F426857

General Info

Members Datasets Scaffolds Average Seq Length
374 278 748 316

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0018503|Ga0496125_0018503_4930_6042
Length 365
Sequence MDPRVRGDDIRFCGAVRSCPLLRASPRSSLNNTRVRRQRTRDIPGRIIFMLNRRSLLLASLAAGVAMSNSRAHAKAAQPTTPVDFDVPAGACIHGDPEKFPFFAGRVYTPEPASPEEMAELHKALHIQRVVIVTPSVYGTDNSATLFGMKARGNDARGVAVIDDKTTEAQLDAMNADGFRGIRLNLATGGINDPSVGRARFQAAVDRMKARGWHIQLYTNTPLIAAIKDLVMQSPVPAVFDHFGGAQAELGLEQPGFGDLVELVRSGKAYVKISGAYRASKRAPDYADVIPFAKALIEANPDRIVWGTDWPHPDSTIRADRKPTDIAPLYQIDDGRLMNQLPVWSPDAAIRKKILVDNPARLYGF

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
227 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
230 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
240 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
241 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
242 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
243 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
244 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
245 2791355199
246 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
247 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
248 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
249 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
250 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
251 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
252 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
253 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
254 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
255 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
256 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
257 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
258 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
259 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
260 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
261 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
262 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
263 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
264 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
265 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
266 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
267 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
268 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
269 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
270 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
271 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
272 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
273 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
274 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
275 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
276 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
277 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
278 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.74
Metatranscriptomes 0.8
Isolates 10.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 6.95
Rhizoplane 4.28
Rhizosphere 71.39
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0018503 3300048928 Bacteria 6616
2 JGI25153J46596_10000632 3300003215 Bacteria 21524
3 JGI25153J46596_10007367 3300003215 Bacteria 5426
4 JGI25160J50197_1000499 3300003354 Bacteria 23457
5 Ga0065165_1031654 3300005262 Bacteria 1669
6 Ga0070683_100012219 3300005329 Bacteria 7455
7 Ga0070666_10107281 3300005335 Bacteria 1930
8 Ga0070689_100023940 3300005340 Bacteria 4578
9 Ga0070689_100064849 3300005340 Bacteria 2844
10 Ga0070689_100089391 3300005340 Bacteria 2426
11 Ga0070687_100134151 3300005343 Bacteria 1433
12 Ga0070668_100197698 3300005347 Bacteria 1650
13 Ga0070669_100013751 3300005353 Bacteria 5753
14 Ga0070671_100006157 3300005355 Bacteria 9556
