F426709

General Info

Members Datasets Scaffolds Average Seq Length
374 187 748 138

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10757102|Ga0157378_107571021
Length 160
Sequence MLEFKDSDVFVKRAAVFTPMSAPIAEITAEQFAFAENAVNNLPLGQMLGMKLTELRPDEAVFTMEMRDDLRQPSGVMHGGVTASLIDTAMAFAVRTRLDRSEATATIDLTIHYLRPVTEGKVTCIAKLVRAGKRIFTVSAEVQNAEGKLIATALSTYTRV

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
161 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
162 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
163 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
164 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
165 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
168 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
169 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
170 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
171 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
172 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
173 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
174 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
175 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
176 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
177 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
178 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
179 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
180 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 98.93
Stem 0
Stem Tuber 0
Unclassified 44.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10757102 3300013297 Bacteria 994
2 MRS1b_contig_8553651 2162886011 Unclassified 816
3 rootL2_10296313 3300003322 Unclassified 1098
4 Ga0065712_10067728 3300005290 Bacteria 178215
5 Ga0065712_10072816 3300005290 Bacteria 4608
6 Ga0065712_10382763 3300005290 Unclassified 750
7 Ga0065715_10089399 3300005293 Bacteria 10523
8 Ga0065715_10285696 3300005293 Bacteria 1075
9 Ga0070658_10003112 3300005327 Bacteria 13692
10 Ga0070676_10037812 3300005328 Unclassified 2785
11 Ga0070676_10523159 3300005328 Bacteria 845
12 Ga0070690_100146991 3300005330 Unclassified 1605
13 Ga0070690_100159800 3300005330 Bacteria 1543
14 Ga0070670_100146018 3300005331 Bacteria 2046
15 Ga0070670_100418910 3300005331 Unclassified 1184
16 Ga0070670_100444578 3300005331 Bacteria 1148
17 Ga0070677_10138226 3300005333 Bacteria 1120
18 Ga0070677_10153808 3300005333 Unclassified 1073
19 Ga0068869_100108521 3300005334 Unclassified 2109
20 Ga0068869_100144322 3300005334 Bacteria 1841
21 Ga0068869_101074303 3300005334 Unclassified 703
22 Ga0070682_100004666 3300005337 Bacteria 7614
23 Ga0068868_100301039 3300005338 Bacteria 1362
24 Ga0068868_101953378 3300005338 Unclassified 556
25 Ga0070691_10038004 3300005341 Unclassified 2272
26 Ga0070661_100006709 3300005344 Bacteria 7939
27 Ga0070661_100098115 3300005344 Unclassified 2176
28 Ga0070661_100389410 3300005344 Bacteria 1100
29 Ga0070661_100549563 3300005344 Unclassified 929
30 Ga0070692_10029712 3300005345 Bacteria 2727
31 Ga0070692_10058999 3300005345 Unclassified 2016
32 Ga0070692_10096805 3300005345 Archaea 1612
33 Ga0070692_10128251 3300005345 Unclassified 1423
34 Ga0070668_100274942 3300005347 Unclassified 1405
35 Ga0070668_100793778 3300005347 Unclassified 841
36 Ga0070675_100205978 3300005354 Bacteria 1709
