F426784

General Info

Members Datasets Scaffolds Average Seq Length
374 226 748 253

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0265891|Ga0395898_0265891_454_1287
Length 277
Sequence MGDEESAAAEVAPATTALRVAPTPNTVKVTVVGCSGSYPGPDSPASCYLVQAIDSLRTWSLVLDMGNGALGALQRYVDPLQVDAVFISHLHADHCVDMTSYYVLRKYHPTGTQPKIPVWGPKGTAKRLAKAYDLPRKPGMREEFSFRVYADPIEIGPFLIEPYEVDHPVPAYGLRVSAFGKVLAYSGDTGPTAALGDIAADADLFLCEASFRSCDDNPPNLHLTGTEAGEVAAKAGAKRLVVTHVPPWHDAATMLAEAEAAYDGPTELAVQGTVYEL

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
105 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
208 2643221576 Nocardioides sp. Root614 Isolate Unclassified
209 2643221590 Nocardioides sp. Root682 Isolate Unclassified
210 2643221604 Nocardioides sp. Root190 Isolate Unclassified
211 2643221617 Nocardioides sp. Root79 Isolate Unclassified
212 2643221620 Nocardioides sp. Root240 Isolate Unclassified
213 2643221641 Nocardioides sp. Root122 Isolate Unclassified
214 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
215 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
216 2738541305 Nocardioides sp. CF167 Isolate Unclassified
217 2739367653 Kocuria sp. OV113 Isolate Unclassified
218 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
219 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
220 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
221 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
222 2857727296 Kocuria sp. R-72562 Isolate Unclassified
223 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
224 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
225 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
226 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.58
Metatranscriptomes 1.07
Isolates 5.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 6.95
Nodule 0
Rhizoplane 1.07
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0265891 3300037466 Bacteria 1636
2 Ga0006562J51391_1062769 3300003578 Bacteria 3040
3 JGI25404J52841_10003459 3300003659 Bacteria 3125
4 JGI25405J52794_10008409 3300003911 Bacteria 1927
5 Ga0070683_100026374 3300005329 Bacteria 5231
6 Ga0070683_100328439 3300005329 Bacteria 1456
7 Ga0070680_100005815 3300005336 Bacteria 9359
8 Ga0070682_100285394 3300005337 Bacteria 1205
9 Ga0070661_100186185 3300005344 Bacteria 1582
10 Ga0070692_10084055 3300005345 Bacteria 1720
11 Ga0070659_100094583 3300005366 Bacteria 2400
12 Ga0070667_100714057 3300005367 Bacteria 928
13 Ga0070709_10503315 3300005434 Bacteria 920
14 Ga0070714_100021007 3300005435 Bacteria 5338
15 Ga0070714_100104768 3300005435 Bacteria 2496
16 Ga0070714_100128742 3300005435 Bacteria 2260
17 Ga0070714_100331835 3300005435 Bacteria 1424
18 Ga0070714_100580147 3300005435 Bacteria 1075
19 Ga0070714_100814967 3300005435 Bacteria 904
20 Ga0070713_100081906 3300005436 Bacteria 2755
21 Ga0070713_100130899 3300005436 Bacteria 2212
22 Ga0070713_100344043 3300005436 Bacteria 1382
23 Ga0070710_10041959 3300005437 Bacteria 2528
24 Ga0070711_100417445 3300005439 Bacteria 1093
25 Ga0070711_100652390 3300005439 Bacteria 882
26 Ga0070708_100087419 3300005445 Bacteria 2832
27 Ga0070708_100109870 3300005445 Bacteria 2533
28 Ga0070663_100235661 3300005455 Bacteria 1443
29 Ga0070662_100115028 3300005457 Bacteria 2054
30 Ga0070681_10442056 3300005458 Bacteria 1212
31 Ga0070706_100000418 3300005467 Bacteria 51047
32 Ga0070706_100002257 3300005467 Bacteria 19521
33 Ga0070706_100027004 3300005467 Bacteria 5282
34 Ga0070707_100019955 3300005468 Bacteria 6319
35 Ga0070707_100025955 3300005468 Bacteria 5561
36 Ga0070707_100066692 3300005468 Bacteria 3459
37 Ga0070698_100001650 3300005471 Bacteria 24887
38 Ga0070698_100003200 3300005471 Bacteria 18039
