Ga0207697_100115322 199
332 3300025898 Ga0207692_10453286 Ga0207692_104532861 199
333 3300025904 Ga0207647_10008407 Ga0207647_100084075 199
334 3300025905 Ga0207685_10076738 Ga0207685_100767382 199
335 3300025906 Ga0207699_10125109 Ga0207699_101251092 199
336 3300025915 Ga0207693_10015357 Ga0207693_100153576 199
337 3300025915 Ga0207693_10038499 Ga0207693_100384993 199
338 3300025916 Ga0207663_10001921 Ga0207663_100019219 199
339 3300025926 Ga0207659_10005926 Ga0207659_100059261 199
340 3300025928 Ga0207700_10003381 Ga0207700_100033812 199
341 3300025929 Ga0207664_10057513 Ga0207664_100575133 199
342 3300025933 Ga0207706_10208412 Ga0207706_102084122 199
343 3300025936 Ga0207670_10005685 Ga0207670_100056857 199
344 3300025944 Ga0207661_10017756 Ga0207661_100177567 199
345 3300025944 Ga0207661_10115683 Ga0207661_101156832 199
346 3300025961 Ga0207712_10024847 Ga0207712_100248472 199
347 3300025961 Ga0207712_10125935 Ga0207712_101259352 199
348 3300025972 Ga0207668_10106832 Ga0207668_101068323 199
349 3300025986 Ga0207658_10739407 Ga0207658_107394072 199
350 3300026023 Ga0207677_11154169 Ga0207677_111541691 199
351 3300026035 Ga0207703_10022192 Ga0207703_100221923 199
352 3300026067 Ga0207678_10002007 Ga0207678_100020072 199
353 3300026075 Ga0207708_10025707 Ga0207708_100257073 199
354 3300026088 Ga0207641_10025166 Ga0207641_100251664 199
355 3300026095 Ga0207676_10456224 Ga0207676_104562242 199
356 3300028381 Ga0268264_10010917 Ga0268264_100109176 199
357 3300035170 Ga0373943_0089177 Ga0373943_0089177_493_1101 199
358 3300035692 Ga0373935_0440848 Ga0373935_0440848_69_677 199
359 3300036401 Ga0373937_0228000 Ga0373937_0228000_1105_1710 199
360 3300037418 Ga0395900_0013131 Ga0395900_0013131_4421_5029 199
361 3300037466 Ga0395898_0015572 Ga0395898_0015572_6548_7156 199
362 3300037471 Ga0395905_0036631 Ga0395905_0036631_646_1254 199
363 3300038443 Ga0395901_0100204 Ga0395901_0100204_1791_2399 199
364 3300042157 Ga0439458_0011588 Ga0439458_0011588_78_683 199
365 3300046454 Ga0495592_0618550 Ga0495592_0618550_35_640 199
366 3300046533 Ga0495640_0247009 Ga0495640_0247009_313_918 199
367 3300046537 Ga0495598_0189551 Ga0495598_0189551_119_718 199
368 3300048906 Ga0496103_0532188 Ga0496103_0532188_130_738 199
369 3300048907 Ga0496104_0280628 Ga0496104_0280628_792_1397 199
370 3300048913 Ga0496110_0026713 Ga0496110_0026713_3721_4320 199
371 3300048918 Ga0496115_0264345 Ga0496115_0264345_592_1197 199
372 3300050507 nmdc:mga05p37_7209_c1 nmdc:mga05p37_7209_c1_7881_8489 199
373 3300050512 nmdc:mga0n895_1023213_c1 nmdc:mga0n895_1023213_c1_25_624 199
374 3300053084 Ga0495595_0126283 Ga0495595_0126283_445_1053 199
375 3300053085 Ga0495619_0038880 Ga0495619_0038880_1537_2145 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

40

176

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9046 29 71
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8953 28 71
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8905 28 71
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8884 29 71
4hf2-assembly1.cif.gz_B crystal structure of e43a iscr mutant bound to its promoter 0.8733 1 142
ID Description Score Start End Superfamily
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9046 29 71 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8953 28 71 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8913 27 70 3.30.230.130
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8905 28 71 1.10.10.10
2y75D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8882 1 137 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4P5QVE9-F1-model_v4 Rrf2 family transcriptional regulator 0.9078 1 151 GO:0003700
GO:0005829
AF-A0A1E9DBJ5-F1-model_v4 Transcriptional regulator 0.903 1 138 GO:0003700
GO:0005829
AF-A0A7V4THM6-F1-model_v4 Rrf2 family transcriptional regulator 0.9018 1 140 GO:0003700
GO:0005829
AF-A0A1F2ULZ4-F1-model_v4 Rrf2 family transcriptional regulator 0.8982 1 148 GO:0003700
GO:0005829
AF-A0A0D2JCC8-F1-model_v4 AsnC family transcriptional regulator 0.8961 1 148 GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
73.73 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map