15 Ga0070671_100161752 3300005355 Bacteria 1892
16 Ga0070673_100058943 3300005364 Bacteria 3038
17 Ga0070673_100066978 3300005364 Bacteria 2870
18 Ga0070688_100006833 3300005365 Bacteria 6120
19 Ga0070688_100103260 3300005365 Bacteria 1883
20 Ga0070688_100151972 3300005365 Bacteria 1583
21 Ga0070667_100011950 3300005367 Bacteria 7184
22 Ga0070678_100068319 3300005456 Bacteria 2648
23 Ga0070662_100153236 3300005457 Bacteria 1797
24 Ga0070681_10365999 3300005458 Bacteria 1352
25 Ga0070685_10033136 3300005466 Bacteria 2899
26 Ga0070684_100035934 3300005535 Bacteria 4243
27 Ga0070684_100197712 3300005535 Bacteria 1831
28 Ga0070697_100196362 3300005536 Bacteria 1714
29 Ga0070672_100050580 3300005543 Bacteria 3237
30 Ga0070686_100219217 3300005544 Bacteria 1374
31 Ga0070665_100031253 3300005548 Bacteria 5359
32 Ga0068855_100193766 3300005563 Bacteria 2291
33 Ga0068856_100317296 3300005614 Bacteria 1576
34 Ga0068859_100420904 3300005617 Bacteria 1432
35 Ga0068859_100631421 3300005617 Bacteria 1164
36 Ga0068863_100011061 3300005841 Bacteria 8752
37 Ga0068858_100036176 3300005842 Bacteria 4578
38 Ga0068858_100494134 3300005842 Bacteria 1182
39 Ga0068862_100014814 3300005844 Bacteria 6476
40 Ga0068862_100016134 3300005844 Bacteria 6213
41 Ga0081455_10003010 3300005937 Bacteria 19659
42 Ga0081455_10146289 3300005937 Bacteria 1828
43 Ga0081540_1002052 3300005983 Bacteria 16799
44 Ga0081540_1003503 3300005983 Bacteria 12388
45 Ga0081540_1016041 3300005983 Bacteria 4715
46 Ga0081540_1024985 3300005983 Bacteria 3453
47 Ga0081540_1043977 3300005983 Bacteria 2285
48 Ga0081540_1062333 3300005983 Bacteria 1772
49 Ga0081539_10000064 3300005985 Bacteria 247020
50 Ga0081539_10000341 3300005985 Bacteria 103044
51 Ga0081539_10002630 3300005985 Bacteria 24552
52 Ga0081539_10014587 3300005985 Bacteria 5798
53 Ga0081539_10096972 3300005985 Bacteria 1511
54 Ga0070717_10018012 3300006028 Bacteria 5509
55 Ga0075365_10016135 3300006038 Bacteria 4535
56 Ga0075364_10041153 3300006051 Bacteria 2999
57 Ga0070712_100272832 3300006175 Bacteria 1360
58 Ga0075369_10013684 3300006186 Bacteria 3227
59 Ga0075370_10036068 3300006353 Bacteria 2776
60 Ga0075428_100048981 3300006844 Bacteria 4636
61 Ga0075433_10056644 3300006852 Bacteria 3424
62 Ga0075429_100420908 3300006880 Bacteria 1170
63 Ga0075436_100055807 3300006914 Bacteria 2728
64 Ga0097620_100420913 3300006931 Bacteria 1432
65 Ga0097620_100631425 3300006931 Bacteria 1164
66 Ga0099794_10016944 3300007265 Bacteria 3240
67 Ga0111539_10000978 3300009094 Bacteria 37530
68 Ga0111539_10025267 3300009094 Bacteria 7281
69 Ga0111539_10401755 3300009094 Bacteria 1596
70 Ga0105245_10106015 3300009098 Bacteria 2607
71 Ga0105247_10018422 3300009101 Unclassified 4188
72 Ga0105247_10027169 3300009101 Bacteria 3461
73 Ga0114129_10012037 3300009147 Bacteria 12304
74 Ga0114129_10017613 3300009147 Bacteria 10169
75 Ga0114129_10024228 3300009147 Bacteria 8601
76 Ga0114129_10237173 3300009147 Bacteria 2453
77 Ga0105242_10127569 3300009176 Bacteria 2192
78 Ga0105248_10008056 3300009177 Bacteria 11568
79 Ga0105248_10834985 3300009177 Unclassified 1040
80 Ga0105237_10356654 3300009545 Bacteria 1466
81 Ga0105238_10113668 3300009551 Bacteria 2687
82 Ga0105239_10058517 3300010375 Bacteria 4229
83 Ga0105246_10200855 3300011119 Bacteria 1550
84 Ga0157369_10029824 3300013105 Bacteria 6025
85 Ga0157369_10036706 3300013105 Bacteria 5368
86 Ga0157374_10018559 3300013296 Bacteria 6141
87 Ga0157374_10164268 3300013296 Bacteria 2163
88 Ga0157378_10141762 3300013297 Bacteria 2232
89 Ga0157380_10292277 3300014326 Bacteria 1497
90 Ga0157379_10023815 3300014968 Bacteria 5434
91 Ga0157376_10242884 3300014969 Bacteria 1678
92 Ga0197907_10087046 3300020069 Bacteria 1779
93 Ga0206354_11280912 3300020081 Bacteria 1337