37 Ga0070671_100380798 3300005355 Bacteria 1206
38 Ga0070671_100437687 3300005355 Unclassified 1121
39 Ga0070674_100536732 3300005356 Unclassified 979
40 Ga0070674_100551297 3300005356 Bacteria 967
41 Ga0070673_100124263 3300005364 Unclassified 2157
42 Ga0070688_100113550 3300005365 Unclassified 1805
43 Ga0070659_100024229 3300005366 Bacteria 4651
44 Ga0070659_100664717 3300005366 Unclassified 899
45 Ga0070667_100067795 3300005367 Bacteria 3035
46 Ga0070667_100415452 3300005367 Unclassified 1226
47 Ga0070701_10436650 3300005438 Unclassified 837
48 Ga0070700_100920487 3300005441 Unclassified 713
49 Ga0070694_100038237 3300005444 Unclassified 3188
50 Ga0070694_100285126 3300005444 Unclassified 1260
51 Ga0070708_100356124 3300005445 Bacteria 1379
52 Ga0070663_101650101 3300005455 Unclassified 572
53 Ga0070678_101117660 3300005456 Unclassified 728
54 Ga0070662_100142308 3300005457 Unclassified 1860
55 Ga0070662_100426142 3300005457 Bacteria 1098
56 Ga0070681_10008134 3300005458 Bacteria 10266
57 Ga0070681_10142336 3300005458 Bacteria 2328
58 Ga0070681_10873707 3300005458 Unclassified 817
59 Ga0068867_100015796 3300005459 Bacteria 5359
60 Ga0068867_100075047 3300005459 Bacteria 2536
61 Ga0070679_100132077 3300005530 Bacteria 2477
62 Ga0070679_100581541 3300005530 Unclassified 1063
63 Ga0070684_100265682 3300005535 Bacteria 1570
64 Ga0070684_101385085 3300005535 Bacteria 662
65 Ga0068853_100021305 3300005539 Bacteria 5402
66 Ga0068853_100535581 3300005539 Unclassified 1108
67 Ga0068853_100901264 3300005539 Unclassified 849
68 Ga0068853_101125030 3300005539 Bacteria 757
69 Ga0068853_101258111 3300005539 Bacteria 715
70 Ga0070672_100301825 3300005543 Unclassified 1357
71 Ga0070672_101091264 3300005543 Unclassified 709
72 Ga0070695_100087105 3300005545 Bacteria 2077
73 Ga0070696_100143970 3300005546 Unclassified 1744
74 Ga0070696_100160447 3300005546 Unclassified 1656
75 Ga0070693_100052241 3300005547 Bacteria 2342
76 Ga0070704_100029138 3300005549 Bacteria 3682
77 Ga0070704_100043719 3300005549 Unclassified 3107
78 Ga0070704_100189441 3300005549 Archaea 1652
79 Ga0070664_100011507 3300005564 Bacteria 7182
80 Ga0070664_100737069 3300005564 Bacteria 919
81 Ga0070664_100811371 3300005564 Bacteria 875
82 Ga0068857_100042385 3300005577 Bacteria 4038
83 Ga0068857_100677831 3300005577 Unclassified 978
84 Ga0068854_100074340 3300005578 Bacteria 2493
85 Ga0068854_100129548 3300005578 Unclassified 1925
86 Ga0068854_100849076 3300005578 Unclassified 799
87 Ga0068854_100974166 3300005578 Unclassified 749
88 Ga0070702_100303620 3300005615 Unclassified 1105
89 Ga0070702_100685798 3300005615 Bacteria 779
90 Ga0068852_100432004 3300005616 Bacteria 1301
91 Ga0068852_101434342 3300005616 Bacteria 713
92 Ga0068859_100012439 3300005617 Bacteria 8563
93 Ga0068859_100032279 3300005617 Bacteria 5260
94 Ga0068859_100068824 3300005617 Unclassified 3574
95 Ga0068859_100153456 3300005617 Unclassified 2379
96 Ga0068859_100254076 3300005617 Bacteria 1848
97 Ga0068859_100259011 3300005617 Unclassified 1830
98 Ga0068859_100968867 3300005617 Unclassified 933
99 Ga0068859_101935960 3300005617 Unclassified 651
100 Ga0068864_100019360 3300005618 Bacteria 5691
101 Ga0068864_100268900 3300005618 Bacteria 1588
102 Ga0068864_100343700 3300005618 Unclassified 1406