39 Ga0070698_100052665 3300005471 Bacteria 4139
40 Ga0070698_100197362 3300005471 Bacteria 1949
41 Ga0070699_100026251 3300005518 Bacteria 5024
42 Ga0070699_100121562 3300005518 Bacteria 2296
43 Ga0070684_100015209 3300005535 Bacteria 6258
44 Ga0070697_100076532 3300005536 Bacteria 2752
45 Ga0070665_100584500 3300005548 Bacteria 1130
46 Ga0068855_100708078 3300005563 Bacteria 1077
47 Ga0070664_100753539 3300005564 Bacteria 909
48 Ga0068857_100170429 3300005577 Bacteria 1978
49 Ga0068856_100260814 3300005614 Bacteria 1748
50 Ga0081455_10003711 3300005937 Bacteria 17483
51 Ga0081455_10007067 3300005937 Bacteria 11913
52 Ga0081540_1000009 3300005983 Bacteria 193562
53 Ga0070717_10012328 3300006028 Bacteria 6516
54 Ga0070717_10082105 3300006028 Bacteria 2707
55 Ga0070717_10441072 3300006028 Bacteria 1172
56 Ga0075365_10001014 3300006038 Bacteria 12050
57 Ga0075365_10005172 3300006038 Bacteria 7013
58 Ga0075365_10010865 3300006038 Bacteria 5328
59 Ga0075365_10097122 3300006038 Bacteria 2013
60 Ga0075365_10165973 3300006038 Bacteria 1540
61 Ga0075363_100002522 3300006048 Bacteria 7508
62 Ga0075363_100008780 3300006048 Bacteria 4724
63 Ga0075364_10001607 3300006051 Bacteria 12365
64 Ga0075364_10014601 3300006051 Bacteria 4855
65 Ga0075364_10121355 3300006051 Bacteria 1749
66 Ga0070716_100006131 3300006173 Bacteria 5865
67 Ga0070712_100264924 3300006175 Bacteria 1378
68 Ga0075367_10106888 3300006178 Bacteria 1715
69 Ga0075370_10001511 3300006353 Bacteria 10168
70 Ga0075370_10052929 3300006353 Bacteria 2304
71 Ga0075370_10188560 3300006353 Bacteria 1214
72 Ga0075428_100006426 3300006844 Bacteria 13075
73 Ga0075430_100009753 3300006846 Bacteria 8119
74 Ga0075431_100006532 3300006847 Bacteria 11582
75 Ga0075433_10190482 3300006852 Bacteria 1825
76 Ga0075429_100013904 3300006880 Bacteria 6981
77 Ga0111539_10036064 3300009094 Bacteria 5983
78 Ga0114129_10065463 3300009147 Bacteria 5072
79 Ga0105241_10058866 3300009174 Bacteria 2951
80 Ga0105239_10025586 3300010375 Bacteria 6498
81 Ga0157370_10197393 3300013104 Bacteria 1867
82 Ga0157369_10063418 3300013105 Bacteria 3981
83 Ga0157369_10446341 3300013105 Bacteria 1340
84 Ga0157369_10507900 3300013105 Bacteria 1247
85 Ga0157375_10039873 3300013308 Bacteria 4522
86 Ga0206354_11585360 3300020081 Bacteria 1234
87 Ga0206353_11075264 3300020082 Bacteria 1510
88 Ga0206353_11880502 3300020082 Bacteria 1531
89 Ga0213875_10127554 3300021388 Bacteria 1189
90 Ga0213875_10178143 3300021388 Bacteria 998
91 Ga0207692_10008080 3300025898 Bacteria 4342
92 Ga0207692_10071689 3300025898 Bacteria 1828
93 Ga0207699_10077243 3300025906 Bacteria 2054
94 Ga0207684_10001169 3300025910 Bacteria 29317
95 Ga0207684_10038181 3300025910 Bacteria 4075
96 Ga0207684_10054729 3300025910 Bacteria 3385
97 Ga0207684_10115372 3300025910 Bacteria 2300
98 Ga0207684_10623555 3300025910 Bacteria 920
99 Ga0207707_10022347 3300025912 Bacteria 5529
100 Ga0207671_10183505 3300025914 Bacteria 1629
101 Ga0207693_10049069 3300025915 Bacteria 3315
102 Ga0207663_10045839 3300025916 Bacteria 2691
103 Ga0207663_10052266 3300025916 Bacteria 2548
104 Ga0207660_10021054 3300025917 Bacteria 4382
105 Ga0207657_10009194 3300025919 Bacteria 9965
106 Ga0207652_10059357 3300025921 Bacteria 3297
107 Ga0207646_10075963 3300025922 Bacteria 3002
108 Ga0207646_10121993 3300025922 Bacteria 2341
109 Ga0207646_10343317 3300025922 Bacteria 1349
110 Ga0207700_10174166 3300025928 Bacteria 1797
111 Ga0207664_10002137 3300025929 Bacteria 13007
112 Ga0207664_10059102 3300025929 Bacteria 3052
113 Ga0207664_10215624 3300025929 Bacteria 1663
114 Ga0207665_10019604 3300025939 Bacteria 4447
115 Ga0207661_10034914 3300025944 Bacteria 3915
