metagRoot

F426877

General Info

Members	Datasets	Scaffolds	Average Seq Length
374	278	342	277

Family's Representative Sequence

Representative Sequence	3300050496\|nmdc:mga07m45_2265_c1\|nmdc:mga07m45_2265_c1_2834_3838
Length	334
Sequence	MTPESDPSDAPPPLPSRRQLLVTGASMVAAAGMPFAASAADAPSRGADVAHPIPTQKGTKSMSTITTKDGTQIYYKDWGSGQPVVFSHGWPLSADDWDGQMLFFLRQGYRVIAHDRRGHGRSSQGSTGHDMDHYADDLAALTEALDLRKAIHVGHSTGGGEVARYISRHGSKRVAKAVLISAVPPLMVKTAANPDGVPIEVLDGIRAAVASNRPQFFRDFTLPFYGFNRPGAKVSEGIREHWWQQGMMGSVQAHYEGIKAFSETDFTEDLKKMDVPTLVMHGDDDQVVPIGISSQLTAKIVKNATLKVYPGLPHGMCATHADLINPDLLAFFKR

Samples

	Sample ID	Description	Type	Environment
1	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
2	2599185354	Sphingomonas sp. NFR15	Isolate	Rhizoplane
3	2643221725	Flavobacterium sp. Root935	Isolate	Unclassified
4	2643221733	Bosea sp. Root381	Isolate	Unclassified
5	2738541279	Flavobacterium sp. GV069	Isolate	Unclassified
6	2738541285	Flavobacterium sp. GV030	Isolate	Unclassified
7	2738543007	Flavobacterium sp. GV063	Isolate	Unclassified
8	2739367857	Flavobacterium sp. GV029	Isolate	Unclassified
9	2739367858	Flavobacterium sp. GV028	Isolate	Unclassified
10	2802428842	Flavobacterium sp. S87F.05.LMB.W.Kidney.N	Isolate	Unclassified
11	2818991437	Pedobacter terrae 518	Isolate	Unclassified
12	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
13	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
14	2842722452	Pedobacter sp. R-72249	Isolate	Unclassified
15	2842909656	Pedobacter sp. R-72393	Isolate	Unclassified
16	2857618242	Flavobacterium sp. R-74482	Isolate	Unclassified
17	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
18	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
19	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
20	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
21	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
22	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
23	2954016120	Flavobacterium sp. W4I14	Isolate	Rhizosphere
24	2977268062	Flavobacterium sp. SORGH_AS 622	Isolate	Unclassified
25	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
26	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
27	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
28	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
29	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
30	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
31	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
32	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
33	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
34	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
35	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
36	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
37	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
38	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
39	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
40	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
41	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
42	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
43	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
44	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
45	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
46	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
47	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
48	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
49	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
50	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
51	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
52	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
53	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
54	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
59	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
60	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
61	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
62	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
63	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
64	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
65	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
66	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
67	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
68	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
69	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
70	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
71	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
73	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
74	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
75	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
79	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
80	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
81	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
82	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
83	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
84	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
85	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
88	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
89	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
90	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
91	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
92	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
93	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
94	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
95	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
96	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
97	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
98	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
99	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
100	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
101	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
102	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
103	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
104	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
105	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
106	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
107	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
108	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
113	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
116	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
152	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
153	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
154	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
158	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
159	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
160	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
161	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
162	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
163	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
164	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
165	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
166	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
167	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
168	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
169	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
170	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
171	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
172	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
173	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
174	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
175	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
176	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
177	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
178	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
179	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
180	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
181	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
182	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
183	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
184	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
185	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
186	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
187	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
188	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
189	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
190	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
191	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
192	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
193	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
194	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
195	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
196	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
197	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
198	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
199	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
200	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
201	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
202	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
203	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
204	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
205	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
206	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
207	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
208	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
209	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
210	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
211	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
212	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
213	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
214	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
215	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
216	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
217	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
218	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
219	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
220	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
221	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
222	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
223	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
224	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
225	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
226	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
227	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
228	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
229	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
230	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
231	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
232	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
233	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
234	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
235	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
236	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
237	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
238	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
239	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
240	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
241	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
242	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
243	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
244	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
245	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
246	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
247	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
248	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
249	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
253	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
254	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
255	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
257	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
258	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
259	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
260	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
261	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
262	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
263	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
264	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
265	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
266	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
267	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
268	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
269	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
270	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
271	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
272	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
273	3300053726	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere	Metagenome	Endosphere
274	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
275	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
276	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
277	8055419101	Flavobacterium tyrosinilyticum KCTC 42726	Isolate	Rhizosphere
278	8055592153	Flavobacterium panacis DCY106	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	91.44
Metatranscriptomes	0.27
Isolates	8.29

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.5
Nodule	2.14
Rhizoplane	8.82
Rhizosphere	69.25
Stem	0
Stem Tuber	0
Unclassified	8.29

