F426981

General Info

Members Datasets Scaffolds Average Seq Length
375 184 750 184

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100284600|Ga0068856_1002846002
Length 197
Sequence MRMFVALAIPDSVAQSLLLIQGGVPGARWQSREQLHLTLSFIGEVDGRDAAMIDDALAGIRAPAFSLQLHGVGQFGEGRRSRAHALWAGARANPALEHLQRKVDTAIRRAGTPAPSSNNQAHKFTPHVTLARMRQPDPGKVVEWLTHNALYTSAEFAVPAFHLYSSKLTSDGSIYRIEQSYDLETQFAEADDDEADD

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
182 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.73
Nodule 0
Rhizoplane 0.53
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 5.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100284600 3300005614 Bacteria 1670
2 JGI25165J46597_1000013 3300003214 Bacteria 402100
3 JGI25153J46596_10001994 3300003215 Bacteria 12065
4 rootH2_10064423 3300003320 Bacteria 1984
5 rootH2_10247014 3300003320 Bacteria 1533
6 rootH1_10249279 3300003323 Bacteria 1495
7 Ga0070658_10033338 3300005327 Bacteria 4143
8 Ga0070658_10375262 3300005327 Bacteria 1219
9 Ga0070676_10340057 3300005328 Bacteria 1029
10 Ga0070683_101007556 3300005329 Bacteria 800
11 Ga0070690_100088516 3300005330 Bacteria 2036
12 Ga0068869_100542558 3300005334 Bacteria 976
13 Ga0070666_10009611 3300005335 Bacteria 6036
14 Ga0070666_10053600 3300005335 Bacteria 2721
15 Ga0070680_100000724 3300005336 Bacteria 22972
16 Ga0070680_100035969 3300005336 Bacteria 3999
17 Ga0068868_100008738 3300005338 Bacteria 7255
18 Ga0068868_100129150 3300005338 Bacteria 2067
19 Ga0070660_100096142 3300005339 Bacteria 2342
20 Ga0070689_100796499 3300005340 Bacteria 831
21 Ga0070691_10262652 3300005341 Bacteria 930
22 Ga0070661_100149127 3300005344 Bacteria 1767
23 Ga0070661_100757950 3300005344 Bacteria 794
24 Ga0070668_100916334 3300005347 Unclassified 784
25 Ga0070671_100360125 3300005355 Bacteria 1242
26 Ga0070673_100010754 3300005364 Bacteria 6210
27 Ga0070673_100694796 3300005364 Bacteria 934
28 Ga0070667_100015920 3300005367 Bacteria 6222
29 Ga0070714_100931626 3300005435 Bacteria 844
30 Ga0070701_10337772 3300005438 Bacteria 937
31 Ga0070663_100823860 3300005455 Bacteria 797
32 Ga0070678_100013152 3300005456 Bacteria 5177
33 Ga0070678_100027041 3300005456 Bacteria 3889
34 Ga0070678_100661434 3300005456 Bacteria 938
35 Ga0070678_100746616 3300005456 Bacteria 885
36 Ga0070662_100018137 3300005457 Bacteria 4757
37 Ga0068867_100006544 3300005459 Bacteria 8228
38 Ga0068867_100018475 3300005459 Bacteria 4957
39 Ga0068867_100845000 3300005459 Unclassified 820
40 Ga0070679_100272524 3300005530 Bacteria 1646
41 Ga0070679_100336435 3300005530 Bacteria 1458
42 Ga0070684_100053368 3300005535 Bacteria 3518
43 Ga0070684_100092677 3300005535 Bacteria 2689
44 Ga0068853_101227931 3300005539 Bacteria 724
45 Ga0070686_100268313 3300005544 Bacteria 1254
46 Ga0070665_100031769 3300005548 Bacteria 5314
47 Ga0070665_100035906 3300005548 Bacteria 4986
48 Ga0070665_100134373 3300005548 Bacteria 2475
49 Ga0070665_100173019 3300005548 Bacteria 2160
50 Ga0070665_100289137 3300005548 Bacteria 1641
51 Ga0070665_100354169 3300005548 Bacteria 1473
52 Ga0070665_100418046 3300005548 Bacteria 1349
53 Ga0070665_100546889 3300005548 Bacteria 1170
54 Ga0070665_101223240 3300005548 Bacteria 762
55 Ga0068855_100000034 3300005563 Bacteria 166436
56 Ga0068855_100025284 3300005563 Bacteria 7107
57 Ga0070664_100393317 3300005564 Bacteria 1267
58 Ga0068856_100069177 3300005614 Bacteria 3491
59 Ga0068856_100230418 3300005614 Bacteria 1868
60 Ga0068856_100338953 3300005614 Bacteria 1521
61 Ga0070702_100704757 3300005615 Unclassified 770
62 Ga0068852_100030426 3300005616 Bacteria 4443
63 Ga0068852_100690157 3300005616 Bacteria 1030
64 Ga0068864_100252531 3300005618 Bacteria 1638
65 Ga0068864_100339642 3300005618 Bacteria 1415
66 Ga0068866_10033699 3300005718 Bacteria 2487
67 Ga0068861_101090544 3300005719 Bacteria 767
68 Ga0068863_100050698 3300005841 Bacteria 3933
