F426867

General Info

Members Datasets Scaffolds Average Seq Length
374 225 748 128

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_1403199|Ga0501048_1403199_56_484
Length 142
Sequence VHALPPLEQGRQGRLIMRQAVSSPSAPRAIGPYSQAIRAGSLLFLSGQIPIDPATGDLVPGDIAAQTHRVFQNLGAILEAAGLSFDHVVRTTVYLADMNDFAAMNEVYGTYFSSPAPARATVQAARLPKDARVEIDLIASLT

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
167 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
190 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
191 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
192 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
193 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
197 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 1.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 5.35
Rhizosphere 88.77
Stem 0
Stem Tuber 0
Unclassified 21.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_1403199 3300049582 Bacteria 502
2 JGI24743J22301_10101078 3300001991 Unclassified 621
3 JGI24744J21845_10099833 3300002077 Bacteria 535
4 Ga0058863_11303963 3300004799 Bacteria 639
5 Ga0065712_10078950 3300005290 Bacteria 3278
6 Ga0065715_10162047 3300005293 Bacteria 1620
7 Ga0070683_100087483 3300005329 Bacteria 2922
8 Ga0070683_100165345 3300005329 Unclassified 2099
9 Ga0070670_100120526 3300005331 Bacteria 2263
10 Ga0068869_101114159 3300005334 Bacteria 691
11 Ga0068869_101739939 3300005334 Bacteria 557
12 Ga0070666_10070725 3300005335 Bacteria 2374
13 Ga0070680_100145249 3300005336 Bacteria 1990
14 Ga0070680_100778666 3300005336 Bacteria 824
15 Ga0070680_101351875 3300005336 Unclassified 617
16 Ga0070661_101165039 3300005344 Bacteria 644
17 Ga0070661_101313408 3300005344 Bacteria 607
18 Ga0070669_100792716 3300005353 Bacteria 805
19 Ga0070675_101238443 3300005354 Bacteria 687
20 Ga0070671_100143438 3300005355 Bacteria 2016
21 Ga0070671_100666581 3300005355 Bacteria 901
22 Ga0070709_10013085 3300005434 Bacteria 4657
23 Ga0070709_10125778 3300005434 Bacteria 1744
24 Ga0070709_10746830 3300005434 Unclassified 764
25 Ga0070709_11208787 3300005434 Unclassified 608
26 Ga0070714_100101391 3300005435 Unclassified 2536
27 Ga0070714_100144326 3300005435 Bacteria 2140
28 Ga0070714_100548387 3300005435 Unclassified 1107
29 Ga0070714_101529891 3300005435 Unclassified 652
30 Ga0070713_100042754 3300005436 Bacteria 3700
31 Ga0070713_100109664 3300005436 Bacteria 2405
32 Ga0070713_100136384 3300005436 Bacteria 2169
33 Ga0070713_100263849 3300005436 Bacteria 1575
34 Ga0070710_10011818 3300005437 Bacteria 4324
35 Ga0070710_10444420 3300005437 Bacteria 878
36 Ga0070711_100136197 3300005439 Bacteria 1836
37 Ga0070711_100853025 3300005439 Unclassified 775
38 Ga0070711_101230814 3300005439 Unclassified 648
39 Ga0070678_100151051 3300005456 Bacteria 1871
40 Ga0070678_100348323 3300005456 Unclassified 1273
41 Ga0070678_101161380 3300005456 Bacteria 715
42 Ga0070681_10317257 3300005458 Bacteria 1468
43 Ga0070685_10792856 3300005466 Bacteria 698
44 Ga0070699_100326432 3300005518 Bacteria 1380
45 Ga0070679_100542037 3300005530 Bacteria 1107
46 Ga0070684_100599735 3300005535 Bacteria 1024
47 Ga0068853_100005890 3300005539 Bacteria 9667
48 Ga0070672_100562026 3300005543 Bacteria 991
49 Ga0070664_100747801 3300005564 Bacteria 912
50 Ga0068854_100500518 3300005578 Bacteria 1023
51 Ga0068854_101097446 3300005578 Bacteria 709
52 Ga0068854_101097924 3300005578 Unclassified 709
53 Ga0068856_100647979 3300005614 Bacteria 1077
54 Ga0068856_101957581 3300005614 Unclassified 597
55 Ga0070702_100118386 3300005615 Unclassified 1654
56 Ga0068852_100292056 3300005616 Unclassified 1575