94 Ga0206353_10547904 3300020082 Bacteria 1849
95 Ga0213876_10176187 3300021384 Bacteria 1138
96 Ga0213875_10042835 3300021388 Bacteria 2126
97 Ga0209673_1029659 3300025273 Bacteria 1738
98 Ga0209564_1014258 3300025295 Bacteria 3318
99 Ga0209758_1000530 3300025297 Bacteria 60826
100 Ga0209758_1004073 3300025297 Bacteria 12567
101 Ga0207426_1000429 3300025302 Bacteria 68612
102 Ga0209257_1024088 3300025304 Bacteria 2118
103 Ga0207710_10077268 3300025900 Bacteria 1538
104 Ga0207680_10117926 3300025903 Bacteria 1732
105 Ga0207645_10075760 3300025907 Bacteria 2154
106 Ga0207695_10335933 3300025913 Bacteria 1399
107 Ga0207671_10127746 3300025914 Bacteria 1949
108 Ga0207693_10017395 3300025915 Bacteria 5735
109 Ga0207662_10095946 3300025918 Unclassified 1831
110 Ga0207694_10135154 3300025924 Bacteria 1980
111 Ga0207650_10000912 3300025925 Bacteria 22280
112 Ga0207700_10021154 3300025928 Bacteria 4435
113 Ga0207664_10063312 3300025929 Bacteria 2956
114 Ga0207644_10002946 3300025931 Bacteria 10965
115 Ga0207644_10051243 3300025931 Bacteria 2962
116 Ga0207644_10157849 3300025931 Bacteria 1761
117 Ga0207706_10190403 3300025933 Bacteria 1801
118 Ga0207670_10018432 3300025936 Bacteria 4243
119 Ga0207670_10052977 3300025936 Bacteria 2731
120 Ga0207670_10186148 3300025936 Bacteria 1567
121 Ga0207669_10133955 3300025937 Bacteria 1708
122 Ga0207704_10178800 3300025938 Bacteria 1531
123 Ga0207691_10013106 3300025940 Bacteria 7935
124 Ga0207691_10079560 3300025940 Bacteria 2950
125 Ga0207711_10038652 3300025941 Bacteria 4058
126 Ga0207711_10214777 3300025941 Bacteria 1758
127 Ga0207661_10000647 3300025944 Bacteria 22491
128 Ga0207667_10351465 3300025949 Bacteria 1503
129 Ga0207651_10006544 3300025960 Bacteria 6114
130 Ga0207651_10037804 3300025960 Bacteria 3165
131 Ga0207658_10061292 3300025986 Bacteria 2810
132 Ga0207678_10162227 3300026067 Bacteria 1909
133 Ga0207678_10223783 3300026067 Bacteria 1611
134 Ga0207708_10096575 3300026075 Bacteria 2283
135 Ga0207708_10230767 3300026075 Bacteria 1486
136 Ga0207641_10001335 3300026088 Bacteria 24409
137 Ga0207675_100372504 3300026118 Bacteria 1403
138 Ga0207428_10000727 3300027907 Bacteria 38034
139 Ga0268266_10032777 3300028379 Bacteria 4415
140 Ga0268265_10049508 3300028380 Bacteria 3160
141 Ga0268264_10015835 3300028381 Bacteria 6174
142 Ga0265326_10013573 3300028558 Bacteria 2381
143 Ga0265334_10045996 3300028573 Bacteria 1688
144 Ga0265323_10003555 3300028653 Bacteria 6859
145 Ga0265336_10000318 3300028666 Bacteria 32827
146 Ga0307517_10001174 3300028786 Bacteria 44101
147 Ga0307515_10274039 3300028794 Bacteria 1404
148 Ga0265338_10000034 3300028800 Bacteria 244623
149 Ga0265324_10001256 3300029957 Bacteria 14953
150 Ga0307511_10142833 3300030521 Bacteria 1400
151 Ga0265339_10058348 3300031249 Bacteria 2084
152 Ga0307408_100184387 3300031548 Bacteria 1676
153 Ga0307508_10000249 3300031616 Bacteria 65482
154 Ga0307416_100239087 3300032002 Bacteria 1758
155 Ga0373926_0002373 3300035083 Bacteria 5970
156 Ga0373923_0016280 3300035111 Bacteria 2821
157 Ga0373936_0001792 3300035113 Bacteria 7894
158 Ga0373953_0007946 3300035117 Bacteria 3578
159 Ga0373954_0001443 3300035118 Bacteria 9654
160 Ga0373954_0048145 3300035118 Bacteria 1997
161 Ga0373954_0074617 3300035118 Bacteria 1614
162 Ga0373956_0004531 3300035119 Bacteria 5550
163 Ga0373957_0003533 3300035120 Bacteria 4635
164 Ga0373943_0059304 3300035170 Bacteria 1907
165 Ga0373924_0003020 3300035410 Bacteria 5731
166 Ga0373935_0013757 3300035692 Bacteria 4886
167 Ga0373935_0046671 3300035692 Bacteria 2736
168 Ga0373927_0008188 3300035695 Bacteria 7044
169 Ga0373927_0180519 3300035695 Bacteria 1384
170 Ga0373933_0006894 3300035724 Bacteria 6189
171 Ga0373947_0013109 3300035725 Bacteria 4752
172 Ga0373937_0062645 3300036401 Bacteria 3419