103 Ga0068864_100349877 3300005618 Bacteria 1394
104 Ga0068864_101088890 3300005618 Unclassified 795
105 Ga0068864_101092003 3300005618 Bacteria 794
106 Ga0068866_10237465 3300005718 Unclassified 1108
107 Ga0068861_100263293 3300005719 Unclassified 1477
108 Ga0068851_10013065 3300005834 Bacteria 3926
109 Ga0068851_10031954 3300005834 Bacteria 2618
110 Ga0068863_100095709 3300005841 Unclassified 2818
111 Ga0068863_100528340 3300005841 Bacteria 1164
112 Ga0068858_100095004 3300005842 Unclassified 2777
113 Ga0068858_100567867 3300005842 Unclassified 1099
114 Ga0068860_100116131 3300005843 Unclassified 2560
115 Ga0068862_100215247 3300005844 Unclassified 1737
116 Ga0068862_100525680 3300005844 Unclassified 1126
117 Ga0068862_101645479 3300005844 Unclassified 649
118 Ga0097621_100470670 3300006237 Bacteria 1134
119 Ga0075428_100053980 3300006844 Bacteria 4403
120 Ga0075428_100323854 3300006844 Bacteria 1656
121 Ga0075428_101012570 3300006844 Unclassified 879
122 Ga0075430_100012468 3300006846 Bacteria 7233
123 Ga0075430_100087381 3300006846 Bacteria 2609
124 Ga0075430_100172343 3300006846 Bacteria 1800
125 Ga0075431_100017308 3300006847 Bacteria 7325
126 Ga0075431_100743600 3300006847 Unclassified 956
127 Ga0075433_10115599 3300006852 Bacteria 2380
128 Ga0075433_10196048 3300006852 Unclassified 1796
129 Ga0075433_11219907 3300006852 Unclassified 653
130 Ga0075434_100021234 3300006871 Bacteria 6311
131 Ga0075434_100138979 3300006871 Unclassified 2449
132 Ga0075434_101308445 3300006871 Unclassified 736
133 Ga0075429_100042072 3300006880 Unclassified 3977
134 Ga0075429_100070937 3300006880 Bacteria 3033
135 Ga0068865_100071163 3300006881 Unclassified 2466
136 Ga0097620_100012439 3300006931 Bacteria 8563
137 Ga0097620_100032276 3300006931 Bacteria 5260
138 Ga0097620_100068823 3300006931 Unclassified 3574
139 Ga0097620_100153452 3300006931 Unclassified 2379
140 Ga0097620_100171322 3300006931 Bacteria 2252
141 Ga0097620_100254069 3300006931 Bacteria 1848
142 Ga0097620_100259037 3300006931 Unclassified 1830
143 Ga0097620_100969048 3300006931 Unclassified 933
144 Ga0097620_101936323 3300006931 Unclassified 651
145 Ga0105251_10437009 3300009011 Bacteria 605
146 Ga0105240_10032163 3300009093 Bacteria 6794
147 Ga0105240_10166276 3300009093 Unclassified 2616
148 Ga0105240_10709859 3300009093 Unclassified 1097
149 Ga0111539_10191154 3300009094 Unclassified 2389
150 Ga0105245_11778795 3300009098 Unclassified 669
151 Ga0105247_10088698 3300009101 Unclassified 1960
152 Ga0114129_10018682 3300009147 Bacteria 9871
153 Ga0114129_10055856 3300009147 Bacteria 5533
154 Ga0114129_10069526 3300009147 Bacteria 4908
155 Ga0114129_12135545 3300009147 Unclassified 675
156 Ga0105243_10032686 3300009148 Unclassified 4021
157 Ga0105243_10540099 3300009148 Unclassified 1112
158 Ga0105243_12026257 3300009148 Unclassified 610
159 Ga0105241_10020095 3300009174 Bacteria 4933
160 Ga0105242_10872441 3300009176 Unclassified 897
161 Ga0105248_10177584 3300009177 Unclassified 2400
162 Ga0105248_10239388 3300009177 Unclassified 2043
163 Ga0105237_10001199 3300009545 Bacteria 34703
164 Ga0105237_10022032 3300009545 Bacteria 6539
165 Ga0105249_10126766 3300009553 Bacteria 2432
166 Ga0105249_10153256 3300009553 Unclassified 2221
167 Ga0105239_10030177 3300010375 Bacteria 5961