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25158J39367_1000509	3300002739	Bacteria	7841
2	JGI25153J46596_10000307	3300003215	Bacteria	36624
3	Ga0055524_1036498	3300003775	Bacteria	1320
4	Ga0055536_1000183	3300003781	Bacteria	52066
5	Ga0055530_10001330	3300003791	Bacteria	18501
6	Ga0055531_10020282	3300003794	Bacteria	2637
7	Ga0065165_1000350	3300005262	Bacteria	75453
8	Ga0065165_1010151	3300005262	Bacteria	4113
9	Ga0065715_10122033	3300005293	Bacteria	2215
10	Ga0065715_10290492	3300005293	Bacteria	1064
11	Ga0070658_10001074	3300005327	Bacteria	23325
12	Ga0070683_100334099	3300005329	Bacteria	1443
13	Ga0068869_100158020	3300005334	Bacteria	1763
14	Ga0068868_100047983	3300005338	Bacteria	3349
15	Ga0070660_100336819	3300005339	Bacteria	1241
16	Ga0070675_100119790	3300005354	Bacteria	2235
17	Ga0070671_100042289	3300005355	Bacteria	3787
18	Ga0070671_100050245	3300005355	Bacteria	3468
19	Ga0070673_100071204	3300005364	Bacteria	2793
20	Ga0070667_100056786	3300005367	Bacteria	3307
21	Ga0070667_100133496	3300005367	Bacteria	2169
22	Ga0070709_10087472	3300005434	Bacteria	2047
23	Ga0070663_100068849	3300005455	Bacteria	2570
24	Ga0070662_100027673	3300005457	Bacteria	3939
25	Ga0070662_100362130	3300005457	Bacteria	1190
26	Ga0070681_10017681	3300005458	Bacteria	7126
27	Ga0070698_100085300	3300005471	Bacteria	3145
28	Ga0070698_100216454	3300005471	Bacteria	1849
29	Ga0070684_100027122	3300005535	Bacteria	4832
30	Ga0070697_100160573	3300005536	Bacteria	1899
31	Ga0068853_100231744	3300005539	Bacteria	1690
32	Ga0070672_100069701	3300005543	Bacteria	2793
33	Ga0070672_100085040	3300005543	Bacteria	2541
34	Ga0070696_100001011	3300005546	Bacteria	18234
35	Ga0070665_100002435	3300005548	Bacteria	20517
36	Ga0070665_100082720	3300005548	Bacteria	3216
37	Ga0070665_100276564	3300005548	Bacteria	1681
38	Ga0070664_100063713	3300005564	Bacteria	3143
39	Ga0068857_100094544	3300005577	Bacteria	2677
40	Ga0068856_100330605	3300005614	Bacteria	1541
41	Ga0068852_100000965	3300005616	Bacteria	18878
42	Ga0068852_100029165	3300005616	Bacteria	4528
43	Ga0068852_100051218	3300005616	Bacteria	3542
44	Ga0068852_100105142	3300005616	Bacteria	2557
45	Ga0068859_100064456	3300005617	Bacteria	3696
46	Ga0068859_100198062	3300005617	Bacteria	2093
47	Ga0068851_10025185	3300005834	Bacteria	2917
48	Ga0068858_100063461	3300005842	Bacteria	3419
49	Ga0068860_100157258	3300005843	Bacteria	2191
50	Ga0081455_10031518	3300005937	Bacteria	4794
51	Ga0070717_10218717	3300006028	Bacteria	1673
52	Ga0075365_10179227	3300006038	Bacteria	1481
53	Ga0075365_10232457	3300006038	Bacteria	1294
54	Ga0075363_100095845	3300006048	Bacteria	1638
55	Ga0070716_100052309	3300006173	Bacteria	2325
56	Ga0070712_100087202	3300006175	Bacteria	2276
57	Ga0075362_10045525	3300006177	Bacteria	1949
58	Ga0075367_10055596	3300006178	Bacteria	2349
59	Ga0075369_10050175	3300006186	Bacteria	1804
60	Ga0075366_10046565	3300006195	Bacteria	2570
61	Ga0097621_100013465	3300006237	Bacteria	6097
62	Ga0075370_10012207	3300006353	Bacteria	4534
63	Ga0075370_10155505	3300006353	Bacteria	1341
64	Ga0068871_100367911	3300006358	Bacteria	1275
65	Ga0075430_100217066	3300006846	Bacteria	1587
66	Ga0075434_100026560	3300006871	Bacteria	5674
67	Ga0068865_100026208	3300006881	Bacteria	3842
68	Ga0097620_100064455	3300006931	Bacteria	3696
69	Ga0097620_100198052	3300006931	Bacteria	2093
70	Ga0105251_10134230	3300009011	Bacteria	1121
71	Ga0105240_10259633	3300009093	Bacteria	2005
72	Ga0105240_10895792	3300009093	Bacteria	955
73	Ga0105245_10609444	3300009098	Bacteria	1119
74	Ga0105247_10000054	3300009101	Bacteria	134359
75	Ga0105247_10063433	3300009101	Bacteria	2293
76	Ga0105243_10021142	3300009148	Bacteria	4938
77	Ga0105243_10085488	3300009148	Bacteria	2586
78	Ga0105242_10129644	3300009176	Bacteria	2175
79	Ga0105242_10332268	3300009176	Bacteria	1398
80	Ga0105248_10018835	3300009177	Bacteria	7635
81	Ga0105248_10047152	3300009177	Bacteria	4832
82	Ga0105237_10043445	3300009545	Bacteria	4526
83	Ga0105237_10053547	3300009545	Bacteria	4047
84	Ga0105238_10035481	3300009551	Bacteria	5070
85	Ga0105238_10321552	3300009551	Bacteria	1533
86	Ga0105239_10188967	3300010375	Bacteria	2306
87	Ga0105239_10237944	3300010375	Bacteria	2044
88	Ga0105246_10035731	3300011119	Bacteria	3323
89	Ga0105246_10168008	3300011119	Bacteria	1677
90	Ga0105246_10309319	3300011119	Bacteria	1279
91	Ga0157373_10000001	3300013100	Bacteria	864756
92	Ga0157373_10000002	3300013100	Bacteria	750094
93	Ga0157373_10005558	3300013100	Bacteria	9448
94	Ga0157371_10000085	3300013102	Bacteria	148566
95	Ga0157371_10015429	3300013102	Bacteria	5730
96	Ga0157370_10000061	3300013104	Bacteria	115933
97	Ga0157370_10000073	3300013104	Bacteria	109460
98	Ga0157370_10007700	3300013104	Bacteria	11685
99	Ga0157370_10017015	3300013104	Bacteria	7347
100	Ga0157369_10309480	3300013105	Bacteria	1643
101	Ga0157378_10069960	3300013297	Bacteria	3150
102	Ga0163162_10023591	3300013306	Bacteria	6074
103	Ga0163162_10077409	3300013306	Bacteria	3389
104	Ga0163162_10251232	3300013306	Bacteria	1900
105	Ga0163162_10484796	3300013306	Bacteria	1368
106	Ga0157372_10034147	3300013307	Bacteria	5591
107	Ga0157372_10232607	3300013307	Bacteria	2137
108	Ga0157375_10351086	3300013308	Bacteria	1641
109	Ga0157375_10561620	3300013308	Bacteria	1302
110	Ga0163163_10004488	3300014325	Bacteria	11909
111	Ga0157377_10121396	3300014745	Bacteria	1584
112	Ga0157377_10202572	3300014745	Bacteria	1261
113	Ga0157379_10032672	3300014968	Bacteria	4640
114	Ga0157376_10316768	3300014969	Bacteria	1482
115	Ga0182006_1001201	3300015261	Bacteria	16183
116	Ga0182006_1003294	3300015261	Bacteria	8344
117	Ga0182006_1039977	3300015261	Bacteria	1848
118	Ga0182006_1040387	3300015261	Bacteria	1837
119	Ga0182007_10000006	3300015262	Bacteria	427355
120	Ga0163161_10000023	3300017792	Bacteria	205048
121	Ga0163161_10000701	3300017792	Bacteria	26688
122	Ga0163161_10002234	3300017792	Bacteria	13936
123	Ga0213872_10019397	3300021361	Bacteria	3132
124	Ga0213871_10067520	3300021441	Bacteria	1005
125	Ga0207425_1007847	3300025245	Bacteria	2781
126	Ga0209759_1004400	3300025256	Bacteria	5278
127	Ga0209129_1000791	3300025258	Bacteria	19971
128	Ga0209455_1009770	3300025272	Bacteria	2491
129	Ga0209676_1000469	3300025292	Bacteria	67603
130	Ga0209025_1000174	3300025294	Bacteria	158915
131	Ga0209564_1018685	3300025295	Bacteria	2629
132	Ga0209758_1000024	3300025297	Bacteria	591966
133	Ga0209050_1000322	3300025298	Bacteria	96057
134	Ga0209256_1002883	3300025299	Bacteria	13035