69 Ga0068858_100158798 3300005842 Bacteria 2128
70 Ga0068860_100630727 3300005843 Bacteria 1079
71 Ga0097621_100011703 3300006237 Bacteria 6476
72 Ga0097621_100073001 3300006237 Bacteria 2839
73 Ga0097621_100089601 3300006237 Bacteria 2572
74 Ga0097621_100225338 3300006237 Bacteria 1635
75 Ga0097621_100239214 3300006237 Bacteria 1587
76 Ga0097621_100275507 3300006237 Bacteria 1480
77 Ga0097621_101169854 3300006237 Bacteria 724
78 Ga0068871_100023537 3300006358 Bacteria 4767
79 Ga0068871_100025844 3300006358 Bacteria 4574
80 Ga0068871_100066263 3300006358 Bacteria 2960
81 Ga0068871_100120697 3300006358 Bacteria 2214
82 Ga0068871_100172552 3300006358 Bacteria 1854
83 Ga0068871_100809961 3300006358 Unclassified 864
84 Ga0068871_100908873 3300006358 Archaea 816
85 Ga0068865_100015024 3300006881 Bacteria 4930
86 Ga0068865_100050071 3300006881 Bacteria 2884
87 Ga0105240_10000382 3300009093 Bacteria 83108
88 Ga0105240_10012354 3300009093 Bacteria 11792
89 Ga0105240_10050735 3300009093 Bacteria 5228
90 Ga0105240_10153799 3300009093 Bacteria 2737
91 Ga0105240_10198681 3300009093 Bacteria 2352
92 Ga0105240_10282191 3300009093 Bacteria 1907
93 Ga0105240_10467201 3300009093 Bacteria 1409
94 Ga0105240_10517736 3300009093 Bacteria 1324
95 Ga0105240_10913977 3300009093 Bacteria 943
96 Ga0105240_11213097 3300009093 Bacteria 798
97 Ga0105245_10050583 3300009098 Bacteria 3725
98 Ga0105245_10166527 3300009098 Bacteria 2095
99 Ga0105245_11187629 3300009098 Bacteria 811
100 Ga0105247_10992741 3300009101 Unclassified 655
101 Ga0105243_10004010 3300009148 Bacteria 11730
102 Ga0105243_10704100 3300009148 Bacteria 985
103 Ga0105241_10047182 3300009174 Bacteria 3275
104 Ga0105241_10080582 3300009174 Bacteria 2549
105 Ga0105241_10103074 3300009174 Bacteria 2272
106 Ga0105241_10212996 3300009174 Bacteria 1620
107 Ga0105241_10857994 3300009174 Bacteria 840
108 Ga0105241_10966624 3300009174 Bacteria 795
109 Ga0105242_10012514 3300009176 Bacteria 6532
110 Ga0105242_10127343 3300009176 Bacteria 2193
111 Ga0105242_10305530 3300009176 Bacteria 1453
112 Ga0105248_10109677 3300009177 Bacteria 3112
113 Ga0105237_10075114 3300009545 Bacteria 3371
114 Ga0105237_10137505 3300009545 Bacteria 2437
115 Ga0105237_10143238 3300009545 Bacteria 2385
116 Ga0105237_10189835 3300009545 Bacteria 2055
117 Ga0105237_10361692 3300009545 Unclassified 1455
118 Ga0105237_10962951 3300009545 Bacteria 860
119 Ga0105238_10002742 3300009551 Bacteria 17548
120 Ga0105238_10091411 3300009551 Bacteria 3031
121 Ga0105238_10128279 3300009551 Bacteria 2515
122 Ga0105238_10135212 3300009551 Bacteria 2443
123 Ga0105238_10215042 3300009551 Bacteria 1898
124 Ga0105238_10360961 3300009551 Bacteria 1442
125 Ga0105238_10585948 3300009551 Unclassified 1122
126 Ga0105249_10043940 3300009553 Bacteria 4063
127 Ga0105239_10001611 3300010375 Bacteria 29829
128 Ga0105239_10025214 3300010375 Bacteria 6548
129 Ga0105239_10114426 3300010375 Bacteria 2992
130 Ga0105239_10150550 3300010375 Bacteria 2597
131 Ga0105239_10160959 3300010375 Bacteria 2507
132 Ga0105239_10170530 3300010375 Bacteria 2433
133 Ga0105239_10210066 3300010375 Bacteria 2182
134 Ga0105239_10374816 3300010375 Bacteria 1609
135 Ga0105239_10470298 3300010375 Bacteria 1427
136 Ga0105239_11642408 3300010375 Unclassified 743
137 Ga0105246_10213851 3300011119 Bacteria 1506
138 Ga0157370_10068890 3300013104 Bacteria 3343
139 Ga0157370_10566042 3300013104 Bacteria 1041
140 Ga0157369_10084521 3300013105 Bacteria 3392
141 Ga0157369_10181893 3300013105 Bacteria 2212
142 Ga0157369_10285956 3300013105 Bacteria 1717
143 Ga0157369_10452432 3300013105 Bacteria 1330
144 Ga0157369_10750269 3300013105 Bacteria 1004
145 Ga0157374_10052435 3300013296 Bacteria 3799
146 Ga0157374_10120192 3300013296 Bacteria 2535
147 Ga0157374_10186346 3300013296 Bacteria 2029
148 Ga0157374_10304984 3300013296 Bacteria 1576
149 Ga0157378_10723646 3300013297 Unclassified 1016