116 Ga0207661_10106489 3300025944 Bacteria 2364
117 Ga0207661_10478729 3300025944 Bacteria 1136
118 Ga0207639_10182958 3300026041 Bacteria 1784
119 Ga0207678_10008195 3300026067 Bacteria 9213
120 Ga0207678_10032114 3300026067 Bacteria 4577
121 Ga0207674_10218561 3300026116 Bacteria 1854
122 Ga0207675_100216627 3300026118 Bacteria 1843
123 Ga0207428_10083535 3300027907 Bacteria 2490
124 Ga0265334_10001141 3300028573 Bacteria 12977
125 Ga0265338_10004400 3300028800 Bacteria 19060
126 Ga0316576_10085737 3300031727 Bacteria 2341
127 Ga0307407_10380977 3300031903 Bacteria 1007
128 Ga0307409_100025686 3300031995 Bacteria 4137
129 Ga0307416_100165263 3300032002 Bacteria 2052
130 Ga0307414_10077875 3300032004 Bacteria 2415
131 Ga0307415_100030471 3300032126 Bacteria 3464
132 Ga0307415_100390614 3300032126 Bacteria 1185
133 Ga0373926_0002575 3300035083 Bacteria 5760
134 Ga0373926_0010022 3300035083 Bacteria 3171
135 Ga0373944_0001682 3300035089 Bacteria 5599
136 Ga0373936_0016413 3300035113 Bacteria 2848
137 Ga0373945_0000040 3300035116 Bacteria 27026
138 Ga0373956_0007146 3300035119 Bacteria 4493
139 Ga0373957_0032417 3300035120 Bacteria 1924
140 Ga0373946_0000247 3300035171 Bacteria 17040
141 Ga0373955_0036941 3300035172 Bacteria 2595
142 Ga0316574_0021701 3300035398 Bacteria 3816
143 Ga0373924_0011320 3300035410 Bacteria 3311
144 Ga0373931_0248800 3300035691 Bacteria 1080
145 Ga0373935_0000888 3300035692 Bacteria 16148
146 Ga0373927_0002022 3300035695 Bacteria 14931
147 Ga0373947_0001193 3300035725 Bacteria 15979
148 Ga0373937_0021489 3300036401 Bacteria 5792
149 Ga0373937_0103514 3300036401 Bacteria 2644
150 Ga0373925_0003463 3300037068 Bacteria 12199
151 Ga0395900_0030621 3300037418 Bacteria 5526
152 Ga0395900_0058762 3300037418 Bacteria 3959
153 Ga0395900_0293386 3300037418 Bacteria 1614
154 Ga0395900_0405742 3300037418 Bacteria 1326
155 Ga0395898_0100136 3300037466 Bacteria 2783
156 Ga0436364_0303970 3300037853 Bacteria 3636
157 Ga0436364_0359596 3300037853 Bacteria 5249
158 Ga0436365_1483491 3300039437 Bacteria 8181
159 Ga0439431_0043158 3300041997 Bacteria 1153
160 Ga0439442_029727 3300042002 Bacteria 1140
161 Ga0439448_0041645 3300042005 Bacteria 1487
162 Ga0439446_0017440 3300042156 Bacteria 2007
163 Ga0439434_0017063 3300042435 Bacteria 2171
164 Ga0466972_0014449 3300044658 Bacteria 3954
165 Ga0466972_0121980 3300044658 Bacteria 1229
166 Ga0466965_0008247 3300044683 Bacteria 4814
167 Ga0466965_0024793 3300044683 Bacteria 2902
168 Ga0466966_0031523 3300044684 Bacteria 3437
169 Ga0466966_0199445 3300044684 Bacteria 1211
170 Ga0466961_0029126 3300044693 Bacteria 3550
171 Ga0466963_0005203 3300044694 Bacteria 7597
172 Ga0466963_0048441 3300044694 Bacteria 2808
173 Ga0466963_0059935 3300044694 Bacteria 2541
174 Ga0466964_0077816 3300044706 Bacteria 1417
175 Ga0466968_0077735 3300044735 Bacteria 1454
176 Ga0466970_0014951 3300044765 Bacteria 3990
177 Ga0466970_0017064 3300044765 Bacteria 3749
178 Ga0466970_0050140 3300044765 Bacteria 2226
179 Ga0466970_0096079 3300044765 Bacteria 1611
180 Ga0466960_0077614 3300044901 Bacteria 1666
181 Ga0466959_0016639 3300045049 Bacteria 5377
182 Ga0466958_0048308 3300045836 Bacteria 2571
183 Ga0466967_0011131 3300045976 Bacteria 6796
184 Ga0466967_0155538 3300045976 Bacteria 2141
185 Ga0466967_0159795 3300045976 Bacteria 2114
186 Ga0495629_0104867 3300046459 Bacteria 1972
187 Ga0495641_0004530 3300046461 Bacteria 9767
188 Ga0495651_0063407 3300046462 Bacteria 2825
189 Ga0495651_0137797 3300046462 Bacteria 1773
190 Ga0495653_0000855 3300046463 Bacteria 23477
191 Ga0495582_0030117 3300046473 Bacteria 2978
192 Ga0495639_0150534 3300046475 Bacteria 1122
