F426901

General Info

Members Datasets Scaffolds Average Seq Length
374 241 748 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221711|2644610033
Length 264
Sequence VKNPAQASACVRCAHASGLPASRLTTLVLRDGTTDGAKAMRLLLTSGGVTNSSIRDALVDLLGKPIADSSALCIPTAQYGHPHVGPGVKAWQFISGNSQNPMVDLGWKSVGVLELTALPSIGEERWVPLVRETDVLLVAGGDVLYLCYWMRESGLADLLPSLTETVWVGLSAGSMVMTPEVGEDFIQWRPPTGDDRTLGIVDFSICPHLAPDGMPGNSMAEAEQWVAGISHPAYAMDDQTAIKVADGTVEVVTEGNWKHFPRDR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2643221711 Terrabacter sp. Root85 Isolate Unclassified
223 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
224 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
225 2643221561 Nocardioides sp. Root151 Isolate Unclassified
226 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
227 2643221696 Nocardioides sp. Root140 Isolate Unclassified
228 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
229 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
230 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
231 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
232 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
233 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
234 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
235 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
236 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
237 2857472729 Cohnella sp. R-74144 Isolate Unclassified
238 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
239 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
240 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
241 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0.53
Isolates 5.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 16.31
Rhizosphere 77.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10061854 3300001989 Bacteria 1182
2 JGI24737J22298_10035094 3300001990 Bacteria 1553
3 JGI24743J22301_10002651 3300001991 Bacteria 2735
4 JGI24738J21930_10001627 3300002075 Bacteria 6179
5 JGI24744J21845_10022433 3300002077 Bacteria 1240
6 JGI25406J46586_10058304 3300003203 Bacteria 1259
7 Ga0006562J51391_1058481 3300003578 Bacteria 11540
8 Ga0070658_10011665 3300005327 Bacteria 7047
9 Ga0070658_10039663 3300005327 Bacteria 3799
10 Ga0070683_100051839 3300005329 Bacteria 3800
11 Ga0070683_100325833 3300005329 Bacteria 1462
12 Ga0070683_100342260 3300005329 Bacteria 1424
13 Ga0068869_100044142 3300005334 Bacteria 3205
14 Ga0068869_100303945 3300005334 Bacteria 1289
15 Ga0070682_100005255 3300005337 Bacteria 7202
16 Ga0070682_100051946 3300005337 Bacteria 2563
17 Ga0068868_100049860 3300005338 Bacteria 3286
18 Ga0070660_100057709 3300005339 Bacteria 3008
19 Ga0070660_100061609 3300005339 Bacteria 2913
20 Ga0070691_10011693 3300005341 Bacteria 4014
21 Ga0070687_100401610 3300005343 Bacteria 899
22 Ga0070661_100063788 3300005344 Bacteria 2706
23 Ga0070692_10028498 3300005345 Bacteria 2775
24 Ga0070675_100127593 3300005354 Bacteria 2165
25 Ga0070671_100370563 3300005355 Bacteria 1223
26 Ga0070674_100183881 3300005356 Bacteria 1603
27 Ga0070673_100065218 3300005364 Bacteria 2904
28 Ga0070688_100302326 3300005365 Bacteria 1157
29 Ga0070659_100128416 3300005366 Bacteria 2057
30 Ga0070709_10383926 3300005434 Bacteria 1045
31 Ga0070714_100009557 3300005435 Bacteria 7631
32 Ga0070714_100163969 3300005435 Bacteria 2013
33 Ga0070713_100002272 3300005436 Bacteria 12484
34 Ga0070713_100086303 3300005436 Bacteria 2691
35 Ga0070663_100017093 3300005455 Bacteria 4726
36 Ga0070678_100084355 3300005456 Bacteria 2418
37 Ga0070678_100103349 3300005456 Bacteria 2213
38 Ga0070662_100024875 3300005457 Bacteria 4130
39 Ga0070681_10077572 3300005458 Bacteria 3280
40 Ga0070681_10356485 3300005458 Bacteria 1373