150 Ga0163162_10031181 3300013306 Bacteria 5286
151 Ga0163162_10123433 3300013306 Bacteria 2695
152 Ga0157372_10013958 3300013307 Bacteria 8583
153 Ga0157375_10070239 3300013308 Bacteria 3511
154 Ga0157375_10905192 3300013308 Bacteria 1026
155 Ga0157375_11829174 3300013308 Bacteria 720
156 Ga0163163_10000180 3300014325 Bacteria 64938
157 Ga0163163_10065548 3300014325 Bacteria 3606
158 Ga0163163_10177792 3300014325 Bacteria 2175
159 Ga0163163_10496370 3300014325 Bacteria 1282
160 Ga0157379_10001410 3300014968 Bacteria 19707
161 Ga0157379_10009831 3300014968 Bacteria 8337
162 Ga0157376_10197266 3300014969 Bacteria 1850
163 Ga0157376_11123664 3300014969 Unclassified 812
164 Ga0182005_1035094 3300015265 Unclassified 1364
165 Ga0207427_105986 3300025231 Bacteria 1608
166 Ga0209233_1000013 3300025261 Bacteria 1013785
167 Ga0209233_1009800 3300025261 Bacteria 2900
168 Ga0209758_1000185 3300025297 Bacteria 139330
169 Ga0207680_10054215 3300025903 Bacteria 2411
170 Ga0207645_10150041 3300025907 Bacteria 1521
171 Ga0207643_10501187 3300025908 Bacteria 776
172 Ga0207705_10050742 3300025909 Bacteria 2987
173 Ga0207705_10130438 3300025909 Bacteria 1870
174 Ga0207705_10662985 3300025909 Bacteria 811
175 Ga0207654_10096724 3300025911 Bacteria 1811
176 Ga0207654_10875384 3300025911 Bacteria 651
177 Ga0207695_10000004 3300025913 Bacteria 1288665
178 Ga0207695_10013955 3300025913 Bacteria 9547
179 Ga0207695_10023779 3300025913 Bacteria 6915
180 Ga0207695_10045400 3300025913 Bacteria 4664
181 Ga0207695_10104132 3300025913 Bacteria 2828
182 Ga0207695_10350349 3300025913 Bacteria 1364
183 Ga0207695_10363472 3300025913 Bacteria 1334
184 Ga0207671_10056126 3300025914 Bacteria 2918
185 Ga0207671_10074401 3300025914 Bacteria 2539
186 Ga0207671_10157345 3300025914 Bacteria 1758
187 Ga0207671_10415899 3300025914 Bacteria 1070
188 Ga0207657_10053218 3300025919 Bacteria 3507
189 Ga0207657_10157376 3300025919 Bacteria 1847
190 Ga0207657_10254983 3300025919 Bacteria 1397
191 Ga0207649_10598976 3300025920 Unclassified 847
192 Ga0207652_10042508 3300025921 Bacteria 3868
193 Ga0207652_10365114 3300025921 Bacteria 1303
194 Ga0207694_10000010 3300025924 Bacteria 439722
195 Ga0207694_10107312 3300025924 Bacteria 2218
196 Ga0207694_10135674 3300025924 Bacteria 1976
197 Ga0207694_10204962 3300025924 Bacteria 1605
198 Ga0207694_10651820 3300025924 Unclassified 887
199 Ga0207687_10108830 3300025927 Bacteria 2052
200 Ga0207687_10306296 3300025927 Bacteria 1281
201 Ga0207664_10533142 3300025929 Bacteria 1053
202 Ga0207644_10378413 3300025931 Bacteria 1154
203 Ga0207690_10017918 3300025932 Bacteria 4334
204 Ga0207706_10032685 3300025933 Bacteria 4631
205 Ga0207686_10141664 3300025934 Bacteria 1663
206 Ga0207686_10221784 3300025934 Bacteria 1366
207 Ga0207686_10536565 3300025934 Unclassified 913
208 Ga0207709_10062262 3300025935 Bacteria 2335
209 Ga0207709_10893173 3300025935 Unclassified 722
210 Ga0207704_10264981 3300025938 Bacteria 1297
211 Ga0207704_10741508 3300025938 Bacteria 816
212 Ga0207711_10010005 3300025941 Bacteria 7882
213 Ga0207689_10179398 3300025942 Bacteria 1746
214 Ga0207661_10062678 3300025944 Bacteria 3009
215 Ga0207661_10159076 3300025944 Unclassified 1959
216 Ga0207679_10228533 3300025945 Bacteria 1569
217 Ga0207679_10280483 3300025945 Bacteria 1429
218 Ga0207667_10068493 3300025949 Bacteria 3696
219 Ga0207667_10158247 3300025949 Bacteria 2331
220 Ga0207667_10594713 3300025949 Bacteria 1116
221 Ga0207667_10728422 3300025949 Bacteria 992
222 Ga0207667_11594792 3300025949 Bacteria 621
223 Ga0207712_10022384 3300025961 Bacteria 4160
224 Ga0207658_10065273 3300025986 Bacteria 2733
225 Ga0207677_10040871 3300026023 Bacteria 3061
226 Ga0207677_10131620 3300026023 Bacteria 1900
227 Ga0207677_10309623 3300026023 Bacteria 1308
228 Ga0207677_10387737 3300026023 Bacteria 1181
229 Ga0207703_10022064 3300026035 Bacteria 4989
230 Ga0207639_11102853 3300026041 Bacteria 744