57 Ga0068852_100945308 3300005616 Unclassified 880
58 Ga0068866_10914295 3300005718 Unclassified 618
59 Ga0068860_101720456 3300005843 Bacteria 649
60 Ga0081455_10010865 3300005937 Bacteria 9189
61 Ga0081455_10021194 3300005937 Bacteria 6103
62 Ga0081455_10256604 3300005937 Bacteria 1275
63 Ga0081540_1141449 3300005983 Unclassified 965
64 Ga0081539_10018683 3300005985 Unclassified 4793
65 Ga0070717_10957233 3300006028 Unclassified 780
66 Ga0075365_10002393 3300006038 Bacteria 9176
67 Ga0075365_11216215 3300006038 Bacteria 530
68 Ga0075368_10034301 3300006042 Bacteria 1977
69 Ga0075364_10075590 3300006051 Unclassified 2223
70 Ga0075364_10648251 3300006051 Bacteria 721
71 Ga0075432_10006201 3300006058 Bacteria 4065
72 Ga0070715_10017008 3300006163 Bacteria 2745
73 Ga0070716_100001033 3300006173 Bacteria 12184
74 Ga0070716_100431454 3300006173 Unclassified 956
75 Ga0070712_100032432 3300006175 Bacteria 3528
76 Ga0070712_100111817 3300006175 Bacteria 2040
77 Ga0075367_10004114 3300006178 Bacteria 7050
78 Ga0075366_10010204 3300006195 Bacteria 5270
79 Ga0097621_101016491 3300006237 Bacteria 776
80 Ga0075370_10122778 3300006353 Bacteria 1513
81 Ga0075428_100070378 3300006844 Unclassified 3824
82 Ga0075428_100182902 3300006844 Bacteria 2268
83 Ga0075428_100421153 3300006844 Bacteria 1431
84 Ga0075428_102104794 3300006844 Bacteria 583
85 Ga0075430_100001102 3300006846 Bacteria 21482
86 Ga0075430_100014824 3300006846 Bacteria 6637
87 Ga0075430_100457829 3300006846 Bacteria 1053
88 Ga0075431_100011438 3300006847 Bacteria 8942
89 Ga0075431_100012511 3300006847 Bacteria 8567
90 Ga0075431_100430970 3300006847 Bacteria 1317
91 Ga0075431_100503937 3300006847 Bacteria 1201
92 Ga0075431_100840529 3300006847 Unclassified 890
93 Ga0075434_102058228 3300006871 Unclassified 576
94 Ga0075429_100102395 3300006880 Bacteria 2500
95 Ga0075429_100160246 3300006880 Bacteria 1970
96 Ga0068865_100267120 3300006881 Unclassified 1357
97 Ga0105240_10015721 3300009093 Bacteria 10271
98 Ga0111539_10400880 3300009094 Bacteria 1598
99 Ga0111539_11005549 3300009094 Bacteria 969
100 Ga0111539_13030450 3300009094 Bacteria 543
101 Ga0105245_12437642 3300009098 Bacteria 577
102 Ga0114129_10012880 3300009147 Bacteria 11901
103 Ga0114129_10185027 3300009147 Bacteria 2832
104 Ga0114129_10886583 3300009147 Bacteria 1131
105 Ga0114129_12660084 3300009147 Bacteria 596
106 Ga0105241_11872635 3300009174 Bacteria 587
107 Ga0105238_11542894 3300009551 Unclassified 693
108 Ga0105239_11403311 3300010375 Bacteria 806
109 Ga0157373_10030743 3300013100 Bacteria 3864
110 Ga0157369_10090552 3300013105 Unclassified 3266
111 Ga0157369_10276539 3300013105 Bacteria 1749
112 Ga0157374_12360941 3300013296 Bacteria 559
113 Ga0157372_10159225 3300013307 Bacteria 2608
114 Ga0157375_10086987 3300013308 Unclassified 3177
115 Ga0163163_10148114 3300014325 Bacteria 2391
116 Ga0157380_10125351 3300014326 Bacteria 2182
117 Ga0157379_10085650 3300014968 Unclassified 2825
118 Ga0157376_10432685 3300014969 Bacteria 1279
119 Ga0163161_10176204 3300017792 Unclassified 1637
120 Ga0206356_10418613 3300020070 Bacteria 686
121 Ga0206354_11419322 3300020081 Bacteria 806
122 Ga0206353_11378470 3300020082 Bacteria 955
123 Ga0207697_10000308 3300025315 Bacteria 27391
124 Ga0207656_10735126 3300025321 Bacteria 506
125 Ga0207692_10020692 3300025898 Bacteria 2998
126 Ga0207642_10650478 3300025899 Bacteria 660
127 Ga0207710_10200028 3300025900 Bacteria 986
128 Ga0207688_10024819 3300025901 Bacteria 3288
129 Ga0207680_10011098 3300025903 Bacteria 4538
130 Ga0207685_10002638 3300025905 Bacteria 4160
131 Ga0207699_10305623 3300025906 Bacteria 1112