41 Ga0068867_100360450 3300005459 Bacteria 1216
42 Ga0070698_100073104 3300005471 Bacteria 3436
43 Ga0070699_100017422 3300005518 Bacteria 6166
44 Ga0070679_100084052 3300005530 Bacteria 3171
45 Ga0070684_100001597 3300005535 Bacteria 16367
46 Ga0070684_100045419 3300005535 Bacteria 3804
47 Ga0070684_100112827 3300005535 Bacteria 2439
48 Ga0070684_100148115 3300005535 Bacteria 2125
49 Ga0068853_100178015 3300005539 Bacteria 1928
50 Ga0070672_100027448 3300005543 Bacteria 4246
51 Ga0070686_100032144 3300005544 Bacteria 3215
52 Ga0070686_100370975 3300005544 Bacteria 1081
53 Ga0070686_100663852 3300005544 Bacteria 828
54 Ga0070695_100000042 3300005545 Bacteria 48840
55 Ga0070693_100028296 3300005547 Bacteria 3046
56 Ga0070704_100519848 3300005549 Bacteria 1036
57 Ga0068855_100481006 3300005563 Bacteria 1352
58 Ga0070664_100307542 3300005564 Bacteria 1434
59 Ga0070664_100632364 3300005564 Bacteria 994
60 Ga0068857_100066437 3300005577 Bacteria 3209
61 Ga0068854_100004694 3300005578 Bacteria 8611
62 Ga0068856_100033840 3300005614 Bacteria 5004
63 Ga0068856_100216655 3300005614 Bacteria 1930
64 Ga0068856_100269622 3300005614 Bacteria 1718
65 Ga0070702_100400228 3300005615 Bacteria 982
66 Ga0068852_100030546 3300005616 Bacteria 4437
67 Ga0068861_100232367 3300005719 Bacteria 1565
68 Ga0068851_10025206 3300005834 Bacteria 2916
69 Ga0068858_100022557 3300005842 Bacteria 5874
70 Ga0068862_100956733 3300005844 Bacteria 845
71 Ga0081455_10044420 3300005937 Bacteria 3876
72 Ga0081540_1006883 3300005983 Bacteria 8203
73 Ga0081539_10003101 3300005985 Bacteria 21322
74 Ga0075365_10093882 3300006038 Bacteria 2047
75 Ga0075365_10099640 3300006038 Bacteria 1988
76 Ga0075368_10049165 3300006042 Bacteria 1672
77 Ga0075367_10097622 3300006178 Bacteria 1793
78 Ga0097621_100218723 3300006237 Bacteria 1659
79 Ga0068871_100410165 3300006358 Bacteria 1208
80 Ga0075428_100096615 3300006844 Bacteria 3220
81 Ga0075428_100752462 3300006844 Bacteria 1037
82 Ga0068865_100076808 3300006881 Bacteria 2385
83 Ga0105245_10003807 3300009098 Bacteria 13416
84 Ga0105245_10004213 3300009098 Bacteria 12769
85 Ga0105245_10375154 3300009098 Bacteria 1415
86 Ga0114129_10152224 3300009147 Bacteria 3165
87 Ga0105243_10051813 3300009148 Bacteria 3248
88 Ga0105243_10059377 3300009148 Bacteria 3052
89 Ga0105243_10607063 3300009148 Bacteria 1054
90 Ga0105242_10039245 3300009176 Bacteria 3809
91 Ga0105242_10093989 3300009176 Bacteria 2528
92 Ga0105248_10024103 3300009177 Bacteria 6763
93 Ga0105237_10062149 3300009545 Bacteria 3734
94 Ga0105238_10289103 3300009551 Bacteria 1621
95 Ga0105249_10048833 3300009553 Bacteria 3858
96 Ga0105239_10006352 3300010375 Bacteria 13732
97 Ga0105239_10168069 3300010375 Bacteria 2452
98 Ga0105246_10010231 3300011119 Bacteria 5793
99 Ga0105246_10371893 3300011119 Bacteria 1178
100 Ga0157371_10054079 3300013102 Bacteria 2852
101 Ga0157371_10109680 3300013102 Bacteria 1959
102 Ga0157370_10518244 3300013104 Bacteria 1094
103 Ga0157369_10378884 3300013105 Bacteria 1468
104 Ga0157369_10716059 3300013105 Bacteria 1030
105 Ga0157369_10734387 3300013105 Bacteria 1016
106 Ga0163162_10046842 3300013306 Bacteria 4334
107 Ga0163162_10054395 3300013306 Bacteria 4026
108 Ga0163162_10549958 3300013306 Bacteria 1283
109 Ga0157372_10030297 3300013307 Bacteria 5919
110 Ga0157372_10057307 3300013307 Bacteria 4355
111 Ga0157372_10067971 3300013307 Bacteria 4006
112 Ga0157372_10156572 3300013307 Bacteria 2632
113 Ga0157372_10190061 3300013307 Bacteria 2378
114 Ga0157372_10383591 3300013307 Bacteria 1637
115 Ga0157372_11403164 3300013307 Bacteria 805
116 Ga0157375_10015612 3300013308 Bacteria 6803
117 Ga0157375_10115664 3300013308 Bacteria 2785