231 Ga0207678_10485735 3300026067 Bacteria 1076
232 Ga0207702_10049757 3300026078 Bacteria 3537
233 Ga0207702_10066919 3300026078 Bacteria 3082
234 Ga0207702_10283881 3300026078 Bacteria 1566
235 Ga0207641_10090323 3300026088 Bacteria 2678
236 Ga0207648_10028150 3300026089 Bacteria 4984
237 Ga0207648_10060362 3300026089 Bacteria 3307
238 Ga0207676_10116687 3300026095 Bacteria 2244
239 Ga0207676_10236696 3300026095 Bacteria 1635
240 Ga0207674_10190409 3300026116 Bacteria 2001
241 Ga0207674_10273889 3300026116 Bacteria 1635
242 Ga0207675_100254673 3300026118 Bacteria 1700
243 Ga0207683_10019804 3300026121 Bacteria 5748
244 Ga0207683_10034092 3300026121 Bacteria 4424
245 Ga0207683_10254360 3300026121 Bacteria 1603
246 Ga0207698_10001319 3300026142 Bacteria 14461
247 Ga0268266_10026985 3300028379 Bacteria 4886
248 Ga0268266_10084228 3300028379 Bacteria 2776
249 Ga0268266_10241072 3300028379 Bacteria 1669
250 Ga0268266_10248217 3300028379 Bacteria 1645
251 Ga0268265_10121189 3300028380 Bacteria 2155
252 Ga0268264_10048760 3300028381 Bacteria 3523
253 Ga0265318_10001386 3300028577 Bacteria 14393
254 Ga0265338_10074283 3300028800 Bacteria 2893
255 Ga0265332_10084403 3300031238 Bacteria 1346
256 Ga0265328_10113446 3300031239 Unclassified 1008
257 Ga0265325_10167736 3300031241 Bacteria 1029
258 Ga0265340_10169247 3300031247 Unclassified 990
259 Ga0265339_10029123 3300031249 Bacteria 3135
260 Ga0265339_10135792 3300031249 Bacteria 1255
261 Ga0265331_10015348 3300031250 Bacteria 4046
262 Ga0265331_10081878 3300031250 Bacteria 1498
263 Ga0265331_10136465 3300031250 Bacteria 1117
264 Ga0265316_10058768 3300031344 Bacteria 2993
265 Ga0307513_10328094 3300031456 Bacteria 1286
266 Ga0265313_10001671 3300031595 Bacteria 20524
267 Ga0265313_10006121 3300031595 Bacteria 8649
268 Ga0265313_10017093 3300031595 Bacteria 4138
269 Ga0265314_10009189 3300031711 Bacteria 8378
270 Ga0265314_10040387 3300031711 Bacteria 3349
271 Ga0265342_10061806 3300031712 Bacteria 2206
272 Ga0265342_10275178 3300031712 Bacteria 892
273 Ga0307516_10022688 3300031730 Bacteria 6443
274 Ga0307516_10028575 3300031730 Bacteria 5642
275 Ga0373955_0127799 3300035172 Bacteria 1482
276 Ga0373937_0259254 3300036401 Bacteria 1639
277 Ga0373937_1262923 3300036401 Unclassified 687
278 Ga0395900_0571440 3300037418 Bacteria 1073
279 Ga0395898_0810324 3300037466 Bacteria 876
280 Ga0395901_0061297 3300038443 Bacteria 3914
281 Ga0436365_0658231 3300039437 Bacteria 5287
282 Ga0451793_0098348 3300041452 Bacteria 718
283 Ga0451807_0801732 3300041486 Bacteria 872
284 Ga0466963_0442287 3300044694 Bacteria 917
285 Ga0495629_0292171 3300046459 Bacteria 1117
286 Ga0495628_0245333 3300046516 Bacteria 1339
287 Ga0495628_0355305 3300046516 Bacteria 1077
288 Ga0495652_0278124 3300046529 Bacteria 1227
289 Ga0495652_1089371 3300046529 Bacteria 519
290 Ga0495587_0519578 3300046536 Bacteria 658
291 Ga0495587_0754967 3300046536 Bacteria 532
292 Ga0495609_0013306 3300046538 Bacteria 3891
293 Ga0495621_0117140 3300046539 Unclassified 1027
294 Ga0495645_0271203 3300046543 Bacteria 1120
295 Ga0495645_0500869 3300046543 Bacteria 759
296 Ga0495622_0043617 3300046557 Bacteria 2085
297 Ga0495611_0062511 3300046648 Bacteria 1694
298 Ga0495604_0886410 3300047317 Bacteria 558
299 Ga0495680_0645429 3300047322 Bacteria 704
300 Ga0495675_0683084 3300047444 Bacteria 576
301 Ga0495602_0104715 3300048088 Bacteria 2314
302 Ga0496121_0005470 3300048924 Bacteria 16266
303 Ga0495682_0013575 3300049460 Bacteria 3098
304 Ga0501032_0046840 3300049569 Bacteria 2921
305 Ga0501033_0020180 3300049570 Bacteria 5038
306 Ga0501033_0040571 3300049570 Bacteria 3474
307 Ga0501033_0077146 3300049570 Bacteria 2445
308 Ga0501033_0137966 3300049570 Bacteria 1764
309 Ga0501033_0166833 3300049570 Bacteria 1583
310 Ga0501034_0013835 3300049571 Bacteria 8304
311 Ga0501034_0424112 3300049571 Bacteria 1251