173 Ga0373937_0211412 3300036401 Bacteria 1825
174 Ga0373925_0017027 3300037068 Bacteria 5261
175 Ga0373925_0217094 3300037068 Bacteria 1525
176 Ga0395900_0156716 3300037418 Bacteria 2326
177 Ga0395898_0005283 3300037466 Bacteria 13964
178 Ga0395898_0125290 3300037466 Bacteria 2461
179 Ga0395898_0192882 3300037466 Bacteria 1947
180 Ga0436364_0300491 3300037853 Bacteria 8746
181 Ga0395901_0058797 3300038443 Bacteria 3999
182 Ga0395901_0762868 3300038443 Bacteria 959
183 Ga0436365_0375309 3300039437 Bacteria 2282
184 Ga0451839_0738043 3300041496 Bacteria 1040
185 Ga0466969_0017806 3300044656 Bacteria 3707
186 Ga0466966_0001059 3300044684 Bacteria 17577
187 Ga0466961_0000050 3300044693 Bacteria 71289
188 Ga0466970_0105927 3300044765 Bacteria 1534
189 Ga0466958_0045606 3300045836 Bacteria 2645
190 Ga0495603_0064366 3300046455 Bacteria 2162
191 Ga0495641_0013082 3300046461 Bacteria 4588
192 Ga0495651_0000133 3300046462 Bacteria 55122
193 Ga0495651_0059584 3300046462 Bacteria 2926
194 Ga0495651_0060943 3300046462 Bacteria 2888
195 Ga0495653_0010359 3300046463 Bacteria 7626
196 Ga0495653_0060660 3300046463 Bacteria 2864
197 Ga0495580_0018258 3300046472 Bacteria 5224
198 Ga0495580_0030398 3300046472 Bacteria 3911
199 Ga0495582_0126029 3300046473 Bacteria 1445
200 Ga0495639_0007078 3300046475 Bacteria 4816
201 Ga0495639_0075160 3300046475 Bacteria 1566
202 Ga0495585_0056204 3300046492 Bacteria 2174
203 Ga0495606_0083987 3300046507 Bacteria 1973
204 Ga0495608_0046285 3300046511 Bacteria 2895
205 Ga0495610_0042920 3300046512 Bacteria 2257
206 Ga0495618_0038366 3300046514 Bacteria 3010
207 Ga0495628_0010927 3300046516 Bacteria 7690
208 Ga0495628_0045425 3300046516 Unclassified 3493
209 Ga0495628_0155260 3300046516 Bacteria 1741
210 Ga0495630_0022167 3300046517 Bacteria 4692
211 Ga0495632_0047945 3300046519 Bacteria 2117
212 Ga0495666_0010810 3300046526 Bacteria 4552
213 Ga0495666_0088543 3300046526 Bacteria 1462
214 Ga0495642_0079066 3300046528 Bacteria 1383
215 Ga0495652_0130617 3300046529 Bacteria 1989
216 Ga0495652_0203164 3300046529 Bacteria 1502
217 Ga0495665_0005602 3300046531 Bacteria 6766
218 Ga0495665_0037074 3300046531 Bacteria 2602
219 Ga0495640_0018122 3300046533 Bacteria 5232
220 Ga0495586_0005189 3300046535 Bacteria 6972
221 Ga0495586_0008132 3300046535 Bacteria 5591
222 Ga0495587_0016241 3300046536 Bacteria 4635
223 Ga0495587_0124253 3300046536 Bacteria 1477
224 Ga0495587_0129682 3300046536 Bacteria 1441
225 Ga0495645_0035113 3300046543 Bacteria 3656
226 Ga0495667_0001796 3300046559 Bacteria 14239
227 Ga0495667_0028859 3300046559 Bacteria 3736
228 Ga0495667_0083403 3300046559 Unclassified 2076
229 Ga0495634_0084899 3300046642 Unclassified 2064
230 Ga0495625_0171800 3300046660 Bacteria 1447
231 Ga0495635_0011865 3300046663 Bacteria 6107
232 Ga0495657_0015778 3300046675 Bacteria 5518
233 Ga0495657_0020131 3300046675 Bacteria 4800
234 Ga0495599_0072898 3300046678 Bacteria 2143
235 Ga0495623_0007492 3300046679 Bacteria 7085
236 Ga0495646_0001805 3300046680 Bacteria 12849
237 Ga0495647_0001227 3300046681 Bacteria 7903
238 Ga0495658_0004323 3300046683 Bacteria 6996
239 Ga0495613_0006028 3300046689 Bacteria 9069
240 Ga0495613_0020231 3300046689 Bacteria 4961
241 Ga0495624_0000494 3300046690 Bacteria 30685
242 Ga0495624_0022764 3300046690 Bacteria 4135
243 Ga0495624_0169990 3300046690 Bacteria 1330
244 Ga0495600_0015748 3300046809 Bacteria 4787
245 Ga0495600_0089945 3300046809 Bacteria 2002
246 Ga0495604_0002666 3300047317 Bacteria 14326
247 Ga0495604_0027961 3300047317 Bacteria 4484
248 Ga0495674_0005096 3300047319 Bacteria 12622
249 Ga0495674_0043430 3300047319 Bacteria 4000
250 Ga0495674_0163951 3300047319 Unclassified 1858
251 Ga0495676_0037319 3300047321 Bacteria 4046
252 Ga0495680_0008030 3300047322 Bacteria 9625