118 Ga0157375_10122160 3300013308 Bacteria 2715
119 Ga0163163_10027995 3300014325 Bacteria 5407
120 Ga0157380_10041470 3300014326 Bacteria 3592
121 Ga0157377_10027463 3300014745 Bacteria 3056
122 Ga0157377_10048927 3300014745 Bacteria 2374
123 Ga0157377_10433123 3300014745 Bacteria 904
124 Ga0157379_10067075 3300014968 Bacteria 3208
125 Ga0163161_10161079 3300017792 Bacteria 1711
126 Ga0163161_10207741 3300017792 Bacteria 1511
127 Ga0206353_11969101 3300020082 Bacteria 1923
128 Ga0207697_10048294 3300025315 Bacteria 1755
129 Ga0207656_10057459 3300025321 Bacteria 1697
130 Ga0207688_10016091 3300025901 Bacteria 4055
131 Ga0207688_10036423 3300025901 Bacteria 2726
132 Ga0207643_10152277 3300025908 Bacteria 1387
133 Ga0207705_10144370 3300025909 Bacteria 1779
134 Ga0207705_10479693 3300025909 Bacteria 965
135 Ga0207695_10141340 3300025913 Bacteria 2355
136 Ga0207662_10200102 3300025918 Bacteria 1293
137 Ga0207657_10001130 3300025919 Bacteria 28334
138 Ga0207657_10068406 3300025919 Bacteria 3017
139 Ga0207649_10215631 3300025920 Bacteria 1364
140 Ga0207652_10123024 3300025921 Bacteria 2309
141 Ga0207681_10159691 3300025923 Bacteria 1698
142 Ga0207694_10140120 3300025924 Bacteria 1944
143 Ga0207659_10200828 3300025926 Bacteria 1592
144 Ga0207687_10061145 3300025927 Bacteria 2659
145 Ga0207687_10136244 3300025927 Bacteria 1857
146 Ga0207687_10360351 3300025927 Bacteria 1187
147 Ga0207687_10509084 3300025927 Bacteria 1006
148 Ga0207700_10008183 3300025928 Bacteria 6460
149 Ga0207664_10001810 3300025929 Bacteria 14089
150 Ga0207644_10296992 3300025931 Bacteria 1301
151 Ga0207690_10089151 3300025932 Bacteria 2174
152 Ga0207706_10079966 3300025933 Bacteria 2874
153 Ga0207709_10056277 3300025935 Bacteria 2434
154 Ga0207709_10158629 3300025935 Bacteria 1575
155 Ga0207704_10179785 3300025938 Bacteria 1527
156 Ga0207711_10019741 3300025941 Bacteria 5614
157 Ga0207689_10035816 3300025942 Bacteria 4121
158 Ga0207689_10342933 3300025942 Bacteria 1241
159 Ga0207661_10006432 3300025944 Bacteria 8307
160 Ga0207661_10083804 3300025944 Bacteria 2639
161 Ga0207661_10143433 3300025944 Bacteria 2057
162 Ga0207679_10155124 3300025945 Bacteria 1869
163 Ga0207667_10388034 3300025949 Bacteria 1422
164 Ga0207667_10472906 3300025949 Bacteria 1273
165 Ga0207651_10179190 3300025960 Bacteria 1679
166 Ga0207651_10461884 3300025960 Bacteria 1091
167 Ga0207712_10194299 3300025961 Bacteria 1604
168 Ga0207668_10482290 3300025972 Bacteria 1064
169 Ga0207640_10483773 3300025981 Bacteria 1027
170 Ga0207640_10619774 3300025981 Bacteria 918
171 Ga0207677_10227949 3300026023 Bacteria 1499
172 Ga0207677_10425377 3300026023 Bacteria 1132
173 Ga0207703_10039545 3300026035 Bacteria 3769
174 Ga0207703_11240995 3300026035 Bacteria 717
175 Ga0207639_10197999 3300026041 Bacteria 1721
176 Ga0207678_10057547 3300026067 Bacteria 3345
177 Ga0207702_10163885 3300026078 Bacteria 2032
178 Ga0207702_10184808 3300026078 Bacteria 1922
179 Ga0207702_10279451 3300026078 Bacteria 1578
180 Ga0207648_10162906 3300026089 Bacteria 1970
181 Ga0207674_10068495 3300026116 Bacteria 3571
182 Ga0207675_100112857 3300026118 Bacteria 2566
183 Ga0207675_100194508 3300026118 Bacteria 1946
184 Ga0207683_10128303 3300026121 Bacteria 2280
185 Ga0207683_10376381 3300026121 Bacteria 1305
186 Ga0207683_10656259 3300026121 Bacteria 972
187 Ga0207698_10030211 3300026142 Bacteria 3893
188 Ga0207698_10459917 3300026142 Bacteria 1230
189 Ga0268266_10066312 3300028379 Bacteria 3122
190 Ga0307513_10171823 3300031456 Bacteria 2044
191 Ga0307408_100333108 3300031548 Bacteria 1282
192 Ga0307409_100098413 3300031995 Bacteria 2419
193 Ga0307409_100833081 3300031995 Bacteria 932
194 Ga0307416_100657968 3300032002 Bacteria 1133