193 Ga0495662_0011473 3300046476 Bacteria 4330
194 Ga0495664_0000285 3300046477 Bacteria 24191
195 Ga0495664_0057486 3300046477 Bacteria 2314
196 Ga0495608_0016335 3300046511 Bacteria 5136
197 Ga0495618_0008222 3300046514 Bacteria 6320
198 Ga0495628_0058599 3300046516 Bacteria 3025
199 Ga0495628_0173930 3300046516 Bacteria 1632
200 Ga0495630_0009357 3300046517 Bacteria 7043
201 Ga0495652_0011357 3300046529 Bacteria 8055
202 Ga0495652_0151287 3300046529 Bacteria 1813
203 Ga0495652_0179304 3300046529 Bacteria 1627
204 Ga0495665_0002118 3300046531 Bacteria 10744
205 Ga0495640_0052823 3300046533 Bacteria 2788
206 Ga0495640_0083607 3300046533 Bacteria 2118
207 Ga0495587_0079088 3300046536 Bacteria 1907
208 Ga0495587_0154750 3300046536 Unclassified 1306
209 Ga0495645_0145168 3300046543 Bacteria 1653
210 Ga0495667_0002109 3300046559 Bacteria 13221
211 Ga0495634_0098779 3300046642 Bacteria 1888
212 Ga0495635_0001154 3300046663 Bacteria 17615
213 Ga0495657_0032383 3300046675 Bacteria 3648
214 Ga0495623_0274511 3300046679 Bacteria 940
215 Ga0495646_0249856 3300046680 Bacteria 950
216 Ga0495624_0016438 3300046690 Bacteria 4980
217 Ga0495624_0135570 3300046690 Bacteria 1509
218 Ga0495600_0021517 3300046809 Bacteria 4131
219 Ga0495581_0003502 3300047315 Bacteria 9010
220 Ga0495674_0000838 3300047319 Bacteria 29338
221 Ga0495674_0051872 3300047319 Bacteria 3614
222 Ga0495674_0053601 3300047319 Bacteria 3544
223 Ga0495674_0233279 3300047319 Unclassified 1518
224 Ga0495680_0033717 3300047322 Bacteria 4142
225 Ga0495684_0001024 3300047471 Bacteria 22712
226 Ga0495593_0015434 3300047673 Bacteria 4325
227 Ga0495602_0318629 3300048088 Bacteria 1132
228 Ga0496102_0698232 3300048905 Bacteria 938
229 Ga0496105_0271223 3300048908 Bacteria 1370
230 Ga0496115_0107897 3300048918 Bacteria 2286
231 Ga0496115_0307369 3300048918 Bacteria 1299
232 Ga0496122_0295859 3300048925 Unclassified 876
233 Ga0496126_0042033 3300048929 Bacteria 4224
234 Ga0501031_0001569 3300049568 Bacteria 14236
235 Ga0501031_0107704 3300049568 Bacteria 1820
236 Ga0501031_0280177 3300049568 Bacteria 1082
237 Ga0501032_0012572 3300049569 Bacteria 6045
238 Ga0501032_0051839 3300049569 Bacteria 2766
239 Ga0501032_0066357 3300049569 Bacteria 2411
240 Ga0501033_0003386 3300049570 Bacteria 13153
241 Ga0501033_0045222 3300049570 Bacteria 3277
242 Ga0501034_0003380 3300049571 Bacteria 18219
243 Ga0501034_0013243 3300049571 Bacteria 8498
244 Ga0501034_0291343 3300049571 Bacteria 1570
245 Ga0501036_0001694 3300049572 Bacteria 17122
246 Ga0501036_0004265 3300049572 Bacteria 11539
247 Ga0501036_0010035 3300049572 Bacteria 7801
248 Ga0501036_0052985 3300049572 Bacteria 3436
249 Ga0501036_0090030 3300049572 Bacteria 2592
250 Ga0501037_0023454 3300049573 Bacteria 4562
251 Ga0501037_0034394 3300049573 Bacteria 3739
252 Ga0501037_0186304 3300049573 Bacteria 1471
253 Ga0501037_0287466 3300049573 Bacteria 1144
254 Ga0501038_0003694 3300049574 Bacteria 14260
255 Ga0501038_0004008 3300049574 Bacteria 13683
256 Ga0501038_0010080 3300049574 Bacteria 8652
257 Ga0501038_0013769 3300049574 Bacteria 7371
258 Ga0501039_0007037 3300049575 Bacteria 8560
259 Ga0501039_0020596 3300049575 Bacteria 5054
260 Ga0501039_0139825 3300049575 Bacteria 1902
261 Ga0501039_0379408 3300049575 Bacteria 1110
262 Ga0501040_0186174 3300049576 Bacteria 1472
263 Ga0501040_0245658 3300049576 Bacteria 1276
264 Ga0501041_0071430 3300049577 Bacteria 2131
265 Ga0501041_0111280 3300049577 Bacteria 1699
266 Ga0501042_0003027 3300049578 Bacteria 10455
267 Ga0501042_0006792 3300049578 Bacteria 7460
268 Ga0501042_0040903 3300049578 Bacteria 3294
269 Ga0501042_0046000 3300049578 Bacteria 3111
270 Ga0501042_0087967 3300049578 Bacteria 2229