253 Ga0495680_0013789 3300047322 Bacteria 7033
254 Ga0495680_0238119 3300047322 Bacteria 1293
255 Ga0495687_006711 3300047443 Bacteria 6978
256 Ga0495675_0003166 3300047444 Bacteria 9883
257 Ga0495675_0006952 3300047444 Bacteria 6952
258 Ga0495681_0095609 3300047470 Bacteria 1306
259 Ga0495684_0008458 3300047471 Bacteria 7966
260 Ga0495684_0088849 3300047471 Bacteria 2341
261 Ga0495686_0039301 3300047472 Bacteria 3023
262 Ga0495686_0055159 3300047472 Bacteria 2487
263 Ga0495593_0009719 3300047673 Bacteria 5581
264 Ga0495602_0003847 3300048088 Bacteria 15621
265 Ga0495614_0013308 3300048089 Bacteria 3609
266 Ga0496102_0081604 3300048905 Bacteria 2981
267 Ga0496102_0104395 3300048905 Bacteria 2636
268 Ga0496103_0225712 3300048906 Bacteria 1205
269 Ga0496104_0417859 3300048907 Bacteria 1253
270 Ga0496105_0068349 3300048908 Bacteria 2935
271 Ga0496106_0023059 3300048909 Bacteria 4622
272 Ga0496106_0478976 3300048909 Bacteria 1000
273 Ga0496109_0125926 3300048912 Bacteria 2389
274 Ga0496109_0489506 3300048912 Bacteria 1161
275 Ga0496110_0205505 3300048913 Bacteria 1790
276 Ga0496110_0386352 3300048913 Bacteria 1276
277 Ga0496110_0416413 3300048913 Bacteria 1225
278 Ga0496112_0027552 3300048915 Bacteria 5478
279 Ga0496113_0201707 3300048916 Bacteria 1581
280 Ga0496115_0036999 3300048918 Bacteria 3867
281 Ga0496115_0053102 3300048918 Bacteria 3252
282 Ga0496118_0003113 3300048921 Bacteria 21268
283 Ga0496121_0000886 3300048924 Bacteria 54049
284 Ga0496121_0022965 3300048924 Bacteria 6027
285 Ga0496121_0191093 3300048924 Bacteria 1468
286 Ga0496124_0024938 3300048927 Bacteria 5425
287 Ga0496124_0026568 3300048927 Bacteria 5217
288 Ga0496125_0018566 3300048928 Bacteria 6603
289 Ga0496125_0113383 3300048928 Bacteria 1956
290 Ga0496126_0009021 3300048929 Bacteria 10666
291 Ga0501031_0066309 3300049568 Bacteria 2352
292 Ga0501033_0135212 3300049570 Bacteria 1784
293 Ga0501036_0304637 3300049572 Bacteria 1332
294 Ga0501037_0053695 3300049573 Bacteria 2948
295 Ga0501040_0039577 3300049576 Bacteria 3206
296 Ga0501042_0169709 3300049578 Bacteria 1574
297 Ga0501046_0223118 3300049580 Bacteria 1394
298 Ga0501075_0046498 3300049591 Bacteria 3260
299 Ga0501076_0012033 3300049592 Bacteria 6466
300 Ga0501077_0027239 3300049593 Bacteria 3629
301 Ga0501081_0051137 3300049743 Bacteria 2849
302 Ga0501045_0037928 3300049824 Bacteria 3505
303 nmdc:mga0yw44_28529_c1 3300050492 Bacteria 3212
304 nmdc:mga0yw44_64214_c1 3300050492 Bacteria 2259
305 nmdc:mga0k408_62785_c1 3300050493 Bacteria 2160
306 nmdc:mga06z11_90506_c1 3300050494 Bacteria 1660
307 nmdc:mga07m45_75153_c1 3300050496 Bacteria 1925
308 nmdc:mga05p37_14985_c1 3300050507 Bacteria 9306
309 nmdc:mga05p37_2256_c1 3300050507 Bacteria 22449
310 nmdc:mga08y16_49387_c1 3300050511 Bacteria 4403
311 nmdc:mga08y16_9490_c1 3300050511 Bacteria 10216
312 nmdc:mga0n895_102585_c1 3300050512 Bacteria 2871
313 nmdc:mga0n895_74707_c1 3300050512 Bacteria 3368
314 nmdc:mga0rr50_319942_c1 3300050513 Bacteria 1300
315 nmdc:mga08x19_213428_c1 3300050514 Bacteria 1325
316 nmdc:mga08x19_44645_c1 3300050514 Bacteria 2830
317 nmdc:mga08x19_79291_c1 3300050514 Bacteria 2153
318 nmdc:mga0sz30_35853_c1 3300050516 Bacteria 2072
319 Ga0495595_0016789 3300053084 Bacteria 3137
320 Ga0500651_0109458 3300053093 Bacteria 1687
321 Ga0500557_000173 3300053105 Bacteria 13018
322 Ga0500569_000688 3300053109 Bacteria 5867
323 Ga0500595_002480 3300053119 Bacteria 9129
324 Ga0500597_093589 3300053120 Bacteria 1306
325 Ga0500597_118078 3300053120 Bacteria 1150
326 Ga0500607_079108 3300053121 Bacteria 1680
327 Ga0500642_0000057 3300053130 Bacteria 67011
328 Ga0500573_0041596 3300053140 Bacteria 2652
329 Ga0500586_003469 3300053145 Bacteria 3730
330 Ga0500636_0086939 3300053177 Bacteria 1794
331 Ga0500645_050757 3300053730 Bacteria 1210