168 Ga0105239_10093019 3300010375 Bacteria 3329
169 Ga0105239_10293265 3300010375 Unclassified 1831
170 Ga0157373_10051226 3300013100 Bacteria 2941
171 Ga0157373_10082402 3300013100 Unclassified 2267
172 Ga0157373_10109432 3300013100 Unclassified 1943
173 Ga0157373_10291221 3300013100 Unclassified 1158
174 Ga0157373_11438515 3300013100 Bacteria 525
175 Ga0157370_10070280 3300013104 Unclassified 3305
176 Ga0157369_10021370 3300013105 Bacteria 7239
177 Ga0157369_10085794 3300013105 Bacteria 3364
178 Ga0157374_10099571 3300013296 Unclassified 2785
179 Ga0157378_10026656 3300013297 Bacteria 5094
180 Ga0157378_10494323 3300013297 Bacteria 1221
181 Ga0157378_11371250 3300013297 Unclassified 749
182 Ga0163162_10746019 3300013306 Unclassified 1098
183 Ga0163162_11211837 3300013306 Unclassified 857
184 Ga0157372_10050999 3300013307 Bacteria 4604
185 Ga0157372_10080716 3300013307 Bacteria 3681
186 Ga0157372_10145858 3300013307 Unclassified 2729
187 Ga0157372_10169976 3300013307 Bacteria 2522
188 Ga0157372_11404185 3300013307 Bacteria 805
189 Ga0157375_10110383 3300013308 Bacteria 2848
190 Ga0157375_10459588 3300013308 Bacteria 1438
191 Ga0163163_10058458 3300014325 Bacteria 3813
192 Ga0163163_10066761 3300014325 Bacteria 3574
193 Ga0163163_10429621 3300014325 Unclassified 1380
194 Ga0163163_12395944 3300014325 Unclassified 586
195 Ga0157380_10010437 3300014326 Bacteria 6682
196 Ga0157380_10142763 3300014326 Bacteria 2059
197 Ga0157377_10541225 3300014745 Unclassified 821
198 Ga0157379_10087621 3300014968 Unclassified 2791
199 Ga0163161_10000241 3300017792 Bacteria 49345
200 Ga0207656_10011878 3300025321 Bacteria 3300
201 Ga0207653_10000497 3300025885 Bacteria 15280
202 Ga0207682_10333087 3300025893 Unclassified 714
203 Ga0207710_10015933 3300025900 Unclassified 3179
204 Ga0207645_10037950 3300025907 Unclassified 3091
205 Ga0207645_10348806 3300025907 Bacteria 990
206 Ga0207705_10015274 3300025909 Bacteria 5513
207 Ga0207654_10145923 3300025911 Bacteria 1514
208 Ga0207654_10556587 3300025911 Bacteria 815
209 Ga0207707_10006375 3300025912 Bacteria 10299
210 Ga0207707_10180266 3300025912 Bacteria 1844
211 Ga0207707_10721612 3300025912 Unclassified 836
212 Ga0207695_10035736 3300025913 Bacteria 5382
213 Ga0207695_10225621 3300025913 Unclassified 1780
214 Ga0207671_10001638 3300025914 Bacteria 25473
215 Ga0207671_10178444 3300025914 Unclassified 1652
216 Ga0207660_10386324 3300025917 Bacteria 1126
217 Ga0207660_10517840 3300025917 Bacteria 968
218 Ga0207657_10062926 3300025919 Bacteria 3174
219 Ga0207649_10366437 3300025920 Unclassified 1070
220 Ga0207649_10561832 3300025920 Unclassified 874
221 Ga0207649_10633346 3300025920 Unclassified 825
222 Ga0207650_10106000 3300025925 Bacteria 2170
223 Ga0207650_10221950 3300025925 Unclassified 1521
224 Ga0207650_10258726 3300025925 Unclassified 1411
225 Ga0207650_11033537 3300025925 Bacteria 699
226 Ga0207644_10036129 3300025931 Unclassified 3467
227 Ga0207644_10370993 3300025931 Bacteria 1166
228 Ga0207690_10040225 3300025932 Bacteria 3055
229 Ga0207706_10074014 3300025933 Bacteria 2995
230 Ga0207706_10441429 3300025933 Bacteria 1126
231 Ga0207709_10399451 3300025935 Bacteria 1050
232 Ga0207669_10499518 3300025937 Unclassified 973
233 Ga0207691_10082797 3300025940 Bacteria 2881