135	Ga0209051_1000674	3300025303	Bacteria	38231
136	Ga0209051_1002382	3300025303	Bacteria	13561
137	Ga0209051_1041627	3300025303	Bacteria	1632
138	Ga0209257_1003446	3300025304	Bacteria	13567
139	Ga0209257_1006765	3300025304	Bacteria	7223
140	Ga0207697_10046104	3300025315	Bacteria	1794
141	Ga0207655_1000066	3300025728	Bacteria	246358
142	Ga0207710_10000123	3300025900	Bacteria	93866
143	Ga0207680_10033291	3300025903	Bacteria	2939
144	Ga0207680_10299817	3300025903	Bacteria	1120
145	Ga0207705_10000066	3300025909	Bacteria	136520
146	Ga0207707_10008176	3300025912	Bacteria	9077
147	Ga0207671_10047943	3300025914	Bacteria	3161
148	Ga0207693_10047891	3300025915	Bacteria	3358
149	Ga0207663_10413060	3300025916	Bacteria	1034
150	Ga0207646_10679541	3300025922	Bacteria	921
151	Ga0207694_10092650	3300025924	Bacteria	2385
152	Ga0207700_10345098	3300025928	Bacteria	1295
153	Ga0207644_10044391	3300025931	Bacteria	3158
154	Ga0207706_10001040	3300025933	Bacteria	28167
155	Ga0207709_10023863	3300025935	Bacteria	3486
156	Ga0207665_10007628	3300025939	Bacteria	7145
157	Ga0207691_10067332	3300025940	Bacteria	3238
158	Ga0207691_10145552	3300025940	Bacteria	2086
159	Ga0207711_10108625	3300025941	Bacteria	2464
160	Ga0207711_10341992	3300025941	Bacteria	1385
161	Ga0207711_10603293	3300025941	Bacteria	1024
162	Ga0207689_10174223	3300025942	Bacteria	1774
163	Ga0207679_10252099	3300025945	Bacteria	1501
164	Ga0207667_10566404	3300025949	Bacteria	1148
165	Ga0207651_10209771	3300025960	Bacteria	1567
166	Ga0207668_10030434	3300025972	Bacteria	3548
167	Ga0207658_10121827	3300025986	Bacteria	2081
168	Ga0207658_10123968	3300025986	Bacteria	2065
169	Ga0207658_10127987	3300025986	Bacteria	2035
170	Ga0207677_10054194	3300026023	Bacteria	2735
171	Ga0207703_10057970	3300026035	Bacteria	3159
172	Ga0207639_10026887	3300026041	Bacteria	4185
173	Ga0207639_10117339	3300026041	Bacteria	2181
174	Ga0207678_10040716	3300026067	Bacteria	4028
175	Ga0207678_10229111	3300026067	Bacteria	1591
176	Ga0207702_10020574	3300026078	Bacteria	5463
177	Ga0207702_10244488	3300026078	Bacteria	1682
178	Ga0207702_10402748	3300026078	Bacteria	1320
179	Ga0207641_10149476	3300026088	Bacteria	2114
180	Ga0207641_10264189	3300026088	Bacteria	1613
181	Ga0207674_10016307	3300026116	Bacteria	8137
182	Ga0207683_10005460	3300026121	Bacteria	10888
183	Ga0207698_10000140	3300026142	Bacteria	45780
184	Ga0209281_1005133	3300027111	Bacteria	3707
185	Ga0209389_1000242	3300027296	Bacteria	35240
186	Ga0209489_102751	3300027361	Bacteria	35240
187	Ga0268266_10424636	3300028379	Bacteria	1260
188	Ga0268265_10197170	3300028380	Bacteria	1743
189	Ga0268264_10397689	3300028381	Bacteria	1323
190	Ga0265327_10005625	3300031251	Bacteria	10375
191	Ga0307408_100063888	3300031548	Bacteria	2694
192	Ga0307514_10004239	3300031649	Bacteria	13276
193	Ga0265314_10074891	3300031711	Bacteria	2253
194	Ga0307405_10000027	3300031731	Bacteria	118118
195	Ga0307405_10022071	3300031731	Bacteria	3592
196	Ga0307413_10008737	3300031824	Bacteria	4804
197	Ga0307406_10035869	3300031901	Bacteria	3053
198	Ga0307407_10000028	3300031903	Bacteria	105575
199	Ga0307412_10166803	3300031911	Bacteria	1642
200	Ga0307416_100000011	3300032002	Bacteria	300622
201	Ga0307414_10000636	3300032004	Bacteria	17977
202	Ga0307414_10054728	3300032004	Bacteria	2790
203	Ga0307414_10177290	3300032004	Bacteria	1710
204	Ga0307411_10000001	3300032005	Bacteria	931810
205	Ga0373934_0020023	3300035086	Bacteria	2572
206	Ga0373923_0017984	3300035111	Bacteria	2712
207	Ga0373953_0003578	3300035117	Bacteria	4861
208	Ga0373954_0000771	3300035118	Bacteria	12334
209	Ga0373955_0001347	3300035172	Bacteria	10434
210	Ga0373962_0063475	3300035242	Bacteria	1090
211	Ga0373924_0023879	3300035410	Bacteria	2404
212	Ga0373931_0001735	3300035691	Bacteria	9444
213	Ga0373937_0151618	3300036401	Bacteria	2171
214	Ga0395900_0587959	3300037418	Bacteria	1055
215	Ga0436364_0799542	3300037853	Bacteria	3993
216	Ga0436360_0291050	3300039438	Bacteria	4306
217	Ga0436360_0329944	3300039438	Bacteria	1927
218	Ga0436360_1020421	3300039438	Bacteria	6961
219	Ga0436361_0375049	3300039447	Bacteria	14568
220	Ga0436361_0702307	3300039447	Bacteria	2085
221	Ga0436361_0734590	3300039447	Bacteria	2611
222	Ga0436363_0436343	3300039450	Bacteria	986
223	Ga0436362_0807820	3300039453	Bacteria	844
224	Ga0439447_059987	3300041407	Bacteria	896
225	Ga0439453_0000118	3300041408	Bacteria	6597
226	Ga0439443_000102	3300042003	Bacteria	5295
227	Ga0439451_018515	3300042009	Bacteria	1405
228	Ga0439456_017094	3300042013	Bacteria	1520
229	Ga0450888_007640	3300042126	Bacteria	1201
230	Ga0439435_0000117	3300042436	Bacteria	10318
231	Ga0439444_0008984	3300042437	Bacteria	1566
232	Ga0439444_0011777	3300042437	Bacteria	1423
233	Ga0439460_0010410	3300042461	Bacteria	2379
234	Ga0439460_0031611	3300042461	Bacteria	1511
235	Ga0466972_0002732	3300044658	Bacteria	8731
236	Ga0466966_0229491	3300044684	Bacteria	1120
237	Ga0466961_0136864	3300044693	Bacteria	1534
238	Ga0466963_0111738	3300044694	Bacteria	1876
239	Ga0466964_0004938	3300044706	Bacteria	4929
240	Ga0466957_0085756	3300044842	Bacteria	1967
241	Ga0466958_0010086	3300045836	Bacteria	5280
242	Ga0466967_0045408	3300045976	Bacteria	3817
243	Ga0495592_0005537	3300046454	Bacteria	9341
244	Ga0495629_0003151	3300046459	Bacteria	12487
245	Ga0495651_0048801	3300046462	Bacteria	3268
246	Ga0495653_0031682	3300046463	Bacteria	4201
247	Ga0495608_0013032	3300046511	Bacteria	5768
248	Ga0495618_0180735	3300046514	Bacteria	1340
249	Ga0495628_0151735	3300046516	Bacteria	1764
250	Ga0495663_0000484	3300046525	Bacteria	14454
251	Ga0495642_0045754	3300046528	Bacteria	1789
252	Ga0495652_0559259	3300046529	Bacteria	785
253	Ga0495654_0181244	3300046530	Bacteria	912
254	Ga0495640_0016825	3300046533	Bacteria	5467
255	Ga0495587_0033512	3300046536	Bacteria	3100
256	Ga0495645_0018546	3300046543	Bacteria	4999
257	Ga0495667_0020844	3300046559	Bacteria	4423
258	Ga0495635_0008343	3300046663	Bacteria	7232
259	Ga0495623_0044223	3300046679	Bacteria	2830
260	Ga0495646_0003724	3300046680	Bacteria	9522
261	Ga0495613_0257108	3300046689	Bacteria	1217
262	Ga0495600_0003462	3300046809	Bacteria	9282
263	Ga0495600_0121184	3300046809	Bacteria	1701
264	Ga0495660_0000244	3300046810	Bacteria	53184
265	Ga0495604_0021552	3300047317	Bacteria	5143
266	Ga0495674_0041124	3300047319	Bacteria	4131
267	Ga0495680_0038001	3300047322	Bacteria	3851
268	Ga0495675_0011991	3300047444	Bacteria	5448
269	Ga0495684_0001200	3300047471	Bacteria	20852