312 Ga0501034_0575497 3300049571 Bacteria 1034
313 Ga0501034_0882969 3300049571 Bacteria 783
314 Ga0501036_0035638 3300049572 Bacteria 4209
315 Ga0501038_0176417 3300049574 Bacteria 1727
316 Ga0501039_0008443 3300049575 Bacteria 7849
317 Ga0501040_0198519 3300049576 Bacteria 1424
318 Ga0501042_0016564 3300049578 Bacteria 5063
319 Ga0501043_0090951 3300049579 Bacteria 2399
320 Ga0501043_0190049 3300049579 Bacteria 1597
321 Ga0501043_0402755 3300049579 Bacteria 1034
322 Ga0501046_0002745 3300049580 Bacteria 16391
323 Ga0501046_0209268 3300049580 Bacteria 1448
324 Ga0501047_0018323 3300049581 Bacteria 6710
325 Ga0501047_0022386 3300049581 Bacteria 6069
326 Ga0501047_0035533 3300049581 Bacteria 4815
327 Ga0501047_0039359 3300049581 Bacteria 4573
328 Ga0501047_0074973 3300049581 Bacteria 3256
329 Ga0501047_0191245 3300049581 Bacteria 1910
330 Ga0501047_0291881 3300049581 Bacteria 1474
331 Ga0501047_0391950 3300049581 Bacteria 1222
332 Ga0501047_0575422 3300049581 Bacteria 949
333 Ga0501047_1023179 3300049581 Unclassified 639
334 Ga0501048_0006399 3300049582 Bacteria 8954
335 Ga0501067_0001398 3300049583 Bacteria 13084
336 Ga0501069_0004517 3300049585 Bacteria 7187
337 Ga0501069_0091721 3300049585 Bacteria 1718
338 Ga0501070_0021985 3300049586 Bacteria 5344
339 Ga0501071_0105641 3300049587 Bacteria 2079
340 Ga0501073_0008596 3300049589 Bacteria 7567
341 Ga0501074_0005728 3300049590 Bacteria 8957
342 Ga0501075_0798681 3300049591 Bacteria 718
343 Ga0501079_0001532 3300049741 Bacteria 16351
344 Ga0501080_0071413 3300049742 Bacteria 3229
345 Ga0501080_0472678 3300049742 Bacteria 1122
346 Ga0501080_0562841 3300049742 Bacteria 1014
347 Ga0501083_0001878 3300049744 Bacteria 14435
348 Ga0501083_0425201 3300049744 Bacteria 864
349 Ga0501035_0073953 3300049822 Bacteria 3015
350 Ga0501035_0166473 3300049822 Bacteria 1906
351 Ga0501035_0181125 3300049822 Bacteria 1815
352 Ga0501035_0255336 3300049822 Bacteria 1487
353 Ga0501035_0454953 3300049822 Bacteria 1059
354 Ga0501035_0909493 3300049822 Bacteria 696
355 Ga0501044_0028158 3300049823 Bacteria 5931
356 Ga0501044_0037323 3300049823 Bacteria 5079
357 Ga0501044_0051471 3300049823 Bacteria 4246
358 Ga0501044_0081108 3300049823 Bacteria 3284
359 Ga0501044_0115617 3300049823 Bacteria 2688
360 Ga0501044_0146928 3300049823 Bacteria 2342
361 Ga0501044_0308479 3300049823 Bacteria 1510
362 Ga0501044_0311953 3300049823 Bacteria 1499
363 Ga0501044_0462219 3300049823 Bacteria 1174
364 Ga0501044_0616001 3300049823 Bacteria 977
365 Ga0501045_0146727 3300049824 Bacteria 1755
366 Ga0500643_000021 3300053087 Bacteria 284326
367 Ga0500646_0110079 3300053090 Bacteria 875
368 Ga0500595_007819 3300053119 Bacteria 4407
369 Ga0500595_009588 3300053119 Bacteria 3900
370 Ga0500655_001771 3300053133 Bacteria 4044
371 Ga0500559_0055310 3300053136 Bacteria 1760
372 Ga0500573_0000050 3300053140 Bacteria 95598
373 Ga0500645_037809 3300053730 Bacteria 1433
374 Ga0501084_0009784 3300054114 Bacteria 7926
375 Ga0501082_0019619 3300060353 Bacteria 5830
376 Ga0068856_100284600
377 JGI25165J46597_1000013
378 JGI25153J46596_10001994
379 rootH2_10064423
380 rootH2_10247014
381 rootH1_10249279
382 Ga0070658_10033338
383 Ga0070658_10375262
384 Ga0070676_10340057
385 Ga0070683_101007556
386 Ga0070690_100088516
387 Ga0068869_100542558
388 Ga0070666_10009611
389 Ga0070666_10053600
390 Ga0070680_100000724
391 Ga0070680_100035969
392 Ga0068868_100008738
393 Ga0068868_100129150
394 Ga0070660_100096142
395 Ga0070689_100796499
396 Ga0070691_10262652
397 Ga0070661_100149127
398 Ga0070661_100757950
399 Ga0070668_100916334
400 Ga0070671_100360125
401 Ga0070673_100010754
402 Ga0070673_100694796
403 Ga0070667_100015920
404 Ga0070714_100931626
405 Ga0070701_10337772
406 Ga0070663_100823860
407 Ga0070678_100013152
408 Ga0070678_100027041
409 Ga0070678_100661434
410 Ga0070678_100746616
411 Ga0070662_100018137
412 Ga0068867_100006544