271 Ga0501042_0110452 3300049578 Bacteria 1980
272 Ga0501043_0000614 3300049579 Bacteria 31470
273 Ga0501043_0026195 3300049579 Bacteria 4575
274 Ga0501043_0083377 3300049579 Bacteria 2513
275 Ga0501043_0501590 3300049579 Bacteria 907
276 Ga0501046_0014736 3300049580 Bacteria 6581
277 Ga0501046_0057893 3300049580 Bacteria 3039
278 Ga0501046_0073585 3300049580 Bacteria 2651
279 Ga0501046_0546400 3300049580 Bacteria 826
280 Ga0501047_0000639 3300049581 Bacteria 36780
281 Ga0501047_0033893 3300049581 Bacteria 4928
282 Ga0501048_0007035 3300049582 Bacteria 8544
283 Ga0501048_0040541 3300049582 Bacteria 3336
284 Ga0501048_0084064 3300049582 Bacteria 2244
285 Ga0501048_0095442 3300049582 Bacteria 2097
286 Ga0501048_0267500 3300049582 Bacteria 1215
287 Ga0501067_0052525 3300049583 Bacteria 2258
288 Ga0501069_0007837 3300049585 Bacteria 5607
289 Ga0501069_0087583 3300049585 Bacteria 1759
290 Ga0501070_0164913 3300049586 Bacteria 1826
291 Ga0501070_0326207 3300049586 Bacteria 1248
292 Ga0501071_0023927 3300049587 Bacteria 4269
293 Ga0501071_0027046 3300049587 Bacteria 4033
294 Ga0501071_0067577 3300049587 Bacteria 2600
295 Ga0501071_0162147 3300049587 Bacteria 1671
296 Ga0501071_0541994 3300049587 Bacteria 893
297 Ga0501072_0006084 3300049588 Bacteria 9211
298 Ga0501072_0151846 3300049588 Bacteria 1847
299 Ga0501072_0229234 3300049588 Bacteria 1480
300 Ga0501073_0063282 3300049589 Bacteria 2581
301 Ga0501073_0153468 3300049589 Bacteria 1596
302 Ga0501073_0344287 3300049589 Bacteria 1029
303 Ga0501074_0000086 3300049590 Bacteria 45255
304 Ga0501074_0153014 3300049590 Bacteria 1648
305 Ga0501074_0383561 3300049590 Bacteria 997
306 Ga0501075_0091417 3300049591 Bacteria 2310
307 Ga0501075_0191492 3300049591 Bacteria 1560
308 Ga0501075_0206357 3300049591 Bacteria 1499
309 Ga0501076_0011478 3300049592 Bacteria 6600
310 Ga0501077_0131424 3300049593 Bacteria 1587
311 Ga0501079_0022774 3300049741 Bacteria 4808
312 Ga0501079_0069043 3300049741 Bacteria 2728
313 Ga0501079_0512542 3300049741 Bacteria 943
314 Ga0501080_0039249 3300049742 Bacteria 4419
315 Ga0501080_0075674 3300049742 Bacteria 3131
316 Ga0501080_0752794 3300049742 Bacteria 857
317 Ga0501080_0804893 3300049742 Bacteria 824
318 Ga0501081_0024483 3300049743 Bacteria 4053
319 Ga0501035_0015615 3300049822 Bacteria 7008
320 Ga0501035_0021194 3300049822 Bacteria 5973
321 Ga0501035_0035574 3300049822 Bacteria 4519
322 Ga0501044_0005123 3300049823 Bacteria 14617
323 Ga0501044_0019591 3300049823 Bacteria 7233
324 Ga0501044_0040033 3300049823 Bacteria 4886
325 Ga0501045_0048556 3300049824 Bacteria 3094
326 Ga0501045_0067284 3300049824 Bacteria 2631
327 Ga0501045_0270195 3300049824 Bacteria 1266
328 nmdc:mga03n38_118288_c1 3300050490 Bacteria 1299
329 nmdc:mga03n38_4360_c1 3300050490 Bacteria 4678
330 nmdc:mga00v17_115301_c1 3300050491 Bacteria 1707
331 nmdc:mga00v17_1413_c1 3300050491 Bacteria 12604
332 nmdc:mga0yw44_19187_c1 3300050492 Bacteria 3765
333 nmdc:mga0yw44_2584_c1 3300050492 Bacteria 7782
334 nmdc:mga0yw44_71403_c1 3300050492 Bacteria 2156
335 nmdc:mga06z11_60523_c1 3300050494 Bacteria 1972
336 nmdc:mga04h51_2047_c1 3300050495 Bacteria 4728
337 nmdc:mga07m45_18259_c1 3300050496 Bacteria 3782
338 nmdc:mga07m45_73169_c2 3300050496 Bacteria 1649
339 nmdc:mga05p37_309_c1 3300050507 Bacteria 51521
340 nmdc:mga09592_7518_c1 3300050508 Bacteria 8864
341 nmdc:mga0qj67_140740_c1 3300050509 Bacteria 1956
342 nmdc:mga0qj67_14409_c1 3300050509 Bacteria 5977
343 nmdc:mga06r32_13498_c1 3300050510 Bacteria 7403
344 nmdc:mga06r32_2255_c1 3300050510 Bacteria 17254
345 nmdc:mga0rr50_371120_c1 3300050513 Bacteria 1205
346 nmdc:mga0a205_167451_c1 3300050515 Bacteria 2093