270	Ga0495686_0045482	3300047472	Bacteria	2777
271	Ga0495593_0010021	3300047673	Bacteria	5492
272	Ga0495593_0072098	3300047673	Bacteria	1794
273	Ga0495602_0078293	3300048088	Bacteria	2792
274	Ga0496100_0017819	3300048903	Bacteria	4201
275	Ga0496100_0372805	3300048903	Bacteria	1083
276	Ga0496101_0012043	3300048904	Bacteria	5762
277	Ga0496101_0546080	3300048904	Bacteria	916
278	Ga0496102_0019066	3300048905	Bacteria	6038
279	Ga0496102_0186864	3300048905	Bacteria	1953
280	Ga0496104_0036375	3300048907	Bacteria	4602
281	Ga0496105_0002707	3300048908	Bacteria	12922
282	Ga0496105_0136948	3300048908	Bacteria	2017
283	Ga0496106_0002037	3300048909	Bacteria	15199
284	Ga0496106_0054034	3300048909	Bacteria	3034
285	Ga0496107_0000944	3300048910	Bacteria	17207
286	Ga0496107_0098969	3300048910	Bacteria	2136
287	Ga0496108_0002514	3300048911	Bacteria	14666
288	Ga0496108_0082179	3300048911	Bacteria	2731
289	Ga0496108_0194278	3300048911	Bacteria	1760
290	Ga0496109_0000837	3300048912	Bacteria	25676
291	Ga0496109_0002524	3300048912	Bacteria	15349
292	Ga0496109_0347345	3300048912	Bacteria	1401
293	Ga0496109_0691121	3300048912	Bacteria	958
294	Ga0496110_0040462	3300048913	Bacteria	4062
295	Ga0496110_0116099	3300048913	Bacteria	2409
296	Ga0496111_0078332	3300048914	Bacteria	2410
297	Ga0496111_0161845	3300048914	Bacteria	1662
298	Ga0496112_0000505	3300048915	Bacteria	26413
299	Ga0496112_0026190	3300048915	Bacteria	5609
300	Ga0496112_0323355	3300048915	Bacteria	1487
301	Ga0496113_0001614	3300048916	Bacteria	12687
302	Ga0496113_0040425	3300048916	Bacteria	3437
303	Ga0496113_0299099	3300048916	Bacteria	1288
304	Ga0496114_0183535	3300048917	Bacteria	1828
305	Ga0496115_0058457	3300048918	Bacteria	3103
306	Ga0496121_0007696	3300048924	Bacteria	12933
307	Ga0496121_0038825	3300048924	Bacteria	4208
308	Ga0496121_0117955	3300048924	Bacteria	2010
309	Ga0496124_0029386	3300048927	Bacteria	4899
310	Ga0496124_0069058	3300048927	Bacteria	2935
311	Ga0496125_0073078	3300048928	Bacteria	2669
312	Ga0496126_0006560	3300048929	Bacteria	12961
313	Ga0501032_0056106	3300049569	Bacteria	2648
314	Ga0501038_0073258	3300049574	Bacteria	2901
315	Ga0501043_0063646	3300049579	Bacteria	2897
316	Ga0501047_0062746	3300049581	Bacteria	3585
317	Ga0501069_0241193	3300049585	Bacteria	1053
318	Ga0501070_0195886	3300049586	Bacteria	1659
319	Ga0501073_0049357	3300049589	Bacteria	2951
320	Ga0501249_001222	3300049679	Bacteria	5393
321	Ga0501083_0002347	3300049744	Bacteria	12949
322	Ga0501262_000884	3300049759	Bacteria	3414
323	Ga0501266_000016	3300049763	Bacteria	164181
324	Ga0501044_0000526	3300049823	Bacteria	46666
325	nmdc:mga03683_9183_c1	3300050489	Bacteria	3505
326	nmdc:mga0yw44_45735_c1	3300050492	Bacteria	2625
327	nmdc:mga0yw44_650633_c1	3300050492	Bacteria	716
328	nmdc:mga06z11_9377_c1	3300050494	Bacteria	4123
329	nmdc:mga07m45_2265_c1	3300050496	Bacteria	8988
330	nmdc:mga0n895_334666_c1	3300050512	Bacteria	1534
331	nmdc:mga0sz30_5842_c1	3300050516	Bacteria	1804
332	Ga0495595_0002899	3300053084	Bacteria	6761
333	Ga0495619_0003738	3300053085	Bacteria	9805
334	Ga0500643_005247	3300053087	Bacteria	5626
335	Ga0500618_037571	3300053125	Bacteria	1119
336	Ga0500658_0000019	3300053134	Bacteria	141013
337	Ga0500559_0003380	3300053136	Bacteria	7875
338	Ga0500559_0019238	3300053136	Bacteria	2886
339	Ga0500584_006947	3300053726	Bacteria	4883
340	Ga0587067_016010	3300059640	Bacteria	1225
341	Ga0501082_0096455	3300060353	Bacteria	2556
342	Ga0466962_0000483	3300061719	Bacteria	17254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050492	nmdc:mga0yw44_650633_c1	nmdc:mga0yw44_650633_c1_30_704	224
2	3300049569	Ga0501032_0056106	Ga0501032_0056106_44_772	233
3	3300049586	Ga0501070_0195886	Ga0501070_0195886_45_773	233
4	3300049589	Ga0501073_0049357	Ga0501073_0049357_26_754	233
5	3300039447	Ga0436361_0734590	Ga0436361_0734590_24_731	235
6	3300039450	Ga0436363_0436343	Ga0436363_0436343_238_945	235
7	3300039453	Ga0436362_0807820	Ga0436362_0807820_125_832	235
8	3300013306	Ga0163162_10484796	Ga0163162_104847961	246
9	3300005616	Ga0068852_100105142	Ga0068852_1001051423	251
10	3300026041	Ga0207639_10026887	Ga0207639_100268874	251
11	3300046463	Ga0495653_0031682	Ga0495653_0031682_13_771	252
12	3300046529	Ga0495652_0559259	Ga0495652_0559259_15_773	252
13	3300046559	Ga0495667_0020844	Ga0495667_0020844_13_771	252
14	3300005471	Ga0070698_100085300	Ga0070698_1000853002	254
15	3300005536	Ga0070697_100160573	Ga0070697_1001605732	254
16	3300003781	Ga0055536_1000183	Ga0055536_100018326	258
17	3300003791	Ga0055530_10001330	Ga0055530_1000133012	258
18	3300025292	Ga0209676_1000469	Ga0209676_100046933	258
19	3300025298	Ga0209050_1000322	Ga0209050_100032256	258
20	3300025303	Ga0209051_1002382	Ga0209051_10023823	258
21	3300025304	Ga0209257_1006765	Ga0209257_10067652	258
22	3300048914	Ga0496111_0078332	Ga0496111_0078332_743_1594	258
23	iso_pu_bacteria	2599185354	2600201159	268
24	iso_pu_bacteria	2643221725	2644683234	268
25	iso_pu_bacteria	2643221725	2644684932	268
26	iso_pu_bacteria	2738541279	2738734295	268
27	iso_pu_bacteria	2738541285	2738767053	268
28	iso_pu_bacteria	2738543007	2739215876	268
29	iso_pu_bacteria	2739367857	2740001407	268
30	iso_pu_bacteria	2739367857	2740001427	268
31	iso_pu_bacteria	2739367858	2740006223	268
32	iso_pu_bacteria	2739367858	2740006243	268
33	iso_pu_bacteria	2802428842	2802652876	268
34	iso_pu_bacteria	2802428842	2802653855	268
35	iso_pu_bacteria	2818991437	2819548737	268
36	iso_pu_bacteria	2842722452	2842725803	268
37	iso_pu_bacteria	2842909656	2842912993	268
38	iso_pu_bacteria	2857618242	2857618368	268
39	iso_pu_bacteria	2954016120	2954017988	268
40	iso_pu_bacteria	2977268062	2977270041	268
41	iso_pu_bacteria	2977268062	2977271023	268
42	iso_pu_bacteria	8055419101	8055422140	268
43	iso_pu_bacteria	8055592153	8055592815	268
44	iso_pu_bacteria	2919462493	2919462510	269
45	iso_pu_bacteria	2945972063	2945972314	269
46	iso_pu_bacteria	2513237104	2513723139	270
47	iso_pu_bacteria	2824671348	2824671950	270
48	iso_pu_bacteria	2824687955	2824688368	270
49	iso_pu_bacteria	2935630451	2935634966	270
50	iso_pu_bacteria	2941507105	2941511755	270
51	iso_pu_bacteria	2941515067	2941519262	270
52	iso_pu_bacteria	2941523033	2941527614	270
53	3300013100	Ga0157373_10005558	Ga0157373_100055586	271
54	3300013307	Ga0157372_10232607	Ga0157372_102326072	271
55	iso_pu_bacteria	2643221733	2644729764	271
56	3300003215	JGI25153J46596_10000307	JGI25153J46596_1000030718	272
57	3300003794	Ga0055531_10020282	Ga0055531_100202822	272