332 Ga0501084_0012374 3300054114 Bacteria 7071
333 Ga0501082_0033161 3300060353 Bacteria 4454
334 Ga0466962_0088850 3300061719 Bacteria 1480
335 2513642896 2513237094 Bacteria 8789602
336 2513719408 2513237104 Bacteria 10034502
337 2517104076 2517093001 Bacteria 9002274
338 2524436362 2524023205 Bacteria 8918781
339 2524470458 2524023210 Bacteria 9029266
340 2745080684 2744054633 Bacteria 8678936
341 2793084119
342 2824711964 2824704595 Bacteria 9667483
343 2824758470 2824753945 Bacteria 9787441
344 2824770054 2824763712 Bacteria 9792355
345 2841959773 2841957949 Bacteria 8652217
346 2844319938 2844315083 Bacteria 8138177
347 2857512843 2857509624 Bacteria 7472071
348 2874607314 2874604998 Bacteria 7834745
349 2879114641 2879110137 Bacteria 8907982
350 2885388309 2885383462 Bacteria 9473874
351 2903730389 2903727486 Bacteria 8281579
352 2903775905 2903768456 Bacteria 9749579
353 2904712063 2904711408 Bacteria 9771557
354 2906604678 2906602504 Bacteria 8295279
355 2922387422 2922386360 Bacteria 7017218
356 2935654201 2935648319 Bacteria 8801166
357 2935663106 2935656913 Bacteria 8965014
358 2935772020 2935769743 Bacteria 7878163
359 2935784195 2935777560 Bacteria 8077691
360 2935787592 2935785616 Bacteria 7962367
361 2935796224 2935793552 Bacteria 8012592
362 2936017262 2936011229 Bacteria 8801034
363 2936025764 2936019824 Bacteria 8804134
364 2936034581 2936028420 Bacteria 8965941
365 2936052638 2936046547 Bacteria 8903709
366 2936062079 2936055302 Bacteria 8785755
367 8006929153 8006926726 Bacteria 6749210
368 8006989183 8006984368 Bacteria 9651211
369 8006994795 8006994254 Bacteria 8309700
370 8016615519 8016613128 Bacteria 8794220
371 8016625705 8016622563 Bacteria 7999408
372 8016639264 8016630954 Bacteria 9217207
373 8019545939 8019538911 Bacteria 7872763
374 8019552788 8019547302 Bacteria 7996444
375 Ga0496125_0018503
376 JGI25153J46596_10000632
377 JGI25153J46596_10007367
378 JGI25160J50197_1000499
379 Ga0065165_1031654
380 Ga0070683_100012219
381 Ga0070666_10107281
382 Ga0070689_100023940
383 Ga0070689_100064849
384 Ga0070689_100089391
385 Ga0070687_100134151
386 Ga0070668_100197698
387 Ga0070669_100013751
388 Ga0070671_100006157
389 Ga0070671_100161752
390 Ga0070673_100058943
391 Ga0070673_100066978
392 Ga0070688_100006833
393 Ga0070688_100103260
394 Ga0070688_100151972
395 Ga0070667_100011950
396 Ga0070678_100068319
397 Ga0070662_100153236
398 Ga0070681_10365999
399 Ga0070685_10033136
400 Ga0070684_100035934
401 Ga0070684_100197712
402 Ga0070697_100196362
403 Ga0070672_100050580
404 Ga0070686_100219217
405 Ga0070665_100031253
406 Ga0068855_100193766
407 Ga0068856_100317296
408 Ga0068859_100420904
409 Ga0068859_100631421
410 Ga0068863_100011061
411 Ga0068858_100036176
412 Ga0068858_100494134
413 Ga0068862_100014814
414 Ga0068862_100016134
415 Ga0081455_10003010
416 Ga0081455_10146289
417 Ga0081540_1002052
418 Ga0081540_1003503
419 Ga0081540_1016041
420 Ga0081540_1024985
421 Ga0081540_1043977
422 Ga0081540_1062333
423 Ga0081539_10000064
424 Ga0081539_10000341
425 Ga0081539_10002630
426 Ga0081539_10014587
427 Ga0081539_10096972
428 Ga0070717_10018012
429 Ga0075365_10016135
430 Ga0075364_10041153
431 Ga0070712_100272832
432 Ga0075369_10013684
433 Ga0075370_10036068
434 Ga0075428_100048981
435 Ga0075433_10056644
436 Ga0075429_100420908
437 Ga0075436_100055807
438 Ga0097620_100420913
439 Ga0097620_100631425
440 Ga0099794_10016944
441 Ga0111539_10000978
442 Ga0111539_10025267
443 Ga0111539_10401755
444 Ga0105245_10106015
445 Ga0105247_10018422
446 Ga0105247_10027169
447 Ga0114129_10012037
448 Ga0114129_10017613
449 Ga0114129_10024228
450 Ga0114129_10237173
451 Ga0105242_10127569
452 Ga0105248_10008056
453 Ga0105248_10834985
454 Ga0105237_10356654
455 Ga0105238_10113668
456 Ga0105239_10058517
457 Ga0105246_10200855