132 Ga0207699_10769369 3300025906 Unclassified 707
133 Ga0207707_10610485 3300025912 Bacteria 922
134 Ga0207693_10109841 3300025915 Bacteria 2163
135 Ga0207693_10266827 3300025915 Unclassified 1342
136 Ga0207693_10287191 3300025915 Bacteria 1289
137 Ga0207663_10271396 3300025916 Bacteria 1257
138 Ga0207663_10769414 3300025916 Unclassified 765
139 Ga0207663_10860482 3300025916 Unclassified 724
140 Ga0207660_11260640 3300025917 Unclassified 601
141 Ga0207649_11016951 3300025920 Bacteria 652
142 Ga0207652_10898687 3300025921 Unclassified 782
143 Ga0207681_11162911 3300025923 Bacteria 648
144 Ga0207650_10783931 3300025925 Bacteria 807
145 Ga0207700_10048424 3300025928 Bacteria 3156
146 Ga0207700_10125659 3300025928 Bacteria 2087
147 Ga0207664_10009401 3300025929 Bacteria 6860
148 Ga0207664_10279227 3300025929 Bacteria 1465
149 Ga0207664_10348495 3300025929 Bacteria 1310
150 Ga0207664_11523010 3300025929 Unclassified 590
151 Ga0207706_10724268 3300025933 Unclassified 849
152 Ga0207665_10000404 3300025939 Bacteria 29715
153 Ga0207665_10423567 3300025939 Unclassified 1017
154 Ga0207691_10388393 3300025940 Bacteria 1191
155 Ga0207661_11755196 3300025944 Bacteria 566
156 Ga0207679_11263231 3300025945 Unclassified 678
157 Ga0207651_10861228 3300025960 Unclassified 806
158 Ga0207640_10582594 3300025981 Bacteria 945
159 Ga0207677_10615450 3300026023 Bacteria 954
160 Ga0207639_10134699 3300026041 Bacteria 2050
161 Ga0207702_10982305 3300026078 Bacteria 837
162 Ga0207683_10728625 3300026121 Bacteria 920
163 Ga0207698_10878602 3300026142 Unclassified 903
164 Ga0207698_12261556 3300026142 Bacteria 556
165 Ga0209813_10102429 3300027866 Bacteria 976
166 Ga0207428_10001649 3300027907 Bacteria 23211
167 Ga0307408_100035849 3300031548 Bacteria 3483
168 Ga0307408_100104928 3300031548 Bacteria 2160
169 Ga0307408_100253088 3300031548 Bacteria 1454
170 Ga0307405_10010251 3300031731 Bacteria 4844
171 Ga0307405_10617410 3300031731 Bacteria 887
172 Ga0307405_11806013 3300031731 Bacteria 544
173 Ga0307413_10279945 3300031824 Bacteria 1254
174 Ga0307413_10318551 3300031824 Bacteria 1187
175 Ga0307410_10141772 3300031852 Bacteria 1779
176 Ga0307410_10229408 3300031852 Bacteria 1433
177 Ga0307410_10454718 3300031852 Bacteria 1045
178 Ga0307410_10673764 3300031852 Bacteria 869
179 Ga0307410_11256830 3300031852 Bacteria 646
180 Ga0307406_10242097 3300031901 Bacteria 1354
181 Ga0307406_10905424 3300031901 Unclassified 751
182 Ga0307406_11531370 3300031901 Bacteria 587
183 Ga0307407_10288154 3300031903 Bacteria 1140
184 Ga0307407_10670021 3300031903 Bacteria 779
185 Ga0307412_10009341 3300031911 Bacteria 5624
186 Ga0307412_10749564 3300031911 Bacteria 843
187 Ga0307409_100253021 3300031995 Bacteria 1612
188 Ga0307409_100920085 3300031995 Bacteria 889
189 Ga0307409_101149916 3300031995 Bacteria 798
190 Ga0307409_101264613 3300031995 Bacteria 762
191 Ga0307416_100010811 3300032002 Bacteria 6048
192 Ga0307416_100026392 3300032002 Bacteria 4280
193 Ga0307416_100169364 3300032002 Bacteria 2031
194 Ga0307416_100466636 3300032002 Bacteria 1319
195 Ga0307414_11603668 3300032004 Unclassified 606
196 Ga0307411_10116255 3300032005 Bacteria 1925
197 Ga0307411_10537866 3300032005 Bacteria 995
198 Ga0307411_10891906 3300032005 Bacteria 789
199 Ga0307415_100098640 3300032126 Bacteria 2136
200 Ga0307415_100404637 3300032126 Bacteria 1166
201 Ga0307415_100829882 3300032126 Bacteria 846
202 Ga0373931_0153596 3300035691 Bacteria 1344
203 Ga0373931_0263000 3300035691 Unclassified 1053
204 Ga0373935_0484621 3300035692 Bacteria 896
205 Ga0373927_0722505 3300035695 Bacteria 658