58	3300005262	Ga0065165_1010151	Ga0065165_10101511	272
59	3300005293	Ga0065715_10290492	Ga0065715_102904921	272
60	3300013100	Ga0157373_10000001	Ga0157373_10000001659	272
61	3300013100	Ga0157373_10000002	Ga0157373_10000002367	272
62	3300013102	Ga0157371_10000085	Ga0157371_10000085110	272
63	3300013102	Ga0157371_10015429	Ga0157371_100154293	272
64	3300013104	Ga0157370_10000061	Ga0157370_1000006144	272
65	3300013104	Ga0157370_10000073	Ga0157370_100000737	272
66	3300013104	Ga0157370_10007700	Ga0157370_100077009	272
67	3300013104	Ga0157370_10017015	Ga0157370_100170153	272
68	3300013308	Ga0157375_10561620	Ga0157375_105616202	272
69	3300015261	Ga0182006_1001201	Ga0182006_10012013	272
70	3300015261	Ga0182006_1003294	Ga0182006_10032945	272
71	3300015261	Ga0182006_1039977	Ga0182006_10399772	272
72	3300015261	Ga0182006_1040387	Ga0182006_10403872	272
73	3300015262	Ga0182007_10000006	Ga0182007_1000000675	272
74	3300017792	Ga0163161_10000023	Ga0163161_1000002375	272
75	3300017792	Ga0163161_10000701	Ga0163161_100007016	272
76	3300017792	Ga0163161_10002234	Ga0163161_100022343	272
77	3300025245	Ga0207425_1007847	Ga0207425_10078472	272
78	3300025295	Ga0209564_1018685	Ga0209564_10186852	272
79	3300025297	Ga0209758_1000024	Ga0209758_1000024560	272
80	3300025299	Ga0209256_1002883	Ga0209256_10028836	272
81	3300025303	Ga0209051_1041627	Ga0209051_10416272	272
82	3300025304	Ga0209257_1003446	Ga0209257_10034462	272
83	3300025728	Ga0207655_1000066	Ga0207655_1000066111	272
84	3300031731	Ga0307405_10000027	Ga0307405_1000002719	272
85	3300031824	Ga0307413_10008737	Ga0307413_100087373	272
86	3300031903	Ga0307407_10000028	Ga0307407_1000002863	272
87	3300032002	Ga0307416_100000011	Ga0307416_100000011190	272
88	3300032005	Ga0307411_10000001	Ga0307411_10000001570	272
89	3300035086	Ga0373934_0020023	Ga0373934_0020023_245_1063	272
90	3300035111	Ga0373923_0017984	Ga0373923_0017984_941_1759	272
91	3300035117	Ga0373953_0003578	Ga0373953_0003578_215_1033	272
92	3300035118	Ga0373954_0000771	Ga0373954_0000771_4837_5655	272
93	3300035172	Ga0373955_0001347	Ga0373955_0001347_5494_6312	272
94	3300035410	Ga0373924_0023879	Ga0373924_0023879_484_1302	272
95	3300036401	Ga0373937_0151618	Ga0373937_0151618_249_1067	272
96	3300046454	Ga0495592_0005537	Ga0495592_0005537_639_1457	272
97	3300046459	Ga0495629_0003151	Ga0495629_0003151_6601_7419	272
98	3300046462	Ga0495651_0048801	Ga0495651_0048801_81_899	272
99	3300046511	Ga0495608_0013032	Ga0495608_0013032_1748_2566	272
100	3300046514	Ga0495618_0180735	Ga0495618_0180735_438_1256	272
101	3300046516	Ga0495628_0151735	Ga0495628_0151735_706_1524	272
102	3300046530	Ga0495654_0181244	Ga0495654_0181244_57_875	272
103	3300046533	Ga0495640_0016825	Ga0495640_0016825_3821_4639	272
104	3300046536	Ga0495587_0033512	Ga0495587_0033512_2218_3036	272
105	3300046543	Ga0495645_0018546	Ga0495645_0018546_1049_1867	272
106	3300046663	Ga0495635_0008343	Ga0495635_0008343_4261_5079	272
107	3300046679	Ga0495623_0044223	Ga0495623_0044223_1696_2514	272
108	3300046680	Ga0495646_0003724	Ga0495646_0003724_5644_6462	272
109	3300046689	Ga0495613_0257108	Ga0495613_0257108_375_1193	272
110	3300046809	Ga0495600_0003462	Ga0495600_0003462_6861_7679	272
111	3300047317	Ga0495604_0021552	Ga0495604_0021552_1357_2175	272
112	3300047319	Ga0495674_0041124	Ga0495674_0041124_1531_2349	272
113	3300047322	Ga0495680_0038001	Ga0495680_0038001_2969_3787	272
114	3300047444	Ga0495675_0011991	Ga0495675_0011991_3431_4249	272
115	3300047471	Ga0495684_0001200	Ga0495684_0001200_6737_7555	272
116	3300047673	Ga0495593_0010021	Ga0495593_0010021_707_1525	272
117	3300048088	Ga0495602_0078293	Ga0495602_0078293_833_1651	272
118	3300048924	Ga0496121_0038825	Ga0496121_0038825_1543_2361	272
119	3300048924	Ga0496121_0117955	Ga0496121_0117955_48_866	272
120	3300048927	Ga0496124_0029386	Ga0496124_0029386_1446_2264	272
121	3300048927	Ga0496124_0069058	Ga0496124_0069058_2032_2850	272
122	3300049679	Ga0501249_001222	Ga0501249_001222_3278_4096	272
123	3300049763	Ga0501266_000016	Ga0501266_000016_159752_160570	272
124	3300049763	Ga0501266_000016	Ga0501266_000016_91968_92786	272
125	3300053084	Ga0495595_0002899	Ga0495595_0002899_4839_5657	272
126	3300053085	Ga0495619_0003738	Ga0495619_0003738_6618_7436	272
127	3300053134	Ga0500658_0000019	Ga0500658_0000019_71152_71970	272
128	3300053136	Ga0500559_0019238	Ga0500559_0019238_368_1186	272
129	3300053726	Ga0500584_006947	Ga0500584_006947_3537_4355	272
130	3300005471	Ga0070698_100216454	Ga0070698_1002164541	273
131	3300005543	Ga0070672_100085040	Ga0070672_1000850402	273
132	3300005548	Ga0070665_100276564	Ga0070665_1002765642	273
133	3300005617	Ga0068859_100064456	Ga0068859_1000644564	273
134	3300006195	Ga0075366_10046565	Ga0075366_100465652	273
135	3300006353	Ga0075370_10012207	Ga0075370_100122074	273
136	3300006931	Ga0097620_100064455	Ga0097620_1000644552	273
137	3300009098	Ga0105245_10609444	Ga0105245_106094442	273
138	3300009176	Ga0105242_10332268	Ga0105242_103322682	273
139	3300009551	Ga0105238_10035481	Ga0105238_100354814	273
140	3300011119	Ga0105246_10168008	Ga0105246_101680082	273
141	3300011119	Ga0105246_10309319	Ga0105246_103093191	273
142	3300013306	Ga0163162_10023591	Ga0163162_100235915	273
143	3300013306	Ga0163162_10077409	Ga0163162_100774094	273
144	3300013308	Ga0157375_10351086	Ga0157375_103510862	273
145	3300025256	Ga0209759_1004400	Ga0209759_10044003	273
146	3300025258	Ga0209129_1000791	Ga0209129_100079115	273
147	3300025294	Ga0209025_1000174	Ga0209025_100017415	273
148	3300025924	Ga0207694_10092650	Ga0207694_100926504	273
149	3300025940	Ga0207691_10145552	Ga0207691_101455521	273
150	3300025949	Ga0207667_10566404	Ga0207667_105664042	273
151	3300025960	Ga0207651_10209771	Ga0207651_102097713	273
152	3300025986	Ga0207658_10121827	Ga0207658_101218273	273
153	3300026023	Ga0207677_10054194	Ga0207677_100541943	273
154	3300028380	Ga0268265_10197170	Ga0268265_101971701	273
155	3300028381	Ga0268264_10397689	Ga0268264_103976891	273
156	3300031251	Ga0265327_10005625	Ga0265327_100056253	273
157	3300031548	Ga0307408_100063888	Ga0307408_1000638881	273
158	3300031649	Ga0307514_10004239	Ga0307514_1000423911	273
159	3300031711	Ga0265314_10074891	Ga0265314_100748913	273
160	3300031731	Ga0307405_10022071	Ga0307405_100220712	273
161	3300031911	Ga0307412_10166803	Ga0307412_101668032	273
162	3300037853	Ga0436364_0799542	Ga0436364_0799542_1729_2550	273
163	3300041407	Ga0439447_059987	Ga0439447_059987_58_879	273
164	3300046528	Ga0495642_0045754	Ga0495642_0045754_32_853	273