347 Ga0495601_0115132 3300053077 Bacteria 1743
348 Ga0495595_0016928 3300053084 Bacteria 3127
349 Ga0500556_0000726 3300053104 Bacteria 19847
350 Ga0501084_0150347 3300054114 Bacteria 1962
351 Ga0501082_0457488 3300060353 Bacteria 1115
352 Ga0466962_0002472 3300061719 Bacteria 8757
353 Ga0466962_0041216 3300061719 Bacteria 2209
354 Ga0530510_0041521 3300061734 Bacteria 3321
355 2515852893 2515154155 Bacteria 7985436
356 2643889893 2643221576 Bacteria 5214352
357 2643958949 2643221590 Bacteria 5214697
358 2644033893 2643221604 Bacteria 5014917
359 2644102589 2643221617 Bacteria 5139111
360 2644118251 2643221620 Bacteria 5134593
361 2644231216 2643221641 Bacteria 4490190
362 2645722848 2643221961 Bacteria 3919167
363 2645725811 2643221962 Bacteria 3874254
364 2738867500 2738541305 Bacteria 4910150
365 2739602635 2739367653 Bacteria 2780952
366 2774393831 2773857762 Bacteria 5971770
367 2809195296 2808606439 Bacteria 5952208
368 2812331741 2811994874 Bacteria 5367947
369 2812350171 2811994878 Bacteria 5992952
370 2857728600 2857727296 Bacteria 2745552
371 2891972204 2891968417 Bacteria 5821697
372 2984577226 2984576629 Bacteria 4248407
373 2990260637 2990256926 Bacteria 4252839
374 8056061676 8056060235 Bacteria 7259403
375 Ga0395898_0265891
376 Ga0006562J51391_1062769
377 JGI25404J52841_10003459
378 JGI25405J52794_10008409
379 Ga0070683_100026374
380 Ga0070683_100328439
381 Ga0070680_100005815
382 Ga0070682_100285394
383 Ga0070661_100186185
384 Ga0070692_10084055
385 Ga0070659_100094583
386 Ga0070667_100714057
387 Ga0070709_10503315
388 Ga0070714_100021007
389 Ga0070714_100104768
390 Ga0070714_100128742
391 Ga0070714_100331835
392 Ga0070714_100580147
393 Ga0070714_100814967
394 Ga0070713_100081906
395 Ga0070713_100130899
396 Ga0070713_100344043
397 Ga0070710_10041959
398 Ga0070711_100417445
399 Ga0070711_100652390
400 Ga0070708_100087419
401 Ga0070708_100109870
402 Ga0070663_100235661
403 Ga0070662_100115028
404 Ga0070681_10442056
405 Ga0070706_100000418
406 Ga0070706_100002257
407 Ga0070706_100027004
408 Ga0070707_100019955
409 Ga0070707_100025955
410 Ga0070707_100066692
411 Ga0070698_100001650
412 Ga0070698_100003200
413 Ga0070698_100052665
414 Ga0070698_100197362
415 Ga0070699_100026251
416 Ga0070699_100121562
417 Ga0070684_100015209
418 Ga0070697_100076532
419 Ga0070665_100584500
420 Ga0068855_100708078
421 Ga0070664_100753539
422 Ga0068857_100170429
423 Ga0068856_100260814
424 Ga0081455_10003711
425 Ga0081455_10007067
426 Ga0081540_1000009
427 Ga0070717_10012328
428 Ga0070717_10082105
429 Ga0070717_10441072
430 Ga0075365_10001014
431 Ga0075365_10005172
432 Ga0075365_10010865
433 Ga0075365_10097122
434 Ga0075365_10165973
435 Ga0075363_100002522
436 Ga0075363_100008780
437 Ga0075364_10001607
438 Ga0075364_10014601
439 Ga0075364_10121355
440 Ga0070716_100006131
441 Ga0070712_100264924
442 Ga0075367_10106888
443 Ga0075370_10001511
444 Ga0075370_10052929
445 Ga0075370_10188560
446 Ga0075428_100006426
447 Ga0075430_100009753
448 Ga0075431_100006532
449 Ga0075433_10190482
450 Ga0075429_100013904
451 Ga0111539_10036064
452 Ga0114129_10065463
453 Ga0105241_10058866
454 Ga0105239_10025586
455 Ga0157370_10197393
456 Ga0157369_10063418
457 Ga0157369_10446341
458 Ga0157369_10507900
459 Ga0157375_10039873
460 Ga0206354_11585360
461 Ga0206353_11075264
462 Ga0206353_11880502
463 Ga0213875_10127554
464 Ga0213875_10178143
465 Ga0207692_10008080
466 Ga0207692_10071689
467 Ga0207699_10077243
468 Ga0207684_10001169
469 Ga0207684_10038181
470 Ga0207684_10054729
471 Ga0207684_10115372
472 Ga0207684_10623555
473 Ga0207707_10022347
474 Ga0207671_10183505
475 Ga0207693_10049069
476 Ga0207663_10045839