234 Ga0207691_11009228 3300025940 Unclassified 694
235 Ga0207689_10090285 3300025942 Bacteria 2517
236 Ga0207689_10265341 3300025942 Unclassified 1421
237 Ga0207679_10007853 3300025945 Bacteria 6780
238 Ga0207679_11255600 3300025945 Bacteria 680
239 Ga0207651_10102453 3300025960 Unclassified 2128
240 Ga0207651_10673524 3300025960 Bacteria 910
241 Ga0207651_10843742 3300025960 Unclassified 814
242 Ga0207712_10000517 3300025961 Bacteria 31862
243 Ga0207668_10604973 3300025972 Unclassified 955
244 Ga0207640_10356274 3300025981 Bacteria 1177
245 Ga0207658_10025018 3300025986 Bacteria 4179
246 Ga0207658_10048227 3300025986 Bacteria 3122
247 Ga0207658_10079404 3300025986 Bacteria 2510
248 Ga0207677_10356100 3300026023 Unclassified 1228
249 Ga0207677_10896173 3300026023 Bacteria 799
250 Ga0207677_11748193 3300026023 Unclassified 577
251 Ga0207703_12079340 3300026035 Bacteria 544
252 Ga0207639_10005616 3300026041 Bacteria 8487
253 Ga0207639_10192848 3300026041 Unclassified 1741
254 Ga0207641_10165643 3300026088 Unclassified 2013
255 Ga0207641_10228689 3300026088 Bacteria 1728
256 Ga0207641_10233116 3300026088 Bacteria 1712
257 Ga0207648_10113421 3300026089 Bacteria 2380
258 Ga0207648_10276974 3300026089 Bacteria 1500
259 Ga0207648_10295424 3300026089 Unclassified 1452
260 Ga0207676_10013071 3300026095 Bacteria 5959
261 Ga0207676_10115276 3300026095 Bacteria 2256
262 Ga0207676_10314704 3300026095 Bacteria 1434
263 Ga0207676_10408481 3300026095 Bacteria 1271
264 Ga0207676_10702234 3300026095 Bacteria 980
265 Ga0207674_10011134 3300026116 Bacteria 10116
266 Ga0207674_10043607 3300026116 Bacteria 4624
267 Ga0207674_10187438 3300026116 Bacteria 2019
268 Ga0207674_11469899 3300026116 Unclassified 651
269 Ga0207675_100193355 3300026118 Unclassified 1952
270 Ga0207698_10233105 3300026142 Bacteria 1672
271 Ga0207698_10777357 3300026142 Unclassified 958
272 Ga0207698_11348249 3300026142 Bacteria 728
273 Ga0207698_12087026 3300026142 Bacteria 580
274 Ga0268265_10434051 3300028380 Bacteria 1223
275 Ga0268265_11106903 3300028380 Unclassified 786
276 Ga0268265_11472058 3300028380 Unclassified 684
277 Ga0268264_10004650 3300028381 Bacteria 11665
278 Ga0268264_10444633 3300028381 Unclassified 1255
279 Ga0307408_100265212 3300031548 Unclassified 1423
280 Ga0307408_100851279 3300031548 Bacteria 831
281 Ga0307408_101648798 3300031548 Unclassified 610
282 Ga0307516_10441525 3300031730 Unclassified 958
283 Ga0307405_10021901 3300031731 Bacteria 3602
284 Ga0307405_10451670 3300031731 Unclassified 1019
285 Ga0307405_10783563 3300031731 Bacteria 797
286 Ga0307413_10099097 3300031824 Unclassified 1920
287 Ga0307413_10152744 3300031824 Bacteria 1611
288 Ga0307413_10421975 3300031824 Bacteria 1051
289 Ga0307413_10761334 3300031824 Bacteria 810
290 Ga0307410_10005416 3300031852 Bacteria 6752
291 Ga0307410_10010198 3300031852 Bacteria 5311
292 Ga0307410_10189180 3300031852 Bacteria 1564
293 Ga0307406_10023671 3300031901 Unclassified 3658
294 Ga0307406_10036888 3300031901 Bacteria 3015
295 Ga0307406_10042904 3300031901 Bacteria 2826
296 Ga0307406_10367920 3300031901 Bacteria 1129
297 Ga0307407_10072933 3300031903 Unclassified 2049
298 Ga0307407_10425473 3300031903 Bacteria 958
299 Ga0307412_10040756 3300031911 Bacteria 3006
300 Ga0307412_10292485 3300031911 Bacteria 1284