206 Ga0373947_0240275 3300035725 Bacteria 1195
207 Ga0373937_0560819 3300036401 Bacteria 1085
208 Ga0373925_0082808 3300037068 Unclassified 2443
209 Ga0395905_0260639 3300037471 Unclassified 1619
210 Ga0436364_0297898 3300037853 Unclassified 1000
211 Ga0242420_002369 3300038996 Bacteria 2680
212 Ga0436365_0366900 3300039437 Bacteria 939
213 Ga0436360_0947621 3300039438 Bacteria 1271
214 Ga0436363_0648363 3300039450 Bacteria 1892
215 Ga0451802_0698006 3300041460 Bacteria 559
216 Ga0451802_1169741 3300041460 Bacteria 531
217 Ga0451849_0297167 3300041505 Unclassified 675
218 Ga0451853_1211625 3300041512 Bacteria 612
219 Ga0439433_0073150 3300041999 Bacteria 827
220 Ga0439445_0161272 3300042004 Bacteria 655
221 Ga0439449_0351159 3300042007 Bacteria 558
222 Ga0439450_015362 3300042008 Unclassified 1566
223 Ga0439457_013619 3300042014 Bacteria 1827
224 Ga0439446_0013223 3300042156 Bacteria 2263
225 Ga0439446_0177816 3300042156 Bacteria 710
226 Ga0439434_0076226 3300042435 Bacteria 1060
227 Ga0439435_0192946 3300042436 Bacteria 669
228 Ga0439435_0234991 3300042436 Unclassified 613
229 Ga0439444_0133279 3300042437 Unclassified 589
230 Ga0439464_0006333 3300042439 Bacteria 3080
231 Ga0439464_0214876 3300042439 Bacteria 616
232 Ga0453683_0147374 3300044673 Bacteria 1486
233 Ga0453683_0861297 3300044673 Bacteria 598
234 Ga0453684_0640755 3300044712 Bacteria 1160
235 Ga0466971_0657787 3300044719 Unclassified 525
236 Ga0466957_0564561 3300044842 Unclassified 794
237 Ga0466959_0450263 3300045049 Unclassified 873
238 Ga0451576_2553775 3300045051 Unclassified 521
239 Ga0495603_0094348 3300046455 Bacteria 1748
240 Ga0495603_0510161 3300046455 Unclassified 689
241 Ga0495580_0008570 3300046472 Bacteria 8113
242 Ga0495580_0216077 3300046472 Bacteria 1318
243 Ga0495580_0982679 3300046472 Bacteria 539
244 Ga0495639_0203705 3300046475 Bacteria 969
245 Ga0496104_0000253 3300048907 Bacteria 47525
246 Ga0496104_0002085 3300048907 Bacteria 17343
247 Ga0496105_0012062 3300048908 Bacteria 6842
248 Ga0496105_0317909 3300048908 Bacteria 1248
249 Ga0496106_0195280 3300048909 Unclassified 1610
250 Ga0496106_0540580 3300048909 Bacteria 935
251 Ga0496107_0489665 3300048910 Bacteria 912
252 Ga0496108_0042524 3300048911 Bacteria 3794
253 Ga0496108_0065279 3300048911 Bacteria 3068
254 Ga0496109_0679501 3300048912 Unclassified 967
255 Ga0496110_0315592 3300048913 Bacteria 1423
256 Ga0496110_0699720 3300048913 Bacteria 915
257 Ga0496112_0233190 3300048915 Bacteria 1795
258 Ga0496114_0497754 3300048917 Bacteria 1078
259 Ga0496114_0917853 3300048917 Unclassified 757
260 Ga0496115_0094322 3300048918 Bacteria 2448
261 Ga0496115_0119080 3300048918 Bacteria 2172
262 Ga0496115_1109193 3300048918 Unclassified 599
263 Ga0501292_004556 3300049515 Bacteria 1899
264 Ga0501299_002713 3300049522 Bacteria 2479
265 Ga0501031_0052557 3300049568 Bacteria 2655
266 Ga0501032_0167600 3300049569 Bacteria 1441
267 Ga0501033_0018008 3300049570 Bacteria 5334
268 Ga0501034_0034078 3300049571 Bacteria 5162
269 Ga0501036_0522371 3300049572 Bacteria 987
270 Ga0501037_0260518 3300049573 Bacteria 1212
271 Ga0501037_0293287 3300049573 Bacteria 1131
272 Ga0501038_0177991 3300049574 Bacteria 1718
273 Ga0501039_0108876 3300049575 Bacteria 2166
274 Ga0501039_0998913 3300049575 Bacteria 650
275 Ga0501039_1047238 3300049575 Unclassified 633
276 Ga0501040_0029948 3300049576 Bacteria 3674
277 Ga0501040_0049041 3300049576 Bacteria 2887
278 Ga0501040_1178795 3300049576 Bacteria 556
279 Ga0501041_0110446 3300049577 Bacteria 1706
280 Ga0501041_0202028 3300049577 Bacteria 1246
281 Ga0501042_0168427 3300049578 Bacteria 1581
282 Ga0501042_1177409 3300049578 Bacteria 559