195 Ga0307415_100035917 3300032126 Bacteria 3241
196 Ga0373937_0404803 3300036401 Bacteria 1295
197 Ga0373937_0406348 3300036401 Bacteria 1292
198 Ga0395899_0096386 3300037312 Bacteria 2139
199 Ga0395899_0102366 3300037312 Bacteria 2067
200 Ga0395900_0103449 3300037418 Bacteria 2925
201 Ga0395898_0089657 3300037466 Bacteria 2959
202 Ga0395905_0037873 3300037471 Bacteria 4526
203 Ga0395905_0258082 3300037471 Bacteria 1627
204 Ga0436361_0694755 3300039447 Bacteria 2073
205 Ga0451798_0349447 3300041458 Bacteria 975
206 Ga0451802_2148868 3300041460 Bacteria 759
207 Ga0451843_1446967 3300041509 Bacteria 965
208 Ga0466965_0040433 3300044683 Bacteria 2295
209 Ga0466965_0252637 3300044683 Bacteria 946
210 Ga0466961_0360324 3300044693 Bacteria 885
211 Ga0466963_0003960 3300044694 Bacteria 8568
212 Ga0466963_0482886 3300044694 Bacteria 875
213 Ga0466964_0031573 3300044706 Bacteria 2101
214 Ga0466971_0289156 3300044719 Bacteria 785
215 Ga0466957_0004163 3300044842 Bacteria 8012
216 Ga0466957_0281390 3300044842 Bacteria 1113
217 Ga0451576_0116557 3300045051 Bacteria 2781
218 Ga0466958_0010694 3300045836 Bacteria 5147
219 Ga0466967_0006133 3300045976 Bacteria 8460
220 Ga0466967_0040984 3300045976 Bacteria 3989
221 Ga0466967_0086254 3300045976 Bacteria 2844
222 Ga0466967_0173273 3300045976 Bacteria 2031
223 Ga0466967_0296543 3300045976 Bacteria 1554
224 Ga0495592_0037750 3300046454 Bacteria 3636
225 Ga0495651_0401025 3300046462 Bacteria 895
226 Ga0495653_0097186 3300046463 Bacteria 2140
227 Ga0495664_0036608 3300046477 Bacteria 2893
228 Ga0495628_0300480 3300046516 Bacteria 1188
229 Ga0495652_0015990 3300046529 Bacteria 6713
230 Ga0495652_0112086 3300046529 Bacteria 2192
231 Ga0495640_0134431 3300046533 Bacteria 1598
232 Ga0495645_0030650 3300046543 Bacteria 3918
233 Ga0495645_0149412 3300046543 Bacteria 1624
234 Ga0495667_0137898 3300046559 Bacteria 1572
235 Ga0495646_0003250 3300046680 Bacteria 10104
236 Ga0495658_0266424 3300046683 Bacteria 1079
237 Ga0495604_0417463 3300047317 Bacteria 881
238 Ga0495674_0002808 3300047319 Bacteria 16921
239 Ga0495676_0192467 3300047321 Bacteria 1422
240 Ga0495675_0242378 3300047444 Bacteria 1085
241 Ga0495684_0502076 3300047471 Bacteria 834
242 Ga0496100_0309707 3300048903 Bacteria 1184
243 Ga0496100_0380499 3300048903 Bacteria 1072
244 Ga0496100_0639712 3300048903 Bacteria 828
245 Ga0496101_0023484 3300048904 Bacteria 4261
246 Ga0496101_0104198 3300048904 Bacteria 2127
247 Ga0496101_0309427 3300048904 Bacteria 1238
248 Ga0496101_0341767 3300048904 Bacteria 1176
249 Ga0496101_0625027 3300048904 Bacteria 851
250 Ga0496102_0003535 3300048905 Bacteria 13243
251 Ga0496102_0046667 3300048905 Bacteria 3935
252 Ga0496102_0053617 3300048905 Bacteria 3675
253 Ga0496102_0077250 3300048905 Bacteria 3064
254 Ga0496102_0295729 3300048905 Bacteria 1526
255 Ga0496103_0029177 3300048906 Bacteria 3352
256 Ga0496103_0082521 3300048906 Bacteria 2023
257 Ga0496103_0498461 3300048906 Bacteria 779
258 Ga0496104_0024592 3300048907 Bacteria 5541
259 Ga0496104_0065374 3300048907 Bacteria 3451
260 Ga0496104_0183109 3300048907 Bacteria 2005
261 Ga0496104_0218233 3300048907 Bacteria 1819
262 Ga0496105_0024605 3300048908 Bacteria 4893
263 Ga0496105_0037581 3300048908 Bacteria 3987
264 Ga0496105_0106351 3300048908 Bacteria 2316
265 Ga0496105_0354666 3300048908 Bacteria 1171
266 Ga0496107_0016018 3300048910 Bacteria 5260
267 Ga0496107_0195422 3300048910 Bacteria 1503
268 Ga0496107_0745136 3300048910 Bacteria 719
269 Ga0496108_0004798 3300048911 Bacteria 10906
270 Ga0496108_0010941 3300048911 Bacteria 7368
271 Ga0496108_0247587 3300048911 Bacteria 1550
272 Ga0496108_0331936 3300048911 Bacteria 1326