301 Ga0307412_10635863 3300031911 Bacteria 908
302 Ga0307409_100027061 3300031995 Unclassified 4058
303 Ga0307409_100121404 3300031995 Bacteria 2213
304 Ga0307409_100339022 3300031995 Bacteria 1414
305 Ga0307409_101463925 3300031995 Bacteria 710
306 Ga0307416_100160682 3300032002 Bacteria 2076
307 Ga0307416_100284701 3300032002 Bacteria 1632
308 Ga0307416_100571822 3300032002 Bacteria 1206
309 Ga0307416_100943819 3300032002 Bacteria 964
310 Ga0307416_101451974 3300032002 Unclassified 792
311 Ga0307414_10009811 3300032004 Bacteria 5519
312 Ga0307411_10002633 3300032005 Bacteria 8033
313 Ga0307411_10011856 3300032005 Bacteria 4727
314 Ga0307411_10024998 3300032005 Unclassified 3570
315 Ga0307415_100074598 3300032126 Unclassified 2398
316 Ga0307415_100429984 3300032126 Unclassified 1136
317 Ga0373950_0052287 3300034818 Bacteria 805
318 Ga0373928_0006196 3300035084 Unclassified 2298
319 Ga0373941_0063049 3300035115 Unclassified 1211
320 Ga0373962_0027166 3300035242 Bacteria 1547
321 Ga0373931_0232333 3300035691 Bacteria 1115
322 Ga0395900_0237519 3300037418 Bacteria 1830
323 Ga0395905_0437404 3300037471 Bacteria 1205
324 Ga0395901_0791255 3300038443 Unclassified 938
325 Ga0436362_0980027 3300039453 Unclassified 739
326 Ga0451576_0604222 3300045051 Bacteria 1153
327 Ga0495616_0154188 3300046513 Bacteria 1037
328 Ga0495663_0000097 3300046525 Bacteria 36409
329 Ga0495598_0000344 3300046537 Bacteria 8306
330 Ga0495598_0091366 3300046537 Unclassified 993
331 Ga0495621_0000252 3300046539 Bacteria 12773
332 Ga0495668_0077763 3300046616 Unclassified 1822
333 Ga0495672_0119746 3300047320 Unclassified 1401
334 Ga0496112_0125561 3300048915 Unclassified 2537
335 Ga0496112_0971429 3300048915 Bacteria 770
336 Ga0501291_009325 3300049514 Bacteria 1374
337 Ga0501077_0538187 3300049593 Unclassified 749
338 Ga0501198_013656 3300049649 Bacteria 1231
339 Ga0501207_001909 3300049654 Bacteria 2662
340 Ga0501223_006557 3300049663 Bacteria 2403
341 Ga0501224_002414 3300049664 Bacteria 2540
342 Ga0501227_003981 3300049665 Bacteria 3182
343 Ga0501230_003641 3300049667 Unclassified 2063
344 Ga0501235_089160 3300049669 Unclassified 743
345 Ga0501240_001156 3300049673 Bacteria 2486
346 Ga0501259_014382 3300049688 Bacteria 1341
347 Ga0501261_001352 3300049690 Bacteria 3005
348 Ga0501261_050519 3300049690 Unclassified 680
349 Ga0501221_047406 3300049704 Unclassified 958
350 Ga0501225_0041048 3300049705 Unclassified 1275
351 Ga0501229_017933 3300049706 Unclassified 926
352 Ga0501232_010015 3300049757 Unclassified 1059
353 Ga0501241_101867 3300049758 Unclassified 620
354 Ga0501268_003571 3300049765 Bacteria 2139
355 Ga0501270_115801 3300049767 Unclassified 577
356 Ga0501272_003750 3300049769 Bacteria 1559
357 Ga0501279_032659 3300049775 Unclassified 776
358 Ga0501212_016656 3300049851 Unclassified 1105
359 Ga0501226_017271 3300049853 Unclassified 794
360 nmdc:mga05p37_123205_c1 3300050507 Bacteria 3184
361 nmdc:mga05p37_235525_c1 3300050507 Bacteria 2204
362 nmdc:mga09592_1156047_c1 3300050508 Unclassified 641
363 nmdc:mga09592_425308_c1 3300050508 Unclassified 1147
364 nmdc:mga09592_683241_c1 3300050508 Unclassified 875
365 nmdc:mga0qj67_141381_c1 3300050509 Bacteria 1952
366 nmdc:mga0qj67_181070_c1 3300050509 Bacteria 1711