477 Ga0207663_10052266
478 Ga0207660_10021054
479 Ga0207657_10009194
480 Ga0207652_10059357
481 Ga0207646_10075963
482 Ga0207646_10121993
483 Ga0207646_10343317
484 Ga0207700_10174166
485 Ga0207664_10002137
486 Ga0207664_10059102
487 Ga0207664_10215624
488 Ga0207665_10019604
489 Ga0207661_10034914
490 Ga0207661_10106489
491 Ga0207661_10478729
492 Ga0207639_10182958
493 Ga0207678_10008195
494 Ga0207678_10032114
495 Ga0207674_10218561
496 Ga0207675_100216627
497 Ga0207428_10083535
498 Ga0265334_10001141
499 Ga0265338_10004400
500 Ga0316576_10085737
501 Ga0307407_10380977
502 Ga0307409_100025686
503 Ga0307416_100165263
504 Ga0307414_10077875
505 Ga0307415_100030471
506 Ga0307415_100390614
507 Ga0373926_0002575
508 Ga0373926_0010022
509 Ga0373944_0001682
510 Ga0373936_0016413
511 Ga0373945_0000040
512 Ga0373956_0007146
513 Ga0373957_0032417
514 Ga0373946_0000247
515 Ga0373955_0036941
516 Ga0316574_0021701
517 Ga0373924_0011320
518 Ga0373931_0248800
519 Ga0373935_0000888
520 Ga0373927_0002022
521 Ga0373947_0001193
522 Ga0373937_0021489
523 Ga0373937_0103514
524 Ga0373925_0003463
525 Ga0395900_0030621
526 Ga0395900_0058762
527 Ga0395900_0293386
528 Ga0395900_0405742
529 Ga0395898_0100136
530 Ga0436364_0303970
531 Ga0436364_0359596
532 Ga0436365_1483491
533 Ga0439431_0043158
534 Ga0439442_029727
535 Ga0439448_0041645
536 Ga0439446_0017440
537 Ga0439434_0017063
538 Ga0466972_0014449
539 Ga0466972_0121980
540 Ga0466965_0008247
541 Ga0466965_0024793
542 Ga0466966_0031523
543 Ga0466966_0199445
544 Ga0466961_0029126
545 Ga0466963_0005203
546 Ga0466963_0048441
547 Ga0466963_0059935
548 Ga0466964_0077816
549 Ga0466968_0077735
550 Ga0466970_0014951
551 Ga0466970_0017064
552 Ga0466970_0050140
553 Ga0466970_0096079
554 Ga0466960_0077614
555 Ga0466959_0016639
556 Ga0466958_0048308
557 Ga0466967_0011131
558 Ga0466967_0155538
559 Ga0466967_0159795
560 Ga0495629_0104867
561 Ga0495641_0004530
562 Ga0495651_0063407
563 Ga0495651_0137797
564 Ga0495653_0000855
565 Ga0495582_0030117
566 Ga0495639_0150534
567 Ga0495662_0011473
568 Ga0495664_0000285
569 Ga0495664_0057486
570 Ga0495608_0016335
571 Ga0495618_0008222
572 Ga0495628_0058599
573 Ga0495628_0173930
574 Ga0495630_0009357
575 Ga0495652_0011357
576 Ga0495652_0151287
577 Ga0495652_0179304
578 Ga0495665_0002118
579 Ga0495640_0052823
580 Ga0495640_0083607
581 Ga0495587_0079088
582 Ga0495587_0154750
583 Ga0495645_0145168
584 Ga0495667_0002109
585 Ga0495634_0098779
586 Ga0495635_0001154
587 Ga0495657_0032383
588 Ga0495623_0274511
589 Ga0495646_0249856
590 Ga0495624_0016438
591 Ga0495624_0135570
592 Ga0495600_0021517
593 Ga0495581_0003502
594 Ga0495674_0000838
595 Ga0495674_0051872
596 Ga0495674_0053601
597 Ga0495674_0233279
598 Ga0495680_0033717
599 Ga0495684_0001024
600 Ga0495593_0015434
601 Ga0495602_0318629
602 Ga0496102_0698232
603 Ga0496105_0271223
604 Ga0496115_0107897
605 Ga0496115_0307369
606 Ga0496122_0295859
607 Ga0496126_0042033
608 Ga0501031_0001569
609 Ga0501031_0107704
610 Ga0501031_0280177
611 Ga0501032_0012572
612 Ga0501032_0051839
613 Ga0501032_0066357
614 Ga0501033_0003386
615 Ga0501033_0045222
616 Ga0501034_0003380
617 Ga0501034_0013243
618 Ga0501034_0291343
619 Ga0501036_0001694
620 Ga0501036_0004265
621 Ga0501036_0010035
622 Ga0501036_0052985
623 Ga0501036_0090030
624 Ga0501037_0023454
625 Ga0501037_0034394
626 Ga0501037_0186304
627 Ga0501037_0287466
628 Ga0501038_0003694
629 Ga0501038_0004008
630 Ga0501038_0010080
631 Ga0501038_0013769
632 Ga0501039_0007037
633 Ga0501039_0020596
634 Ga0501039_0139825
635 Ga0501039_0379408
636 Ga0501040_0186174
637 Ga0501040_0245658
638 Ga0501041_0071430
639 Ga0501041_0111280
640 Ga0501042_0003027
641 Ga0501042_0006792
642 Ga0501042_0040903