273 Ga0496108_0339350 3300048911 Bacteria 1311
274 Ga0496109_0012452 3300048912 Bacteria 7344
275 Ga0496109_0014606 3300048912 Bacteria 6831
276 Ga0496109_0026153 3300048912 Bacteria 5203
277 Ga0496109_0278927 3300048912 Bacteria 1575
278 Ga0496109_0316848 3300048912 Bacteria 1472
279 Ga0496109_0463807 3300048912 Bacteria 1196
280 Ga0496110_0012787 3300048913 Bacteria 6914
281 Ga0496110_0071040 3300048913 Bacteria 3085
282 Ga0496110_0356385 3300048913 Bacteria 1333
283 Ga0496110_0490938 3300048913 Bacteria 1118
284 Ga0496111_0034624 3300048914 Bacteria 3606
285 Ga0496111_0072013 3300048914 Bacteria 2515
286 Ga0496111_0115266 3300048914 Bacteria 1981
287 Ga0496112_0381470 3300048915 Bacteria 1350
288 Ga0496113_0129311 3300048916 Bacteria 1980
289 Ga0496113_0165444 3300048916 Bacteria 1750
290 Ga0496114_0010442 3300048917 Bacteria 7388
291 Ga0496114_0061998 3300048917 Bacteria 3129
292 Ga0496114_0071816 3300048917 Bacteria 2909
293 Ga0496114_0189529 3300048917 Bacteria 1799
294 Ga0496114_0238231 3300048917 Bacteria 1599
295 Ga0496114_0326450 3300048917 Bacteria 1356
296 Ga0496114_0341892 3300048917 Bacteria 1323
297 Ga0496114_0727172 3300048917 Bacteria 869
298 Ga0496115_0006024 3300048918 Bacteria 8855
299 Ga0496115_0090336 3300048918 Bacteria 2502
300 Ga0496115_0114523 3300048918 Bacteria 2216
301 Ga0496126_0546012 3300048929 Bacteria 920
302 Ga0501032_0318817 3300049569 Bacteria 1003
303 Ga0501033_0090222 3300049570 Bacteria 2242
304 Ga0501034_0031684 3300049571 Bacteria 5370
305 Ga0501034_0047097 3300049571 Bacteria 4355
306 Ga0501036_0039899 3300049572 Bacteria 3971
307 Ga0501037_0052350 3300049573 Bacteria 2986
308 Ga0501038_0241329 3300049574 Bacteria 1434
309 Ga0501039_0011885 3300049575 Bacteria 6634
310 Ga0501039_0379437 3300049575 Bacteria 1110
311 Ga0501040_0006262 3300049576 Bacteria 7724
312 Ga0501040_0116820 3300049576 Bacteria 1869
313 Ga0501042_0229988 3300049578 Bacteria 1337
314 Ga0501043_0016817 3300049579 Bacteria 5733
315 Ga0501046_0022659 3300049580 Bacteria 5174
316 Ga0501047_0489709 3300049581 Bacteria 1057
317 Ga0501048_0036431 3300049582 Bacteria 3536
318 Ga0501067_0046155 3300049583 Bacteria 2418
319 Ga0501067_0177368 3300049583 Bacteria 1187
320 Ga0501068_0024217 3300049584 Bacteria 3563
321 Ga0501069_0023590 3300049585 Bacteria 3355
322 Ga0501069_0057380 3300049585 Bacteria 2170
323 Ga0501069_0120138 3300049585 Bacteria 1500
324 Ga0501070_0008267 3300049586 Bacteria 8799
325 Ga0501070_0096531 3300049586 Bacteria 2445
326 Ga0501071_0046427 3300049587 Bacteria 3119
327 Ga0501072_0014664 3300049588 Bacteria 6008
328 Ga0501072_0214216 3300049588 Bacteria 1535
329 Ga0501073_0085629 3300049589 Bacteria 2192
330 Ga0501073_0350649 3300049589 Bacteria 1019
331 Ga0501074_0268562 3300049590 Bacteria 1212
332 Ga0501075_0051277 3300049591 Bacteria 3102
333 Ga0501075_0629638 3300049591 Bacteria 818
334 Ga0501076_0016761 3300049592 Bacteria 5559
335 Ga0501077_0010144 3300049593 Bacteria 5866
336 Ga0501079_0060538 3300049741 Bacteria 2920
337 Ga0501079_0101973 3300049741 Bacteria 2226
338 Ga0501080_0033995 3300049742 Bacteria 4760
339 Ga0501081_0005895 3300049743 Bacteria 7928
340 Ga0501083_0331741 3300049744 Bacteria 989
341 Ga0501035_0069977 3300049822 Bacteria 3109
342 Ga0501045_0023428 3300049824 Bacteria 4425
343 nmdc:mga00v17_364005_c1 3300050491 Bacteria 940
344 nmdc:mga06z11_99638_c1 3300050494 Bacteria 1592
345 nmdc:mga04h51_166774_c1 3300050495 Bacteria 850
346 nmdc:mga05p37_65449_c1 3300050507 Bacteria 4472
347 Ga0495601_0020595 3300053077 Bacteria 4029
348 Ga0495619_0056897 3300053085 Bacteria 2594
349 Ga0500556_0001192 3300053104 Bacteria 12303
350 Ga0501084_0103876 3300054114 Bacteria 2386
351 Ga0501082_0019482 3300060353 Bacteria 5849