367 nmdc:mga0qj67_21714_c1 3300050509 Bacteria 4926
368 nmdc:mga0qj67_933593_c1 3300050509 Unclassified 683
369 nmdc:mga06r32_79496_c1 3300050510 Bacteria 3190
370 nmdc:mga08y16_129761_c1 3300050511 Bacteria 2622
371 nmdc:mga0n895_197456_c1 3300050512 Bacteria 2043
372 nmdc:mga0n895_242955_c1 3300050512 Bacteria 1827
373 nmdc:mga0a205_60887_c1 3300050515 Bacteria 3646
374 nmdc:mga0a205_789757_c1 3300050515 Unclassified 797
375 Ga0157378_10757102
376 MRS1b_contig_8553651
377 rootL2_10296313
378 Ga0065712_10067728
379 Ga0065712_10072816
380 Ga0065712_10382763
381 Ga0065715_10089399
382 Ga0065715_10285696
383 Ga0070658_10003112
384 Ga0070676_10037812
385 Ga0070676_10523159
386 Ga0070690_100146991
387 Ga0070690_100159800
388 Ga0070670_100146018
389 Ga0070670_100418910
390 Ga0070670_100444578
391 Ga0070677_10138226
392 Ga0070677_10153808
393 Ga0068869_100108521
394 Ga0068869_100144322
395 Ga0068869_101074303
396 Ga0070682_100004666
397 Ga0068868_100301039
398 Ga0068868_101953378
399 Ga0070691_10038004
400 Ga0070661_100006709
401 Ga0070661_100098115
402 Ga0070661_100389410
403 Ga0070661_100549563
404 Ga0070692_10029712
405 Ga0070692_10058999
406 Ga0070692_10096805
407 Ga0070692_10128251
408 Ga0070668_100274942
409 Ga0070668_100793778
410 Ga0070675_100205978
411 Ga0070671_100380798
412 Ga0070671_100437687
413 Ga0070674_100536732
414 Ga0070674_100551297
415 Ga0070673_100124263
416 Ga0070688_100113550
417 Ga0070659_100024229
418 Ga0070659_100664717
419 Ga0070667_100067795
420 Ga0070667_100415452
421 Ga0070701_10436650
422 Ga0070700_100920487
423 Ga0070694_100038237
424 Ga0070694_100285126
425 Ga0070708_100356124
426 Ga0070663_101650101
427 Ga0070678_101117660
428 Ga0070662_100142308
429 Ga0070662_100426142
430 Ga0070681_10008134
431 Ga0070681_10142336
432 Ga0070681_10873707
433 Ga0068867_100015796
434 Ga0068867_100075047
435 Ga0070679_100132077
436 Ga0070679_100581541
437 Ga0070684_100265682
438 Ga0070684_101385085
439 Ga0068853_100021305
440 Ga0068853_100535581
441 Ga0068853_100901264
442 Ga0068853_101125030
443 Ga0068853_101258111
444 Ga0070672_100301825
445 Ga0070672_101091264
446 Ga0070695_100087105
447 Ga0070696_100143970
448 Ga0070696_100160447
449 Ga0070693_100052241
450 Ga0070704_100029138
451 Ga0070704_100043719
452 Ga0070704_100189441
453 Ga0070664_100011507
454 Ga0070664_100737069
455 Ga0070664_100811371
456 Ga0068857_100042385
457 Ga0068857_100677831
458 Ga0068854_100074340
459 Ga0068854_100129548
460 Ga0068854_100849076
461 Ga0068854_100974166
462 Ga0070702_100303620
463 Ga0070702_100685798
464 Ga0068852_100432004
465 Ga0068852_101434342
466 Ga0068859_100012439
467 Ga0068859_100032279
468 Ga0068859_100068824
469 Ga0068859_100153456
470 Ga0068859_100254076
471 Ga0068859_100259011
472 Ga0068859_100968867
473 Ga0068859_101935960
474 Ga0068864_100019360
475 Ga0068864_100268900
476 Ga0068864_100343700
477 Ga0068864_100349877
478 Ga0068864_101088890
479 Ga0068864_101092003
480 Ga0068866_10237465
481 Ga0068861_100263293
482 Ga0068851_10013065
483 Ga0068851_10031954
484 Ga0068863_100095709
485 Ga0068863_100528340
486 Ga0068858_100095004
487 Ga0068858_100567867
488 Ga0068860_100116131
489 Ga0068862_100215247
490 Ga0068862_100525680
491 Ga0068862_101645479
492 Ga0097621_100470670
493 Ga0075428_100053980
494 Ga0075428_100323854
495 Ga0075428_101012570