283 Ga0501042_1394911 3300049578 Bacteria 511
284 Ga0501043_0045528 3300049579 Bacteria 3451
285 Ga0501043_0537426 3300049579 Bacteria 870
286 Ga0501046_0015710 3300049580 Bacteria 6354
287 Ga0501046_0034361 3300049580 Bacteria 4092
288 Ga0501046_0194433 3300049580 Bacteria 1512
289 Ga0501046_0279826 3300049580 Bacteria 1222
290 Ga0501046_0830361 3300049580 Bacteria 647
291 Ga0501047_0165302 3300049581 Bacteria 2083
292 Ga0501048_0139669 3300049582 Bacteria 1713
293 Ga0501048_0826383 3300049582 Bacteria 666
294 Ga0501048_1077696 3300049582 Bacteria 578
295 Ga0501068_0614621 3300049584 Bacteria 709
296 Ga0501071_0061999 3300049587 Bacteria 2709
297 Ga0501071_0098089 3300049587 Unclassified 2158
298 Ga0501071_0267465 3300049587 Bacteria 1292
299 Ga0501071_0822610 3300049587 Bacteria 716
300 Ga0501071_0834298 3300049587 Bacteria 711
301 Ga0501071_0904855 3300049587 Unclassified 681
302 Ga0501072_0112453 3300049588 Bacteria 2168
303 Ga0501072_0425488 3300049588 Bacteria 1052
304 Ga0501073_0159005 3300049589 Unclassified 1566
305 Ga0501075_0004054 3300049591 Bacteria 9885
306 Ga0501075_0008401 3300049591 Bacteria 7202
307 Ga0501075_0089344 3300049591 Bacteria 2336
308 Ga0501075_0101061 3300049591 Bacteria 2190
309 Ga0501076_0190530 3300049592 Unclassified 1673
310 Ga0501077_0129999 3300049593 Unclassified 1597
311 Ga0501077_1006647 3300049593 Bacteria 536
312 Ga0501217_047320 3300049661 Bacteria 1113
313 Ga0501252_026711 3300049682 Bacteria 783
314 Ga0501261_010543 3300049690 Bacteria 1219
315 Ga0501221_037035 3300049704 Bacteria 1048
316 Ga0501234_024886 3300049707 Bacteria 960
317 Ga0501079_0061722 3300049741 Unclassified 2891
318 Ga0501079_0185628 3300049741 Bacteria 1623
319 Ga0501079_0228711 3300049741 Bacteria 1453
320 Ga0501079_1093994 3300049741 Unclassified 628
321 Ga0501079_1572464 3300049741 Bacteria 517
322 Ga0501081_0143827 3300049743 Bacteria 1710
323 Ga0501081_0790791 3300049743 Bacteria 714
324 Ga0501081_1164336 3300049743 Unclassified 584
325 Ga0501081_1504094 3300049743 Unclassified 511
326 Ga0501279_015579 3300049775 Bacteria 1054
327 Ga0501283_047315 3300049779 Bacteria 756
328 Ga0501035_0359327 3300049822 Bacteria 1217
329 Ga0501044_0060833 3300049823 Bacteria 3865
330 Ga0501045_0001215 3300049824 Bacteria 17156
331 nmdc:mga03683_7692_c1 3300050489 Unclassified 3050
332 nmdc:mga0yw44_2671_c1 3300050492 Bacteria 7691
333 nmdc:mga0yw44_794787_c1 3300050492 Bacteria 642
334 nmdc:mga05p37_213670_c1 3300050507 Unclassified 2330
335 nmdc:mga05p37_245493_c1 3300050507 Bacteria 2150
336 nmdc:mga05p37_359291_c1 3300050507 Bacteria 1713
337 nmdc:mga05p37_370833_c1 3300050507 Bacteria 1680
338 nmdc:mga09592_756944_c1 3300050508 Bacteria 824
339 nmdc:mga09592_88438_c1 3300050508 Bacteria 2646
340 nmdc:mga09592_929020_c1 3300050508 Bacteria 730
341 nmdc:mga0qj67_45497_c1 3300050509 Bacteria 3464
342 nmdc:mga0qj67_461443_c1 3300050509 Bacteria 1023
343 nmdc:mga06r32_280443_c1 3300050510 Bacteria 1653
344 nmdc:mga06r32_38678_c1 3300050510 Bacteria 4522
345 nmdc:mga06r32_83793_c1 3300050510 Unclassified 3107
346 nmdc:mga08y16_349909_c1 3300050511 Bacteria 1518
347 nmdc:mga08y16_523258_c1 3300050511 Bacteria 1203
348 nmdc:mga08x19_871457_c1 3300050514 Unclassified 640
349 nmdc:mga0a205_840972_c1 3300050515 Bacteria 765
350 Ga0495601_0412756 3300053077 Unclassified 875
351 Ga0495595_0152285 3300053084 Unclassified 1138
352 Ga0495619_0159621 3300053085 Bacteria 1557
353 Ga0495619_0214469 3300053085 Bacteria 1333
354 Ga0500646_0148982 3300053090 Bacteria 773
355 Ga0500562_073525 3300053108 Bacteria 923
356 Ga0500628_001620 3300053129 Bacteria 3813