165	3300046809	Ga0495600_0121184	Ga0495600_0121184_173_994	273
166	3300046810	Ga0495660_0000244	Ga0495660_0000244_22329_23150	273
167	3300047673	Ga0495593_0072098	Ga0495593_0072098_651_1472	273
168	3300048903	Ga0496100_0017819	Ga0496100_0017819_1199_2020	273
169	3300048904	Ga0496101_0012043	Ga0496101_0012043_3179_4000	273
170	3300048905	Ga0496102_0019066	Ga0496102_0019066_5008_5829	273
171	3300048907	Ga0496104_0036375	Ga0496104_0036375_3358_4179	273
172	3300048908	Ga0496105_0002707	Ga0496105_0002707_10827_11648	273
173	3300048910	Ga0496107_0098969	Ga0496107_0098969_688_1509	273
174	3300048911	Ga0496108_0082179	Ga0496108_0082179_1723_2544	273
175	3300048916	Ga0496113_0299099	Ga0496113_0299099_221_1042	273
176	3300049759	Ga0501262_000884	Ga0501262_000884_1104_1925	273
177	3300053087	Ga0500643_005247	Ga0500643_005247_1968_2789	273
178	3300053136	Ga0500559_0003380	Ga0500559_0003380_5793_6614	273
179	3300005293	Ga0065715_10122033	Ga0065715_101220333	274
180	3300005329	Ga0070683_100334099	Ga0070683_1003340991	274
181	3300005334	Ga0068869_100158020	Ga0068869_1001580201	274
182	3300005338	Ga0068868_100047983	Ga0068868_1000479832	274
183	3300005339	Ga0070660_100336819	Ga0070660_1003368191	274
184	3300005354	Ga0070675_100119790	Ga0070675_1001197901	274
185	3300005355	Ga0070671_100042289	Ga0070671_1000422893	274
186	3300005355	Ga0070671_100050245	Ga0070671_1000502452	274
187	3300005364	Ga0070673_100071204	Ga0070673_1000712041	274
188	3300005367	Ga0070667_100056786	Ga0070667_1000567862	274
189	3300005367	Ga0070667_100133496	Ga0070667_1001334962	274
190	3300005457	Ga0070662_100027673	Ga0070662_1000276732	274
191	3300005457	Ga0070662_100362130	Ga0070662_1003621302	274
192	3300005458	Ga0070681_10017681	Ga0070681_100176812	274
193	3300005539	Ga0068853_100231744	Ga0068853_1002317442	274
194	3300005543	Ga0070672_100069701	Ga0070672_1000697012	274
195	3300005546	Ga0070696_100001011	Ga0070696_1000010114	274
196	3300005548	Ga0070665_100082720	Ga0070665_1000827202	274
197	3300005614	Ga0068856_100330605	Ga0068856_1003306052	274
198	3300005616	Ga0068852_100029165	Ga0068852_1000291653	274
199	3300005617	Ga0068859_100198062	Ga0068859_1001980621	274
200	3300005842	Ga0068858_100063461	Ga0068858_1000634612	274
201	3300005843	Ga0068860_100157258	Ga0068860_1001572583	274
202	3300005937	Ga0081455_10031518	Ga0081455_100315185	274
203	3300006237	Ga0097621_100013465	Ga0097621_1000134657	274
204	3300006353	Ga0075370_10155505	Ga0075370_101555052	274
205	3300006358	Ga0068871_100367911	Ga0068871_1003679111	274
206	3300006871	Ga0075434_100026560	Ga0075434_1000265605	274
207	3300006881	Ga0068865_100026208	Ga0068865_1000262083	274
208	3300006931	Ga0097620_100198052	Ga0097620_1001980521	274
209	3300009093	Ga0105240_10259633	Ga0105240_102596332	274
210	3300009093	Ga0105240_10895792	Ga0105240_108957921	274
211	3300009101	Ga0105247_10063433	Ga0105247_100634332	274
212	3300009176	Ga0105242_10129644	Ga0105242_101296442	274
213	3300009177	Ga0105248_10018835	Ga0105248_100188353	274
214	3300009177	Ga0105248_10047152	Ga0105248_100471524	274
215	3300009545	Ga0105237_10043445	Ga0105237_100434453	274
216	3300009551	Ga0105238_10321552	Ga0105238_103215522	274
217	3300010375	Ga0105239_10188967	Ga0105239_101889671	274
218	3300011119	Ga0105246_10035731	Ga0105246_100357312	274
219	3300013105	Ga0157369_10309480	Ga0157369_103094803	274
220	3300013297	Ga0157378_10069960	Ga0157378_100699602	274
221	3300013307	Ga0157372_10034147	Ga0157372_100341473	274
222	3300014325	Ga0163163_10004488	Ga0163163_100044885	274
223	3300014745	Ga0157377_10121396	Ga0157377_101213962	274
224	3300014745	Ga0157377_10202572	Ga0157377_102025721	274
225	3300014968	Ga0157379_10032672	Ga0157379_100326722	274
226	3300014969	Ga0157376_10316768	Ga0157376_103167682	274
227	3300021361	Ga0213872_10019397	Ga0213872_100193973	274
228	3300021441	Ga0213871_10067520	Ga0213871_100675202	274
229	3300025315	Ga0207697_10046104	Ga0207697_100461042	274
230	3300025903	Ga0207680_10299817	Ga0207680_102998171	274
231	3300025912	Ga0207707_10008176	Ga0207707_100081767	274
232	3300025915	Ga0207693_10047891	Ga0207693_100478912	274
233	3300025916	Ga0207663_10413060	Ga0207663_104130601	274
234	3300025922	Ga0207646_10679541	Ga0207646_106795411	274
235	3300025931	Ga0207644_10044391	Ga0207644_100443912	274
236	3300025933	Ga0207706_10001040	Ga0207706_1000104023	274
237	3300025940	Ga0207691_10067332	Ga0207691_100673322	274
238	3300025941	Ga0207711_10108625	Ga0207711_101086252	274
239	3300025941	Ga0207711_10603293	Ga0207711_106032932	274
240	3300025942	Ga0207689_10174223	Ga0207689_101742232	274
241	3300025945	Ga0207679_10252099	Ga0207679_102520991	274
242	3300025972	Ga0207668_10030434	Ga0207668_100304343	274
243	3300025986	Ga0207658_10123968	Ga0207658_101239683	274
244	3300025986	Ga0207658_10127987	Ga0207658_101279872	274
245	3300026035	Ga0207703_10057970	Ga0207703_100579705	274
246	3300026041	Ga0207639_10117339	Ga0207639_101173391	274
247	3300026067	Ga0207678_10229111	Ga0207678_102291112	274
248	3300026088	Ga0207641_10264189	Ga0207641_102641892	274
249	3300026121	Ga0207683_10005460	Ga0207683_100054607	274
250	3300027296	Ga0209389_1000242	Ga0209389_100024222	274
251	3300027361	Ga0209489_102751	Ga0209489_10275122	274
252	3300028379	Ga0268266_10424636	Ga0268266_104246362	274
253	3300032004	Ga0307414_10000636	Ga0307414_100006367	274
254	3300032004	Ga0307414_10054728	Ga0307414_100547283	274
255	3300032004	Ga0307414_10177290	Ga0307414_101772902	274
256	3300035242	Ga0373962_0063475	Ga0373962_0063475_51_875	274
257	3300037418	Ga0395900_0587959	Ga0395900_0587959_140_964	274
258	3300039438	Ga0436360_0291050	Ga0436360_0291050_475_1299	274
259	3300039438	Ga0436360_0329944	Ga0436360_0329944_993_1817	274
260	3300039438	Ga0436360_1020421	Ga0436360_1020421_2361_3185	274
261	3300039447	Ga0436361_0702307	Ga0436361_0702307_965_1789	274
262	3300048903	Ga0496100_0372805	Ga0496100_0372805_204_1028	274
263	3300048904	Ga0496101_0546080	Ga0496101_0546080_32_856	274
264	3300048905	Ga0496102_0186864	Ga0496102_0186864_1048_1872	274
265	3300048908	Ga0496105_0136948	Ga0496105_0136948_59_907	274
266	3300048909	Ga0496106_0002037	Ga0496106_0002037_6979_7803	274
267	3300048909	Ga0496106_0054034	Ga0496106_0054034_655_1503	274
268	3300048910	Ga0496107_0000944	Ga0496107_0000944_9651_10475	274
269	3300048911	Ga0496108_0002514	Ga0496108_0002514_5891_6715	274
270	3300048911	Ga0496108_0194278	Ga0496108_0194278_861_1685	274
271	3300048912	Ga0496109_0000837	Ga0496109_0000837_7071_7895	274