458 Ga0157369_10029824
459 Ga0157369_10036706
460 Ga0157374_10018559
461 Ga0157374_10164268
462 Ga0157378_10141762
463 Ga0157380_10292277
464 Ga0157379_10023815
465 Ga0157376_10242884
466 Ga0197907_10087046
467 Ga0206354_11280912
468 Ga0206353_10547904
469 Ga0213876_10176187
470 Ga0213875_10042835
471 Ga0209673_1029659
472 Ga0209564_1014258
473 Ga0209758_1000530
474 Ga0209758_1004073
475 Ga0207426_1000429
476 Ga0209257_1024088
477 Ga0207710_10077268
478 Ga0207680_10117926
479 Ga0207645_10075760
480 Ga0207695_10335933
481 Ga0207671_10127746
482 Ga0207693_10017395
483 Ga0207662_10095946
484 Ga0207694_10135154
485 Ga0207650_10000912
486 Ga0207700_10021154
487 Ga0207664_10063312
488 Ga0207644_10002946
489 Ga0207644_10051243
490 Ga0207644_10157849
491 Ga0207706_10190403
492 Ga0207670_10018432
493 Ga0207670_10052977
494 Ga0207670_10186148
495 Ga0207669_10133955
496 Ga0207704_10178800
497 Ga0207691_10013106
498 Ga0207691_10079560
499 Ga0207711_10038652
500 Ga0207711_10214777
501 Ga0207661_10000647
502 Ga0207667_10351465
503 Ga0207651_10006544
504 Ga0207651_10037804
505 Ga0207658_10061292
506 Ga0207678_10162227
507 Ga0207678_10223783
508 Ga0207708_10096575
509 Ga0207708_10230767
510 Ga0207641_10001335
511 Ga0207675_100372504
512 Ga0207428_10000727
513 Ga0268266_10032777
514 Ga0268265_10049508
515 Ga0268264_10015835
516 Ga0265326_10013573
517 Ga0265334_10045996
518 Ga0265323_10003555
519 Ga0265336_10000318
520 Ga0307517_10001174
521 Ga0307515_10274039
522 Ga0265338_10000034
523 Ga0265324_10001256
524 Ga0307511_10142833
525 Ga0265339_10058348
526 Ga0307408_100184387
527 Ga0307508_10000249
528 Ga0307416_100239087
529 Ga0373926_0002373
530 Ga0373923_0016280
531 Ga0373936_0001792
532 Ga0373953_0007946
533 Ga0373954_0001443
534 Ga0373954_0048145
535 Ga0373954_0074617
536 Ga0373956_0004531
537 Ga0373957_0003533
538 Ga0373943_0059304
539 Ga0373924_0003020
540 Ga0373935_0013757
541 Ga0373935_0046671
542 Ga0373927_0008188
543 Ga0373927_0180519
544 Ga0373933_0006894
545 Ga0373947_0013109
546 Ga0373937_0062645
547 Ga0373937_0211412
548 Ga0373925_0017027
549 Ga0373925_0217094
550 Ga0395900_0156716
551 Ga0395898_0005283
552 Ga0395898_0125290
553 Ga0395898_0192882
554 Ga0436364_0300491
555 Ga0395901_0058797
556 Ga0395901_0762868
557 Ga0436365_0375309
558 Ga0451839_0738043
559 Ga0466969_0017806
560 Ga0466966_0001059
561 Ga0466961_0000050
562 Ga0466970_0105927
563 Ga0466958_0045606
564 Ga0495603_0064366
565 Ga0495641_0013082
566 Ga0495651_0000133
567 Ga0495651_0059584
568 Ga0495651_0060943
569 Ga0495653_0010359
570 Ga0495653_0060660
571 Ga0495580_0018258
572 Ga0495580_0030398
573 Ga0495582_0126029
574 Ga0495639_0007078
575 Ga0495639_0075160
576 Ga0495585_0056204
577 Ga0495606_0083987
578 Ga0495608_0046285
579 Ga0495610_0042920
580 Ga0495618_0038366
581 Ga0495628_0010927
582 Ga0495628_0045425
583 Ga0495628_0155260
584 Ga0495630_0022167
585 Ga0495632_0047945
586 Ga0495666_0010810
587 Ga0495666_0088543
588 Ga0495642_0079066
589 Ga0495652_0130617
590 Ga0495652_0203164
591 Ga0495665_0005602
592 Ga0495665_0037074
593 Ga0495640_0018122
594 Ga0495586_0005189
595 Ga0495586_0008132
596 Ga0495587_0016241
597 Ga0495587_0124253
598 Ga0495587_0129682
599 Ga0495645_0035113
600 Ga0495667_0001796
601 Ga0495667_0028859
602 Ga0495667_0083403
603 Ga0495634_0084899
604 Ga0495625_0171800
605 Ga0495635_0011865
606 Ga0495657_0015778
607 Ga0495657_0020131
608 Ga0495599_0072898
609 Ga0495623_0007492
610 Ga0495646_0001805
611 Ga0495647_0001227
612 Ga0495658_0004323
613 Ga0495613_0006028
614 Ga0495613_0020231
615 Ga0495624_0000494
616 Ga0495624_0022764
617 Ga0495624_0169990
618 Ga0495600_0015748
619 Ga0495600_0089945
620 Ga0495604_0002666
621 Ga0495604_0027961
622 Ga0495674_0005096
623 Ga0495674_0043430
624 Ga0495674_0163951
625 Ga0495676_0037319
626 Ga0495680_0008030