357 Ga0500652_019641 3300053131 Bacteria 2514
358 Ga0500645_000050 3300053730 Bacteria 99596
359 Ga0501084_0099587 3300054114 Bacteria 2441
360 Ga0501084_0232595 3300054114 Bacteria 1556
361 Ga0501084_0383356 3300054114 Unclassified 1188
362 Ga0590075_212194 3300059424 Bacteria 513
363 Ga0590077_104383 3300059426 Bacteria 664
364 Ga0590077_148133 3300059426 Bacteria 561
365 Ga0587090_052122 3300059510 Bacteria 753
366 Ga0587091_081554 3300059511 Bacteria 727
367 Ga0587106_034632 3300059605 Bacteria 828
368 Ga0501082_0108430 3300060353 Bacteria 2403
369 Ga0501082_0362095 3300060353 Bacteria 1265
370 Ga0501082_0769975 3300060353 Bacteria 842
371 Ga0530510_0008472 3300061734 Bacteria 7171
372 Ga0530510_0550401 3300061734 Bacteria 876
373 Ga0530510_1016687 3300061734 Unclassified 634
374 Ga0530510_1247200 3300061734 Unclassified 570
375 Ga0501048_1403199
376 JGI24743J22301_10101078
377 JGI24744J21845_10099833
378 Ga0058863_11303963
379 Ga0065712_10078950
380 Ga0065715_10162047
381 Ga0070683_100087483
382 Ga0070683_100165345
383 Ga0070670_100120526
384 Ga0068869_101114159
385 Ga0068869_101739939
386 Ga0070666_10070725
387 Ga0070680_100145249
388 Ga0070680_100778666
389 Ga0070680_101351875
390 Ga0070661_101165039
391 Ga0070661_101313408
392 Ga0070669_100792716
393 Ga0070675_101238443
394 Ga0070671_100143438
395 Ga0070671_100666581
396 Ga0070709_10013085
397 Ga0070709_10125778
398 Ga0070709_10746830
399 Ga0070709_11208787
400 Ga0070714_100101391
401 Ga0070714_100144326
402 Ga0070714_100548387
403 Ga0070714_101529891
404 Ga0070713_100042754
405 Ga0070713_100109664
406 Ga0070713_100136384
407 Ga0070713_100263849
408 Ga0070710_10011818
409 Ga0070710_10444420
410 Ga0070711_100136197
411 Ga0070711_100853025
412 Ga0070711_101230814
413 Ga0070678_100151051
414 Ga0070678_100348323
415 Ga0070678_101161380
416 Ga0070681_10317257
417 Ga0070685_10792856
418 Ga0070699_100326432
419 Ga0070679_100542037
420 Ga0070684_100599735
421 Ga0068853_100005890
422 Ga0070672_100562026
423 Ga0070664_100747801
424 Ga0068854_100500518
425 Ga0068854_101097446
426 Ga0068854_101097924
427 Ga0068856_100647979
428 Ga0068856_101957581
429 Ga0070702_100118386
430 Ga0068852_100292056
431 Ga0068852_100945308
432 Ga0068866_10914295
433 Ga0068860_101720456
434 Ga0081455_10010865
435 Ga0081455_10021194
436 Ga0081455_10256604
437 Ga0081540_1141449
438 Ga0081539_10018683
439 Ga0070717_10957233
440 Ga0075365_10002393
441 Ga0075365_11216215
442 Ga0075368_10034301
443 Ga0075364_10075590
444 Ga0075364_10648251
445 Ga0075432_10006201
446 Ga0070715_10017008
447 Ga0070716_100001033
448 Ga0070716_100431454
449 Ga0070712_100032432
450 Ga0070712_100111817
451 Ga0075367_10004114
452 Ga0075366_10010204
453 Ga0097621_101016491
454 Ga0075370_10122778
455 Ga0075428_100070378
456 Ga0075428_100182902
457 Ga0075428_100421153
458 Ga0075428_102104794
459 Ga0075430_100001102
460 Ga0075430_100014824
461 Ga0075430_100457829
462 Ga0075431_100011438
463 Ga0075431_100012511
464 Ga0075431_100430970
465 Ga0075431_100503937
466 Ga0075431_100840529
467 Ga0075434_102058228
468 Ga0075429_100102395
469 Ga0075429_100160246
470 Ga0068865_100267120
471 Ga0105240_10015721
472 Ga0111539_10400880
473 Ga0111539_11005549
474 Ga0111539_13030450
475 Ga0105245_12437642
476 Ga0114129_10012880
477 Ga0114129_10185027
478 Ga0114129_10886583
479 Ga0114129_12660084
480 Ga0105241_11872635
481 Ga0105238_11542894
482 Ga0105239_11403311
483 Ga0157373_10030743
484 Ga0157369_10090552
485 Ga0157369_10276539
486 Ga0157374_12360941
487 Ga0157372_10159225
488 Ga0157375_10086987
489 Ga0163163_10148114
490 Ga0157380_10125351
491 Ga0157379_10085650