272	3300048912	Ga0496109_0002524	Ga0496109_0002524_4741_5589	274
273	3300048912	Ga0496109_0347345	Ga0496109_0347345_506_1330	274
274	3300048912	Ga0496109_0691121	Ga0496109_0691121_62_907	274
275	3300048913	Ga0496110_0040462	Ga0496110_0040462_2760_3608	274
276	3300048913	Ga0496110_0116099	Ga0496110_0116099_1339_2163	274
277	3300048914	Ga0496111_0161845	Ga0496111_0161845_572_1420	274
278	3300048915	Ga0496112_0000505	Ga0496112_0000505_13369_14217	274
279	3300048915	Ga0496112_0026190	Ga0496112_0026190_3236_4081	274
280	3300048915	Ga0496112_0323355	Ga0496112_0323355_352_1176	274
281	3300048916	Ga0496113_0001614	Ga0496113_0001614_11524_12372	274
282	3300048916	Ga0496113_0040425	Ga0496113_0040425_1524_2348	274
283	3300048917	Ga0496114_0183535	Ga0496114_0183535_849_1673	274
284	3300048918	Ga0496115_0058457	Ga0496115_0058457_2172_2996	274
285	3300049581	Ga0501047_0062746	Ga0501047_0062746_1420_2244	274
286	3300049744	Ga0501083_0002347	Ga0501083_0002347_11479_12303	274
287	3300050512	nmdc:mga0n895_334666_c1	nmdc:mga0n895_334666_c1_122_946	274
288	3300060353	Ga0501082_0096455	Ga0501082_0096455_1453_2277	274
289	3300025272	Ga0209455_1009770	Ga0209455_10097703	275
290	3300026067	Ga0207678_10040716	Ga0207678_100407162	275
291	3300059640	Ga0587067_016010	Ga0587067_016010_135_965	275
292	3300003775	Ga0055524_1036498	Ga0055524_10364981	276
293	3300005327	Ga0070658_10001074	Ga0070658_100010749	276
294	3300005434	Ga0070709_10087472	Ga0070709_100874722	276
295	3300005548	Ga0070665_100002435	Ga0070665_10000243521	276
296	3300005577	Ga0068857_100094544	Ga0068857_1000945443	276
297	3300005616	Ga0068852_100000965	Ga0068852_10000096516	276
298	3300006028	Ga0070717_10218717	Ga0070717_102187172	276
299	3300006038	Ga0075365_10179227	Ga0075365_101792271	276
300	3300006038	Ga0075365_10232457	Ga0075365_102324572	276
301	3300006048	Ga0075363_100095845	Ga0075363_1000958452	276
302	3300006173	Ga0070716_100052309	Ga0070716_1000523092	276
303	3300006175	Ga0070712_100087202	Ga0070712_1000872021	276
304	3300006177	Ga0075362_10045525	Ga0075362_100455252	276
305	3300006178	Ga0075367_10055596	Ga0075367_100555962	276
306	3300006186	Ga0075369_10050175	Ga0075369_100501751	276
307	3300006846	Ga0075430_100217066	Ga0075430_1002170662	276
308	3300009011	Ga0105251_10134230	Ga0105251_101342301	276
309	3300009101	Ga0105247_10000054	Ga0105247_1000005421	276
310	3300009545	Ga0105237_10053547	Ga0105237_100535473	276
311	3300013306	Ga0163162_10251232	Ga0163162_102512321	276
312	3300025900	Ga0207710_10000123	Ga0207710_1000012320	276
313	3300025909	Ga0207705_10000066	Ga0207705_100000669	276
314	3300025914	Ga0207671_10047943	Ga0207671_100479432	276
315	3300025928	Ga0207700_10345098	Ga0207700_103450981	276
316	3300025939	Ga0207665_10007628	Ga0207665_100076282	276
317	3300026078	Ga0207702_10020574	Ga0207702_100205742	276
318	3300026078	Ga0207702_10402748	Ga0207702_104027482	276
319	3300026116	Ga0207674_10016307	Ga0207674_100163072	276
320	3300026142	Ga0207698_10000140	Ga0207698_100001406	276
321	3300027111	Ga0209281_1005133	Ga0209281_10051334	276
322	3300031901	Ga0307406_10035869	Ga0307406_100358691	276
323	3300041408	Ga0439453_0000118	Ga0439453_0000118_642_1472	276
324	3300042003	Ga0439443_000102	Ga0439443_000102_623_1453	276
325	3300042009	Ga0439451_018515	Ga0439451_018515_94_924	276
326	3300042013	Ga0439456_017094	Ga0439456_017094_490_1320	276
327	3300042126	Ga0450888_007640	Ga0450888_007640_319_1149	276
328	3300042436	Ga0439435_0000117	Ga0439435_0000117_8872_9702	276
329	3300042437	Ga0439444_0008984	Ga0439444_0008984_492_1322	276
330	3300042437	Ga0439444_0011777	Ga0439444_0011777_336_1166	276
331	3300042461	Ga0439460_0010410	Ga0439460_0010410_126_956	276
332	3300042461	Ga0439460_0031611	Ga0439460_0031611_225_1055	276
333	3300044658	Ga0466972_0002732	Ga0466972_0002732_7555_8436	276
334	3300044684	Ga0466966_0229491	Ga0466966_0229491_205_1086	276
335	3300044693	Ga0466961_0136864	Ga0466961_0136864_551_1432	276
336	3300044694	Ga0466963_0111738	Ga0466963_0111738_604_1485	276
337	3300044706	Ga0466964_0004938	Ga0466964_0004938_2487_3368	276
338	3300044842	Ga0466957_0085756	Ga0466957_0085756_708_1589	276
339	3300045836	Ga0466958_0010086	Ga0466958_0010086_1369_2250	276
340	3300045976	Ga0466967_0045408	Ga0466967_0045408_1413_2294	276
341	3300046525	Ga0495663_0000484	Ga0495663_0000484_8787_9617	276
342	3300049579	Ga0501043_0063646	Ga0501043_0063646_1844_2674	276
343	3300049585	Ga0501069_0241193	Ga0501069_0241193_78_908	276
344	3300050489	nmdc:mga03683_9183_c1	nmdc:mga03683_9183_c1_59_889	276
345	3300050492	nmdc:mga0yw44_45735_c1	nmdc:mga0yw44_45735_c1_865_1695	276
346	3300050494	nmdc:mga06z11_9377_c1	nmdc:mga06z11_9377_c1_562_1392	276
347	3300050516	nmdc:mga0sz30_5842_c1	nmdc:mga0sz30_5842_c1_76_906	276
348	3300061719	Ga0466962_0000483	Ga0466962_0000483_980_1861	276
349	3300039447	Ga0436361_0375049	Ga0436361_0375049_10910_11755	278
350	3300049823	Ga0501044_0000526	Ga0501044_0000526_33038_33988	286
351	3300047472	Ga0495686_0045482	Ga0495686_0045482_1547_2488	287
352	3300048924	Ga0496121_0007696	Ga0496121_0007696_5037_6026	291
353	3300005535	Ga0070684_100027122	Ga0070684_1000271222	292
354	3300009148	Ga0105243_10021142	Ga0105243_100211424	296
355	3300025303	Ga0209051_1000674	Ga0209051_100067428	296
356	3300053125	Ga0500618_037571	Ga0500618_037571_120_1067	301
357	3300009148	Ga0105243_10085488	Ga0105243_100854881	302
358	3300025935	Ga0207709_10023863	Ga0207709_100238634	302
359	3300005455	Ga0070663_100068849	Ga0070663_1000688491	312
360	3300005564	Ga0070664_100063713	Ga0070664_1000637131	312
361	3300005616	Ga0068852_100051218	Ga0068852_1000512182	312
362	3300005834	Ga0068851_10025185	Ga0068851_100251853	312
363	3300010375	Ga0105239_10237944	Ga0105239_102379442	312
364	3300025903	Ga0207680_10033291	Ga0207680_100332913	312
365	3300025941	Ga0207711_10341992	Ga0207711_103419922	312
366	3300026078	Ga0207702_10244488	Ga0207702_102444882	312
367	3300026088	Ga0207641_10149476	Ga0207641_101494761	312
368	3300035691	Ga0373931_0001735	Ga0373931_0001735_5860_6834	312
369	3300048928	Ga0496125_0073078	Ga0496125_0073078_1649_2626	312
370	3300050496	nmdc:mga07m45_2265_c1	nmdc:mga07m45_2265_c1_2834_3838	312
371	3300005262	Ga0065165_1000350	Ga0065165_100035060	316
372	3300048929	Ga0496126_0006560	Ga0496126_0006560_10602_11591	320
373	3300049574	Ga0501038_0073258	Ga0501038_0073258_1325_2311	320
374	3300002739	JGI25158J39367_1000509	JGI25158J39367_10005094	324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