413 Ga0068867_100018475
414 Ga0068867_100845000
415 Ga0070679_100272524
416 Ga0070679_100336435
417 Ga0070684_100053368
418 Ga0070684_100092677
419 Ga0068853_101227931
420 Ga0070686_100268313
421 Ga0070665_100031769
422 Ga0070665_100035906
423 Ga0070665_100134373
424 Ga0070665_100173019
425 Ga0070665_100289137
426 Ga0070665_100354169
427 Ga0070665_100418046
428 Ga0070665_100546889
429 Ga0070665_101223240
430 Ga0068855_100000034
431 Ga0068855_100025284
432 Ga0070664_100393317
433 Ga0068856_100069177
434 Ga0068856_100230418
435 Ga0068856_100338953
436 Ga0070702_100704757
437 Ga0068852_100030426
438 Ga0068852_100690157
439 Ga0068864_100252531
440 Ga0068864_100339642
441 Ga0068866_10033699
442 Ga0068861_101090544
443 Ga0068863_100050698
444 Ga0068858_100158798
445 Ga0068860_100630727
446 Ga0097621_100011703
447 Ga0097621_100073001
448 Ga0097621_100089601
449 Ga0097621_100225338
450 Ga0097621_100239214
451 Ga0097621_100275507
452 Ga0097621_101169854
453 Ga0068871_100023537
454 Ga0068871_100025844
455 Ga0068871_100066263
456 Ga0068871_100120697
457 Ga0068871_100172552
458 Ga0068871_100809961
459 Ga0068871_100908873
460 Ga0068865_100015024
461 Ga0068865_100050071
462 Ga0105240_10000382
463 Ga0105240_10012354
464 Ga0105240_10050735
465 Ga0105240_10153799
466 Ga0105240_10198681
467 Ga0105240_10282191
468 Ga0105240_10467201
469 Ga0105240_10517736
470 Ga0105240_10913977
471 Ga0105240_11213097
472 Ga0105245_10050583
473 Ga0105245_10166527
474 Ga0105245_11187629
475 Ga0105247_10992741
476 Ga0105243_10004010
477 Ga0105243_10704100
478 Ga0105241_10047182
479 Ga0105241_10080582
480 Ga0105241_10103074
481 Ga0105241_10212996
482 Ga0105241_10857994
483 Ga0105241_10966624
484 Ga0105242_10012514
485 Ga0105242_10127343
486 Ga0105242_10305530
487 Ga0105248_10109677
488 Ga0105237_10075114
489 Ga0105237_10137505
490 Ga0105237_10143238
491 Ga0105237_10189835
492 Ga0105237_10361692
493 Ga0105237_10962951
494 Ga0105238_10002742
495 Ga0105238_10091411
496 Ga0105238_10128279
497 Ga0105238_10135212
498 Ga0105238_10215042
499 Ga0105238_10360961
500 Ga0105238_10585948
501 Ga0105249_10043940
502 Ga0105239_10001611
503 Ga0105239_10025214
504 Ga0105239_10114426
505 Ga0105239_10150550
506 Ga0105239_10160959
507 Ga0105239_10170530
508 Ga0105239_10210066
509 Ga0105239_10374816
510 Ga0105239_10470298
511 Ga0105239_11642408
512 Ga0105246_10213851
513 Ga0157370_10068890
514 Ga0157370_10566042
515 Ga0157369_10084521
516 Ga0157369_10181893
517 Ga0157369_10285956
518 Ga0157369_10452432
519 Ga0157369_10750269
520 Ga0157374_10052435
521 Ga0157374_10120192
522 Ga0157374_10186346
523 Ga0157374_10304984
524 Ga0157378_10723646
525 Ga0163162_10031181
526 Ga0163162_10123433
527 Ga0157372_10013958
528 Ga0157375_10070239
529 Ga0157375_10905192
530 Ga0157375_11829174
531 Ga0163163_10000180
532 Ga0163163_10065548
533 Ga0163163_10177792
534 Ga0163163_10496370
535 Ga0157379_10001410
536 Ga0157379_10009831
537 Ga0157376_10197266
538 Ga0157376_11123664
539 Ga0182005_1035094
540 Ga0207427_105986
541 Ga0209233_1000013
542 Ga0209233_1009800
543 Ga0209758_1000185
544 Ga0207680_10054215
545 Ga0207645_10150041
546 Ga0207643_10501187
547 Ga0207705_10050742
548 Ga0207705_10130438
549 Ga0207705_10662985
550 Ga0207654_10096724
551 Ga0207654_10875384
552 Ga0207695_10000004
553 Ga0207695_10013955
554 Ga0207695_10023779
555 Ga0207695_10045400
556 Ga0207695_10104132
557 Ga0207695_10350349
558 Ga0207695_10363472
559 Ga0207671_10056126
560 Ga0207671_10074401
561 Ga0207671_10157345
562 Ga0207671_10415899
563 Ga0207657_10053218
564 Ga0207657_10157376
565 Ga0207657_10254983
566 Ga0207649_10598976
567 Ga0207652_10042508
568 Ga0207652_10365114
569 Ga0207694_10000010
570 Ga0207694_10107312
571 Ga0207694_10135674
572 Ga0207694_10204962
573 Ga0207694_10651820
574 Ga0207687_10108830
575 Ga0207687_10306296
576 Ga0207664_10533142
577 Ga0207644_10378413
578 Ga0207690_10017918
579 Ga0207706_10032685