492 Ga0157376_10432685
493 Ga0163161_10176204
494 Ga0206356_10418613
495 Ga0206354_11419322
496 Ga0206353_11378470
497 Ga0207697_10000308
498 Ga0207656_10735126
499 Ga0207692_10020692
500 Ga0207642_10650478
501 Ga0207710_10200028
502 Ga0207688_10024819
503 Ga0207680_10011098
504 Ga0207685_10002638
505 Ga0207699_10305623
506 Ga0207699_10769369
507 Ga0207707_10610485
508 Ga0207693_10109841
509 Ga0207693_10266827
510 Ga0207693_10287191
511 Ga0207663_10271396
512 Ga0207663_10769414
513 Ga0207663_10860482
514 Ga0207660_11260640
515 Ga0207649_11016951
516 Ga0207652_10898687
517 Ga0207681_11162911
518 Ga0207650_10783931
519 Ga0207700_10048424
520 Ga0207700_10125659
521 Ga0207664_10009401
522 Ga0207664_10279227
523 Ga0207664_10348495
524 Ga0207664_11523010
525 Ga0207706_10724268
526 Ga0207665_10000404
527 Ga0207665_10423567
528 Ga0207691_10388393
529 Ga0207661_11755196
530 Ga0207679_11263231
531 Ga0207651_10861228
532 Ga0207640_10582594
533 Ga0207677_10615450
534 Ga0207639_10134699
535 Ga0207702_10982305
536 Ga0207683_10728625
537 Ga0207698_10878602
538 Ga0207698_12261556
539 Ga0209813_10102429
540 Ga0207428_10001649
541 Ga0307408_100035849
542 Ga0307408_100104928
543 Ga0307408_100253088
544 Ga0307405_10010251
545 Ga0307405_10617410
546 Ga0307405_11806013
547 Ga0307413_10279945
548 Ga0307413_10318551
549 Ga0307410_10141772
550 Ga0307410_10229408
551 Ga0307410_10454718
552 Ga0307410_10673764
553 Ga0307410_11256830
554 Ga0307406_10242097
555 Ga0307406_10905424
556 Ga0307406_11531370
557 Ga0307407_10288154
558 Ga0307407_10670021
559 Ga0307412_10009341
560 Ga0307412_10749564
561 Ga0307409_100253021
562 Ga0307409_100920085
563 Ga0307409_101149916
564 Ga0307409_101264613
565 Ga0307416_100010811
566 Ga0307416_100026392
567 Ga0307416_100169364
568 Ga0307416_100466636
569 Ga0307414_11603668
570 Ga0307411_10116255
571 Ga0307411_10537866
572 Ga0307411_10891906
573 Ga0307415_100098640
574 Ga0307415_100404637
575 Ga0307415_100829882
576 Ga0373931_0153596
577 Ga0373931_0263000
578 Ga0373935_0484621
579 Ga0373927_0722505
580 Ga0373947_0240275
581 Ga0373937_0560819
582 Ga0373925_0082808
583 Ga0395905_0260639
584 Ga0436364_0297898
585 Ga0242420_002369
586 Ga0436365_0366900
587 Ga0436360_0947621
588 Ga0436363_0648363
589 Ga0451802_0698006
590 Ga0451802_1169741
591 Ga0451849_0297167
592 Ga0451853_1211625
593 Ga0439433_0073150
594 Ga0439445_0161272
595 Ga0439449_0351159
596 Ga0439450_015362
597 Ga0439457_013619
598 Ga0439446_0013223
599 Ga0439446_0177816
600 Ga0439434_0076226
601 Ga0439435_0192946
602 Ga0439435_0234991
603 Ga0439444_0133279
604 Ga0439464_0006333
605 Ga0439464_0214876
606 Ga0453683_0147374
607 Ga0453683_0861297
608 Ga0453684_0640755
609 Ga0466971_0657787
610 Ga0466957_0564561
611 Ga0466959_0450263
612 Ga0451576_2553775
613 Ga0495603_0094348
614 Ga0495603_0510161
615 Ga0495580_0008570
616 Ga0495580_0216077
617 Ga0495580_0982679
618 Ga0495639_0203705
619 Ga0496104_0000253
620 Ga0496104_0002085
621 Ga0496105_0012062
622 Ga0496105_0317909
623 Ga0496106_0195280
624 Ga0496106_0540580
625 Ga0496107_0489665
626 Ga0496108_0042524
627 Ga0496108_0065279
628 Ga0496109_0679501
629 Ga0496110_0315592
630 Ga0496110_0699720
631 Ga0496112_0233190
632 Ga0496114_0497754
633 Ga0496114_0917853
634 Ga0496115_0094322
635 Ga0496115_0119080
636 Ga0496115_1109193
637 Ga0501292_004556
638 Ga0501299_002713
639 Ga0501031_0052557
640 Ga0501032_0167600
641 Ga0501033_0018008
642 Ga0501034_0034078
643 Ga0501036_0522371
644 Ga0501037_0260518
645 Ga0501037_0293287
646 Ga0501038_0177991
647 Ga0501039_0108876
648 Ga0501039_0998913
649 Ga0501039_1047238
650 Ga0501040_0029948
651 Ga0501040_0049041