627 Ga0495680_0013789
628 Ga0495680_0238119
629 Ga0495687_006711
630 Ga0495675_0003166
631 Ga0495675_0006952
632 Ga0495681_0095609
633 Ga0495684_0008458
634 Ga0495684_0088849
635 Ga0495686_0039301
636 Ga0495686_0055159
637 Ga0495593_0009719
638 Ga0495602_0003847
639 Ga0495614_0013308
640 Ga0496102_0081604
641 Ga0496102_0104395
642 Ga0496103_0225712
643 Ga0496104_0417859
644 Ga0496105_0068349
645 Ga0496106_0023059
646 Ga0496106_0478976
647 Ga0496109_0125926
648 Ga0496109_0489506
649 Ga0496110_0205505
650 Ga0496110_0386352
651 Ga0496110_0416413
652 Ga0496112_0027552
653 Ga0496113_0201707
654 Ga0496115_0036999
655 Ga0496115_0053102
656 Ga0496118_0003113
657 Ga0496121_0000886
658 Ga0496121_0022965
659 Ga0496121_0191093
660 Ga0496124_0024938
661 Ga0496124_0026568
662 Ga0496125_0018566
663 Ga0496125_0113383
664 Ga0496126_0009021
665 Ga0501031_0066309
666 Ga0501033_0135212
667 Ga0501036_0304637
668 Ga0501037_0053695
669 Ga0501040_0039577
670 Ga0501042_0169709
671 Ga0501046_0223118
672 Ga0501075_0046498
673 Ga0501076_0012033
674 Ga0501077_0027239
675 Ga0501081_0051137
676 Ga0501045_0037928
677 nmdc:mga0yw44_28529_c1
678 nmdc:mga0yw44_64214_c1
679 nmdc:mga0k408_62785_c1
680 nmdc:mga06z11_90506_c1
681 nmdc:mga07m45_75153_c1
682 nmdc:mga05p37_14985_c1
683 nmdc:mga05p37_2256_c1
684 nmdc:mga08y16_49387_c1
685 nmdc:mga08y16_9490_c1
686 nmdc:mga0n895_102585_c1
687 nmdc:mga0n895_74707_c1
688 nmdc:mga0rr50_319942_c1
689 nmdc:mga08x19_213428_c1
690 nmdc:mga08x19_44645_c1
691 nmdc:mga08x19_79291_c1
692 nmdc:mga0sz30_35853_c1
693 Ga0495595_0016789
694 Ga0500651_0109458
695 Ga0500557_000173
696 Ga0500569_000688
697 Ga0500595_002480
698 Ga0500597_093589
699 Ga0500597_118078
700 Ga0500607_079108
701 Ga0500642_0000057
702 Ga0500573_0041596
703 Ga0500586_003469
704 Ga0500636_0086939
705 Ga0500645_050757
706 Ga0501084_0012374
707 Ga0501082_0033161
708 Ga0466962_0088850
709 2513642896
710 2513719408
711 2517104076
712 2524436362
713 2524470458
714 2745080684
715 2793084119
716 2824711964
717 2824758470
718 2824770054
719 2841959773
720 2844319938
721 2857512843
722 2874607314
723 2879114641
724 2885388309
725 2903730389
726 2903775905
727 2904712063
728 2906604678
729 2922387422
730 2935654201
731 2935663106
732 2935772020
733 2935784195
734 2935787592
735 2935796224
736 2936017262
737 2936025764
738 2936034581
739 2936052638
740 2936062079
741 8006929153
742 8006989183
743 8006994795
744 8016615519
745 8016625705
746 8016639264
747 8019545939
748 8019552788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

72

365

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4d8l-assembly1.cif.gz_A crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis 0.8888 31 316
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.8873 31 316
4di9-assembly1.cif.gz_A crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 0.886 31 316
4mup-assembly3.cif.gz_C crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure 0.8734 31 317
4mup-assembly3.cif.gz_C crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure 0.8613 31 317
ID Description Score Start End Superfamily
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8904 31 316 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8734 31 317 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8613 31 317 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8576 40 317 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8516 40 317 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A5D3K565-F1-model_v4 Amidohydrolase family protein 0.9963 28 317 GO:0016787
AF-A0A270QKK2-F1-model_v4 deleted 0.9911 143 317
AF-A0A537CN39-F1-model_v4 Hydrolase 0.9907 31 124 GO:0016787
AF-A0A2V8CVC0-F1-model_v4 Hydrolase 0.9881 28 317 GO:0016787
AF-A0A3N6N6N5-F1-model_v4 Hydrolase 0.9834 18 317 GO:0016787

Map