643 Ga0501042_0046000
644 Ga0501042_0087967
645 Ga0501042_0110452
646 Ga0501043_0000614
647 Ga0501043_0026195
648 Ga0501043_0083377
649 Ga0501043_0501590
650 Ga0501046_0014736
651 Ga0501046_0057893
652 Ga0501046_0073585
653 Ga0501046_0546400
654 Ga0501047_0000639
655 Ga0501047_0033893
656 Ga0501048_0007035
657 Ga0501048_0040541
658 Ga0501048_0084064
659 Ga0501048_0095442
660 Ga0501048_0267500
661 Ga0501067_0052525
662 Ga0501069_0007837
663 Ga0501069_0087583
664 Ga0501070_0164913
665 Ga0501070_0326207
666 Ga0501071_0023927
667 Ga0501071_0027046
668 Ga0501071_0067577
669 Ga0501071_0162147
670 Ga0501071_0541994
671 Ga0501072_0006084
672 Ga0501072_0151846
673 Ga0501072_0229234
674 Ga0501073_0063282
675 Ga0501073_0153468
676 Ga0501073_0344287
677 Ga0501074_0000086
678 Ga0501074_0153014
679 Ga0501074_0383561
680 Ga0501075_0091417
681 Ga0501075_0191492
682 Ga0501075_0206357
683 Ga0501076_0011478
684 Ga0501077_0131424
685 Ga0501079_0022774
686 Ga0501079_0069043
687 Ga0501079_0512542
688 Ga0501080_0039249
689 Ga0501080_0075674
690 Ga0501080_0752794
691 Ga0501080_0804893
692 Ga0501081_0024483
693 Ga0501035_0015615
694 Ga0501035_0021194
695 Ga0501035_0035574
696 Ga0501044_0005123
697 Ga0501044_0019591
698 Ga0501044_0040033
699 Ga0501045_0048556
700 Ga0501045_0067284
701 Ga0501045_0270195
702 nmdc:mga03n38_118288_c1
703 nmdc:mga03n38_4360_c1
704 nmdc:mga00v17_115301_c1
705 nmdc:mga00v17_1413_c1
706 nmdc:mga0yw44_19187_c1
707 nmdc:mga0yw44_2584_c1
708 nmdc:mga0yw44_71403_c1
709 nmdc:mga06z11_60523_c1
710 nmdc:mga04h51_2047_c1
711 nmdc:mga07m45_18259_c1
712 nmdc:mga07m45_73169_c2
713 nmdc:mga05p37_309_c1
714 nmdc:mga09592_7518_c1
715 nmdc:mga0qj67_140740_c1
716 nmdc:mga0qj67_14409_c1
717 nmdc:mga06r32_13498_c1
718 nmdc:mga06r32_2255_c1
719 nmdc:mga0rr50_371120_c1
720 nmdc:mga0a205_167451_c1
721 Ga0495601_0115132
722 Ga0495595_0016928
723 Ga0500556_0000726
724 Ga0501084_0150347
725 Ga0501082_0457488
726 Ga0466962_0002472
727 Ga0466962_0041216
728 Ga0530510_0041521
729 2515852893
730 2643889893
731 2643958949
732 2644033893
733 2644102589
734 2644118251
735 2644231216
736 2645722848
737 2645725811
738 2738867500
739 2739602635
740 2774393831
741 2809195296
742 2812331741
743 2812350171
744 2857728600
745 2891972204
746 2984577226
747 2990260637
748 8056061676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

40

244

0.83

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

60

245

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8671 22 264
6kns-assembly1.cif.gz_A crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8644 22 264
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.862 23 262
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8602 22 264
6kns-assembly3.cif.gz_C-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8584 20 264
ID Description Score Start End Superfamily
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9088 23 262 3.60.15.10
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8667 23 262 3.60.15.10
1zkpC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8432 25 262 3.60.15.10
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8322 24 264 3.60.15.10
1zkpC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8299 25 262 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A838H5C6-F1-model_v4 MBL fold metallo-hydrolase 0.982 170 264 GO:0042781
AF-A0A7X7QDQ5-F1-model_v4 MBL fold metallo-hydrolase 0.974 170 264 GO:0042781
AF-A0A2S9GGK9-F1-model_v4 MBL fold metallo-hydrolase 0.9696 179 262
AF-A0A7V9ZIP8-F1-model_v4 MBL fold metallo-hydrolase 0.9684 25 93 GO:0016787
AF-A0A7W3PA43-F1-model_v4 Ribonuclease BN (tRNA processing enzyme) 0.9671 24 264 GO:0042781

Map