352 Ga0501082_0305504 3300060353 Bacteria 1385
353 Ga0466962_0013980 3300061719 Bacteria 3866
354 Ga0530510_0059914 3300061734 Bacteria 2754
355 2644610033 2643221711 Bacteria 4865335
356 2515854306 2515154155 Bacteria 7985436
357 2578337053 2576861424 Bacteria 5270569
358 2643827026 2643221561 Bacteria 4984412
359 2644527233 2643221694 Bacteria 4392972
360 2644534377 2643221696 Bacteria 5431823
361 2644667729 2643221722 Bacteria 4247614
362 2676477403 2675903058 Bacteria 6822861
363 2810365742 2808606700 Bacteria 3482157
364 2812374809 2811994882 Bacteria 4688362
365 2819428731 2818991318 Bacteria 5266538
366 2819691754 2818991462 Bacteria 4320267
367 2819729472 2818991469 Bacteria 4644110
368 2821271799 2821268502 Bacteria 3750023
369 2827634660 2827628540 Bacteria 6858585
370 2857472788 2857472729 Bacteria 6568124
371 2858897996 2858895516 Bacteria 7378898
372 2880491248 2880489317 Bacteria 7096270
373 3001267835 3001267043 Bacteria 4823521
374 8016255747 8016254467 Bacteria 3797036
375 JGI24739J22299_10061854
376 JGI24737J22298_10035094
377 JGI24743J22301_10002651
378 JGI24738J21930_10001627
379 JGI24744J21845_10022433
380 JGI25406J46586_10058304
381 Ga0006562J51391_1058481
382 Ga0070658_10011665
383 Ga0070658_10039663
384 Ga0070683_100051839
385 Ga0070683_100325833
386 Ga0070683_100342260
387 Ga0068869_100044142
388 Ga0068869_100303945
389 Ga0070682_100005255
390 Ga0070682_100051946
391 Ga0068868_100049860
392 Ga0070660_100057709
393 Ga0070660_100061609
394 Ga0070691_10011693
395 Ga0070687_100401610
396 Ga0070661_100063788
397 Ga0070692_10028498
398 Ga0070675_100127593
399 Ga0070671_100370563
400 Ga0070674_100183881
401 Ga0070673_100065218
402 Ga0070688_100302326
403 Ga0070659_100128416
404 Ga0070709_10383926
405 Ga0070714_100009557
406 Ga0070714_100163969
407 Ga0070713_100002272
408 Ga0070713_100086303
409 Ga0070663_100017093
410 Ga0070678_100084355
411 Ga0070678_100103349
412 Ga0070662_100024875
413 Ga0070681_10077572
414 Ga0070681_10356485
415 Ga0068867_100360450
416 Ga0070698_100073104
417 Ga0070699_100017422
418 Ga0070679_100084052
419 Ga0070684_100001597
420 Ga0070684_100045419
421 Ga0070684_100112827
422 Ga0070684_100148115
423 Ga0068853_100178015
424 Ga0070672_100027448
425 Ga0070686_100032144
426 Ga0070686_100370975
427 Ga0070686_100663852
428 Ga0070695_100000042
429 Ga0070693_100028296
430 Ga0070704_100519848
431 Ga0068855_100481006
432 Ga0070664_100307542
433 Ga0070664_100632364
434 Ga0068857_100066437
435 Ga0068854_100004694
436 Ga0068856_100033840
437 Ga0068856_100216655
438 Ga0068856_100269622
439 Ga0070702_100400228
440 Ga0068852_100030546
441 Ga0068861_100232367
442 Ga0068851_10025206
443 Ga0068858_100022557
444 Ga0068862_100956733
445 Ga0081455_10044420
446 Ga0081540_1006883
447 Ga0081539_10003101
448 Ga0075365_10093882
449 Ga0075365_10099640
450 Ga0075368_10049165
451 Ga0075367_10097622
452 Ga0097621_100218723
453 Ga0068871_100410165
454 Ga0075428_100096615
455 Ga0075428_100752462
456 Ga0068865_100076808
457 Ga0105245_10003807
458 Ga0105245_10004213
459 Ga0105245_10375154
460 Ga0114129_10152224
461 Ga0105243_10051813
462 Ga0105243_10059377
463 Ga0105243_10607063
464 Ga0105242_10039245
465 Ga0105242_10093989
466 Ga0105248_10024103
467 Ga0105237_10062149
468 Ga0105238_10289103
469 Ga0105249_10048833
470 Ga0105239_10006352
471 Ga0105239_10168069
472 Ga0105246_10010231
473 Ga0105246_10371893
474 Ga0157371_10054079
475 Ga0157371_10109680
476 Ga0157370_10518244
477 Ga0157369_10378884
478 Ga0157369_10716059
479 Ga0157369_10734387
480 Ga0163162_10046842
481 Ga0163162_10054395
482 Ga0163162_10549958
483 Ga0157372_10030297
484 Ga0157372_10057307
485 Ga0157372_10067971
486 Ga0157372_10156572