580 Ga0207686_10141664
581 Ga0207686_10221784
582 Ga0207686_10536565
583 Ga0207709_10062262
584 Ga0207709_10893173
585 Ga0207704_10264981
586 Ga0207704_10741508
587 Ga0207711_10010005
588 Ga0207689_10179398
589 Ga0207661_10062678
590 Ga0207661_10159076
591 Ga0207679_10228533
592 Ga0207679_10280483
593 Ga0207667_10068493
594 Ga0207667_10158247
595 Ga0207667_10594713
596 Ga0207667_10728422
597 Ga0207667_11594792
598 Ga0207712_10022384
599 Ga0207658_10065273
600 Ga0207677_10040871
601 Ga0207677_10131620
602 Ga0207677_10309623
603 Ga0207677_10387737
604 Ga0207703_10022064
605 Ga0207639_11102853
606 Ga0207678_10485735
607 Ga0207702_10049757
608 Ga0207702_10066919
609 Ga0207702_10283881
610 Ga0207641_10090323
611 Ga0207648_10028150
612 Ga0207648_10060362
613 Ga0207676_10116687
614 Ga0207676_10236696
615 Ga0207674_10190409
616 Ga0207674_10273889
617 Ga0207675_100254673
618 Ga0207683_10019804
619 Ga0207683_10034092
620 Ga0207683_10254360
621 Ga0207698_10001319
622 Ga0268266_10026985
623 Ga0268266_10084228
624 Ga0268266_10241072
625 Ga0268266_10248217
626 Ga0268265_10121189
627 Ga0268264_10048760
628 Ga0265318_10001386
629 Ga0265338_10074283
630 Ga0265332_10084403
631 Ga0265328_10113446
632 Ga0265325_10167736
633 Ga0265340_10169247
634 Ga0265339_10029123
635 Ga0265339_10135792
636 Ga0265331_10015348
637 Ga0265331_10081878
638 Ga0265331_10136465
639 Ga0265316_10058768
640 Ga0307513_10328094
641 Ga0265313_10001671
642 Ga0265313_10006121
643 Ga0265313_10017093
644 Ga0265314_10009189
645 Ga0265314_10040387
646 Ga0265342_10061806
647 Ga0265342_10275178
648 Ga0307516_10022688
649 Ga0307516_10028575
650 Ga0373955_0127799
651 Ga0373937_0259254
652 Ga0373937_1262923
653 Ga0395900_0571440
654 Ga0395898_0810324
655 Ga0395901_0061297
656 Ga0436365_0658231
657 Ga0451793_0098348
658 Ga0451807_0801732
659 Ga0466963_0442287
660 Ga0495629_0292171
661 Ga0495628_0245333
662 Ga0495628_0355305
663 Ga0495652_0278124
664 Ga0495652_1089371
665 Ga0495587_0519578
666 Ga0495587_0754967
667 Ga0495609_0013306
668 Ga0495621_0117140
669 Ga0495645_0271203
670 Ga0495645_0500869
671 Ga0495622_0043617
672 Ga0495611_0062511
673 Ga0495604_0886410
674 Ga0495680_0645429
675 Ga0495675_0683084
676 Ga0495602_0104715
677 Ga0496121_0005470
678 Ga0495682_0013575
679 Ga0501032_0046840
680 Ga0501033_0020180
681 Ga0501033_0040571
682 Ga0501033_0077146
683 Ga0501033_0137966
684 Ga0501033_0166833
685 Ga0501034_0013835
686 Ga0501034_0424112
687 Ga0501034_0575497
688 Ga0501034_0882969
689 Ga0501036_0035638
690 Ga0501038_0176417
691 Ga0501039_0008443
692 Ga0501040_0198519
693 Ga0501042_0016564
694 Ga0501043_0090951
695 Ga0501043_0190049
696 Ga0501043_0402755
697 Ga0501046_0002745
698 Ga0501046_0209268
699 Ga0501047_0018323
700 Ga0501047_0022386
701 Ga0501047_0035533
702 Ga0501047_0039359
703 Ga0501047_0074973
704 Ga0501047_0191245
705 Ga0501047_0291881
706 Ga0501047_0391950
707 Ga0501047_0575422
708 Ga0501047_1023179
709 Ga0501048_0006399
710 Ga0501067_0001398
711 Ga0501069_0004517
712 Ga0501069_0091721
713 Ga0501070_0021985
714 Ga0501071_0105641
715 Ga0501073_0008596
716 Ga0501074_0005728
717 Ga0501075_0798681
718 Ga0501079_0001532
719 Ga0501080_0071413
720 Ga0501080_0472678
721 Ga0501080_0562841
722 Ga0501083_0001878
723 Ga0501083_0425201
724 Ga0501035_0073953
725 Ga0501035_0166473
726 Ga0501035_0181125
727 Ga0501035_0255336
728 Ga0501035_0454953
729 Ga0501035_0909493
730 Ga0501044_0028158
731 Ga0501044_0037323
732 Ga0501044_0051471
733 Ga0501044_0081108
734 Ga0501044_0115617
735 Ga0501044_0146928
736 Ga0501044_0308479
737 Ga0501044_0311953
738 Ga0501044_0462219
739 Ga0501044_0616001
740 Ga0501045_0146727
741 Ga0500643_000021
742 Ga0500646_0110079
743 Ga0500595_007819
744 Ga0500595_009588
745 Ga0500655_001771
746 Ga0500559_0055310
747 Ga0500573_0000050
748 Ga0500645_037809
749 Ga0501084_0009784
750 Ga0501082_0019619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02834