82

321

0.89 PF12146

Hydrolase_4

Serine aminopeptidase, S33

81

319

0.84 PF00326

Peptidase_S9

Prolyl oligopeptidase family

207

334

0.78 PF12697

Abhydrolase_6

Alpha/beta hydrolase family

84

329

0.56 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1a88-assembly1.cif.gz_C	chloroperoxidase l	0.9941	51	324
1zoi-assembly1.cif.gz_B	crystal structure of a stereoselective esterase from pseudomonas putida ifo12996	0.9937	51	321
4dgq-assembly1.cif.gz_C	crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia	0.9904	48	324
1a8s-assembly1.cif.gz_A	chloroperoxidase f/propionate complex	0.9896	51	324
1a88-assembly1.cif.gz_C	chloroperoxidase l	0.9869	51	324

ID	Description	Score	Start	End	Superfamily
4dgqB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.9918	48	324	3.40.50.1820
4dgqB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.9883	48	324	3.40.50.1820
1va4B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.985	51	324	3.40.50.1820
1va4B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.9778	51	324	3.40.50.1820
1a8qA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.9711	51	324	3.40.50.1820

ID	Description	Score	Start	End	GO Terms
AF-A0A537P9P8-F1-model_v4	Alpha/beta hydrolase	1.005	51	126	GO:0016020 GO:0016787
AF-E6PXJ0-F1-model_v4	Putative peroxidase/hydrolase	0.9933	51	324	GO:0004601 GO:0016787
AF-A0A3G7BLC3-F1-model_v4	deleted	0.9932	51	324
AF-A0A3D0GG95-F1-model_v4	deleted	0.9922	77	324
AF-A0A098U7Z1-F1-model_v4	deleted	0.992	48	324

Feature Viewer

pLDDT	pTM	Quality
87.57	0.83	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F426877

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

82

321

0.89

PF12146

Hydrolase_4

Serine aminopeptidase, S33

81

319

0.84

PF00326

Peptidase_S9

Prolyl oligopeptidase family

207

334

0.78

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

84

329

0.56

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map