487 Ga0157372_10190061
488 Ga0157372_10383591
489 Ga0157372_11403164
490 Ga0157375_10015612
491 Ga0157375_10115664
492 Ga0157375_10122160
493 Ga0163163_10027995
494 Ga0157380_10041470
495 Ga0157377_10027463
496 Ga0157377_10048927
497 Ga0157377_10433123
498 Ga0157379_10067075
499 Ga0163161_10161079
500 Ga0163161_10207741
501 Ga0206353_11969101
502 Ga0207697_10048294
503 Ga0207656_10057459
504 Ga0207688_10016091
505 Ga0207688_10036423
506 Ga0207643_10152277
507 Ga0207705_10144370
508 Ga0207705_10479693
509 Ga0207695_10141340
510 Ga0207662_10200102
511 Ga0207657_10001130
512 Ga0207657_10068406
513 Ga0207649_10215631
514 Ga0207652_10123024
515 Ga0207681_10159691
516 Ga0207694_10140120
517 Ga0207659_10200828
518 Ga0207687_10061145
519 Ga0207687_10136244
520 Ga0207687_10360351
521 Ga0207687_10509084
522 Ga0207700_10008183
523 Ga0207664_10001810
524 Ga0207644_10296992
525 Ga0207690_10089151
526 Ga0207706_10079966
527 Ga0207709_10056277
528 Ga0207709_10158629
529 Ga0207704_10179785
530 Ga0207711_10019741
531 Ga0207689_10035816
532 Ga0207689_10342933
533 Ga0207661_10006432
534 Ga0207661_10083804
535 Ga0207661_10143433
536 Ga0207679_10155124
537 Ga0207667_10388034
538 Ga0207667_10472906
539 Ga0207651_10179190
540 Ga0207651_10461884
541 Ga0207712_10194299
542 Ga0207668_10482290
543 Ga0207640_10483773
544 Ga0207640_10619774
545 Ga0207677_10227949
546 Ga0207677_10425377
547 Ga0207703_10039545
548 Ga0207703_11240995
549 Ga0207639_10197999
550 Ga0207678_10057547
551 Ga0207702_10163885
552 Ga0207702_10184808
553 Ga0207702_10279451
554 Ga0207648_10162906
555 Ga0207674_10068495
556 Ga0207675_100112857
557 Ga0207675_100194508
558 Ga0207683_10128303
559 Ga0207683_10376381
560 Ga0207683_10656259
561 Ga0207698_10030211
562 Ga0207698_10459917
563 Ga0268266_10066312
564 Ga0307513_10171823
565 Ga0307408_100333108
566 Ga0307409_100098413
567 Ga0307409_100833081
568 Ga0307416_100657968
569 Ga0307415_100035917
570 Ga0373937_0404803
571 Ga0373937_0406348
572 Ga0395899_0096386
573 Ga0395899_0102366
574 Ga0395900_0103449
575 Ga0395898_0089657
576 Ga0395905_0037873
577 Ga0395905_0258082
578 Ga0436361_0694755
579 Ga0451798_0349447
580 Ga0451802_2148868
581 Ga0451843_1446967
582 Ga0466965_0040433
583 Ga0466965_0252637
584 Ga0466961_0360324
585 Ga0466963_0003960
586 Ga0466963_0482886
587 Ga0466964_0031573
588 Ga0466971_0289156
589 Ga0466957_0004163
590 Ga0466957_0281390
591 Ga0451576_0116557
592 Ga0466958_0010694
593 Ga0466967_0006133
594 Ga0466967_0040984
595 Ga0466967_0086254
596 Ga0466967_0173273
597 Ga0466967_0296543
598 Ga0495592_0037750
599 Ga0495651_0401025
600 Ga0495653_0097186
601 Ga0495664_0036608
602 Ga0495628_0300480
603 Ga0495652_0015990
604 Ga0495652_0112086
605 Ga0495640_0134431
606 Ga0495645_0030650
607 Ga0495645_0149412
608 Ga0495667_0137898
609 Ga0495646_0003250
610 Ga0495658_0266424
611 Ga0495604_0417463
612 Ga0495674_0002808
613 Ga0495676_0192467
614 Ga0495675_0242378
615 Ga0495684_0502076
616 Ga0496100_0309707
617 Ga0496100_0380499
618 Ga0496100_0639712
619 Ga0496101_0023484
620 Ga0496101_0104198
621 Ga0496101_0309427
622 Ga0496101_0341767
623 Ga0496101_0625027
624 Ga0496102_0003535
625 Ga0496102_0046667
626 Ga0496102_0053617
627 Ga0496102_0077250
628 Ga0496102_0295729
629 Ga0496103_0029177
630 Ga0496103_0082521
631 Ga0496103_0498461
632 Ga0496104_0024592
633 Ga0496104_0065374
634 Ga0496104_0183109
635 Ga0496104_0218233
636 Ga0496105_0024605
637 Ga0496105_0037581
638 Ga0496105_0106351
639 Ga0496105_0354666
640 Ga0496107_0016018
641 Ga0496107_0195422
642 Ga0496107_0745136
643 Ga0496108_0004798
644 Ga0496108_0010941
645 Ga0496108_0247587
646 Ga0496108_0331936
647 Ga0496108_0339350
648 Ga0496109_0012452
649 Ga0496109_0014606
650 Ga0496109_0026153