LigT_PEase

LigT like Phosphoesterase

7

85

0.95

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

10

169

0.87

PF02834

LigT_PEase

LigT like Phosphoesterase

90

175

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8848 1 175
4qak-assembly2.cif.gz_B crystal structure of phosphoesterase 0.8638 2 175
5ldi-assembly4.cif.gz_D crystal structure of e.coli ligt in apo form 0.8571 2 175
5ldj-assembly3.cif.gz_C crystal structure of e.coli ligt complexed with phosphate 0.8559 2 175
5ldo-assembly4.cif.gz_D crystal structure of e.coli ligt complexed with 3'-amp 0.8534 2 175
ID Description Score Start End Superfamily
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.9029 1 173 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.898 1 173 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.877 2 175 3.90.1140.10
5ldmB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8579 2 176 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8413 2 175 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A846N5J7-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9932 1 175 GO:0004113
GO:0008664
GO:0016874
AF-A0A554U8R5-F1-model_v4 deleted 0.9847 1 176
AF-A0A7Y8MAQ9-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9845 2 175 GO:0004113
GO:0008664
AF-A0A2P2EEI1-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9838 1 176 GO:0004113
GO:0008664
AF-A0A7V8DB11-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9826 2 176 GO:0004113
GO:0008664
GO:0016874

Map