652 Ga0501040_1178795
653 Ga0501041_0110446
654 Ga0501041_0202028
655 Ga0501042_0168427
656 Ga0501042_1177409
657 Ga0501042_1394911
658 Ga0501043_0045528
659 Ga0501043_0537426
660 Ga0501046_0015710
661 Ga0501046_0034361
662 Ga0501046_0194433
663 Ga0501046_0279826
664 Ga0501046_0830361
665 Ga0501047_0165302
666 Ga0501048_0139669
667 Ga0501048_0826383
668 Ga0501048_1077696
669 Ga0501068_0614621
670 Ga0501071_0061999
671 Ga0501071_0098089
672 Ga0501071_0267465
673 Ga0501071_0822610
674 Ga0501071_0834298
675 Ga0501071_0904855
676 Ga0501072_0112453
677 Ga0501072_0425488
678 Ga0501073_0159005
679 Ga0501075_0004054
680 Ga0501075_0008401
681 Ga0501075_0089344
682 Ga0501075_0101061
683 Ga0501076_0190530
684 Ga0501077_0129999
685 Ga0501077_1006647
686 Ga0501217_047320
687 Ga0501252_026711
688 Ga0501261_010543
689 Ga0501221_037035
690 Ga0501234_024886
691 Ga0501079_0061722
692 Ga0501079_0185628
693 Ga0501079_0228711
694 Ga0501079_1093994
695 Ga0501079_1572464
696 Ga0501081_0143827
697 Ga0501081_0790791
698 Ga0501081_1164336
699 Ga0501081_1504094
700 Ga0501279_015579
701 Ga0501283_047315
702 Ga0501035_0359327
703 Ga0501044_0060833
704 Ga0501045_0001215
705 nmdc:mga03683_7692_c1
706 nmdc:mga0yw44_2671_c1
707 nmdc:mga0yw44_794787_c1
708 nmdc:mga05p37_213670_c1
709 nmdc:mga05p37_245493_c1
710 nmdc:mga05p37_359291_c1
711 nmdc:mga05p37_370833_c1
712 nmdc:mga09592_756944_c1
713 nmdc:mga09592_88438_c1
714 nmdc:mga09592_929020_c1
715 nmdc:mga0qj67_45497_c1
716 nmdc:mga0qj67_461443_c1
717 nmdc:mga06r32_280443_c1
718 nmdc:mga06r32_38678_c1
719 nmdc:mga06r32_83793_c1
720 nmdc:mga08y16_349909_c1
721 nmdc:mga08y16_523258_c1
722 nmdc:mga08x19_871457_c1
723 nmdc:mga0a205_840972_c1
724 Ga0495601_0412756
725 Ga0495595_0152285
726 Ga0495619_0159621
727 Ga0495619_0214469
728 Ga0500646_0148982
729 Ga0500562_073525
730 Ga0500628_001620
731 Ga0500652_019641
732 Ga0500645_000050
733 Ga0501084_0099587
734 Ga0501084_0232595
735 Ga0501084_0383356
736 Ga0590075_212194
737 Ga0590077_104383
738 Ga0590077_148133
739 Ga0587090_052122
740 Ga0587091_081554
741 Ga0587106_034632
742 Ga0501082_0108430
743 Ga0501082_0362095
744 Ga0501082_0769975
745 Ga0530510_0008472
746 Ga0530510_0550401
747 Ga0530510_1016687
748 Ga0530510_1247200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

23

141

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9726 22 128
7zs6-assembly1.cif.gz_CCC crystal structure of apis mellifera rida 0.968 1 126
6tcc-assembly1.cif.gz_A crystal structure of salmo salar rida-1 0.9678 3 126
3l7q-assembly2.cif.gz_E crystal structure of aldr from streptococcus mutans 0.9677 5 128
6l8p-assembly1.cif.gz_B crystal structure of rida from antarctic bacterium psychrobacter sp. pamc 21119 0.9666 5 128
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9741 22 128 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9671 4 128 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.965 3 126 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9633 3 128 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.96 5 128 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A645I7K2-F1-model_v4 2-iminobutanoate/2-iminopropanoate deaminase (EC 3.5.99.10) 0.9871 19 126 GO:0005829
GO:0120241
AF-A0A357T813-F1-model_v4 Reactive intermediate/imine deaminase 0.9866 21 128 GO:0005829
GO:0019239
AF-A0A538L8Q5-F1-model_v4 RidA family protein 0.9863 3 128 GO:0005829
GO:0019239
AF-A0A7V9SW13-F1-model_v4 Reactive intermediate/imine deaminase 0.9861 1 128 GO:0005829
GO:0019239
AF-A0A131Y934-F1-model_v4 Putative translation initiation inhibitor 0.9847 22 126 GO:0005739
GO:0005829
GO:0019239

Map