651 Ga0496109_0278927
652 Ga0496109_0316848
653 Ga0496109_0463807
654 Ga0496110_0012787
655 Ga0496110_0071040
656 Ga0496110_0356385
657 Ga0496110_0490938
658 Ga0496111_0034624
659 Ga0496111_0072013
660 Ga0496111_0115266
661 Ga0496112_0381470
662 Ga0496113_0129311
663 Ga0496113_0165444
664 Ga0496114_0010442
665 Ga0496114_0061998
666 Ga0496114_0071816
667 Ga0496114_0189529
668 Ga0496114_0238231
669 Ga0496114_0326450
670 Ga0496114_0341892
671 Ga0496114_0727172
672 Ga0496115_0006024
673 Ga0496115_0090336
674 Ga0496115_0114523
675 Ga0496126_0546012
676 Ga0501032_0318817
677 Ga0501033_0090222
678 Ga0501034_0031684
679 Ga0501034_0047097
680 Ga0501036_0039899
681 Ga0501037_0052350
682 Ga0501038_0241329
683 Ga0501039_0011885
684 Ga0501039_0379437
685 Ga0501040_0006262
686 Ga0501040_0116820
687 Ga0501042_0229988
688 Ga0501043_0016817
689 Ga0501046_0022659
690 Ga0501047_0489709
691 Ga0501048_0036431
692 Ga0501067_0046155
693 Ga0501067_0177368
694 Ga0501068_0024217
695 Ga0501069_0023590
696 Ga0501069_0057380
697 Ga0501069_0120138
698 Ga0501070_0008267
699 Ga0501070_0096531
700 Ga0501071_0046427
701 Ga0501072_0014664
702 Ga0501072_0214216
703 Ga0501073_0085629
704 Ga0501073_0350649
705 Ga0501074_0268562
706 Ga0501075_0051277
707 Ga0501075_0629638
708 Ga0501076_0016761
709 Ga0501077_0010144
710 Ga0501079_0060538
711 Ga0501079_0101973
712 Ga0501080_0033995
713 Ga0501081_0005895
714 Ga0501083_0331741
715 Ga0501035_0069977
716 Ga0501045_0023428
717 nmdc:mga00v17_364005_c1
718 nmdc:mga06z11_99638_c1
719 nmdc:mga04h51_166774_c1
720 nmdc:mga05p37_65449_c1
721 Ga0495601_0020595
722 Ga0495619_0056897
723 Ga0500556_0001192
724 Ga0501084_0103876
725 Ga0501082_0019482
726 Ga0501082_0305504
727 Ga0466962_0013980
728 Ga0530510_0059914
729 2644610033
730 2515854306
731 2578337053
732 2643827026
733 2644527233
734 2644534377
735 2644667729
736 2676477403
737 2810365742
738 2812374809
739 2819428731
740 2819691754
741 2819729472
742 2821271799
743 2827634660
744 2857472788
745 2858897996
746 2880491248
747 3001267835
748 8016255747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03575

Peptidase_S51

Peptidase family S51

42

252

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a4t-assembly1.cif.gz_B crystal structure of peptidase e from deinococcus radiodurans r1 0.7563 1 214
6a4t-assembly1.cif.gz_B crystal structure of peptidase e from deinococcus radiodurans r1 0.7494 1 214
3l4e-assembly1.cif.gz_A 1.5a crystal structure of a putative peptidase e protein from listeria monocytogenes egd-e 0.7399 2 216
6iru-assembly2.cif.gz_B crystal structure of peptidase e from deinococcus radiodurans in p6422 space group 0.7326 1 214
3l4e-assembly1.cif.gz_A 1.5a crystal structure of a putative peptidase e protein from listeria monocytogenes egd-e 0.7268 2 216
ID Description Score Start End Superfamily
3l4eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7378 2 216 3.40.50.880
3l4eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7279 2 216 3.40.50.880
2ywjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7115 31 163 3.40.50.880
1fyeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6931 1 222 3.40.50.880
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6635 2 220 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7Y9RX42-F1-model_v4 Peptidase E 0.9988 1 148 GO:0006508
GO:0008236
AF-A0A7V9PW09-F1-model_v4 Type 1 glutamine amidotransferase-like domain-containing protein 0.9959 1 221 GO:0006508
GO:0008236
GO:0016740
AF-A0A5B7RAN9-F1-model_v4 Peptidase E 0.9956 1 190 GO:0006508
GO:0008236
AF-A0A4R1WYT5-F1-model_v4 Dipeptidase E 0.9944 1 223 GO:0006508
GO:0008236
AF-A0A7Y9RX42-F1-model_v4 Peptidase E 0.9921 1 148 GO:0006508
GO:0008236

Map