496 Ga0075430_100012468
497 Ga0075430_100087381
498 Ga0075430_100172343
499 Ga0075431_100017308
500 Ga0075431_100743600
501 Ga0075433_10115599
502 Ga0075433_10196048
503 Ga0075433_11219907
504 Ga0075434_100021234
505 Ga0075434_100138979
506 Ga0075434_101308445
507 Ga0075429_100042072
508 Ga0075429_100070937
509 Ga0068865_100071163
510 Ga0097620_100012439
511 Ga0097620_100032276
512 Ga0097620_100068823
513 Ga0097620_100153452
514 Ga0097620_100171322
515 Ga0097620_100254069
516 Ga0097620_100259037
517 Ga0097620_100969048
518 Ga0097620_101936323
519 Ga0105251_10437009
520 Ga0105240_10032163
521 Ga0105240_10166276
522 Ga0105240_10709859
523 Ga0111539_10191154
524 Ga0105245_11778795
525 Ga0105247_10088698
526 Ga0114129_10018682
527 Ga0114129_10055856
528 Ga0114129_10069526
529 Ga0114129_12135545
530 Ga0105243_10032686
531 Ga0105243_10540099
532 Ga0105243_12026257
533 Ga0105241_10020095
534 Ga0105242_10872441
535 Ga0105248_10177584
536 Ga0105248_10239388
537 Ga0105237_10001199
538 Ga0105237_10022032
539 Ga0105249_10126766
540 Ga0105249_10153256
541 Ga0105239_10030177
542 Ga0105239_10093019
543 Ga0105239_10293265
544 Ga0157373_10051226
545 Ga0157373_10082402
546 Ga0157373_10109432
547 Ga0157373_10291221
548 Ga0157373_11438515
549 Ga0157370_10070280
550 Ga0157369_10021370
551 Ga0157369_10085794
552 Ga0157374_10099571
553 Ga0157378_10026656
554 Ga0157378_10494323
555 Ga0157378_11371250
556 Ga0163162_10746019
557 Ga0163162_11211837
558 Ga0157372_10050999
559 Ga0157372_10080716
560 Ga0157372_10145858
561 Ga0157372_10169976
562 Ga0157372_11404185
563 Ga0157375_10110383
564 Ga0157375_10459588
565 Ga0163163_10058458
566 Ga0163163_10066761
567 Ga0163163_10429621
568 Ga0163163_12395944
569 Ga0157380_10010437
570 Ga0157380_10142763
571 Ga0157377_10541225
572 Ga0157379_10087621
573 Ga0163161_10000241
574 Ga0207656_10011878
575 Ga0207653_10000497
576 Ga0207682_10333087
577 Ga0207710_10015933
578 Ga0207645_10037950
579 Ga0207645_10348806
580 Ga0207705_10015274
581 Ga0207654_10145923
582 Ga0207654_10556587
583 Ga0207707_10006375
584 Ga0207707_10180266
585 Ga0207707_10721612
586 Ga0207695_10035736
587 Ga0207695_10225621
588 Ga0207671_10001638
589 Ga0207671_10178444
590 Ga0207660_10386324
591 Ga0207660_10517840
592 Ga0207657_10062926
593 Ga0207649_10366437
594 Ga0207649_10561832
595 Ga0207649_10633346
596 Ga0207650_10106000
597 Ga0207650_10221950
598 Ga0207650_10258726
599 Ga0207650_11033537
600 Ga0207644_10036129
601 Ga0207644_10370993
602 Ga0207690_10040225
603 Ga0207706_10074014
604 Ga0207706_10441429
605 Ga0207709_10399451
606 Ga0207669_10499518
607 Ga0207691_10082797
608 Ga0207691_11009228
609 Ga0207689_10090285
610 Ga0207689_10265341
611 Ga0207679_10007853
612 Ga0207679_11255600
613 Ga0207651_10102453
614 Ga0207651_10673524
615 Ga0207651_10843742
616 Ga0207712_10000517
617 Ga0207668_10604973
618 Ga0207640_10356274
619 Ga0207658_10025018
620 Ga0207658_10048227
621 Ga0207658_10079404
622 Ga0207677_10356100
623 Ga0207677_10896173
624 Ga0207677_11748193
625 Ga0207703_12079340
626 Ga0207639_10005616
627 Ga0207639_10192848
628 Ga0207641_10165643
629 Ga0207641_10228689
630 Ga0207641_10233116
631 Ga0207648_10113421
632 Ga0207648_10276974
633 Ga0207648_10295424
634 Ga0207676_10013071
635 Ga0207676_10115276
636 Ga0207676_10314704
637 Ga0207676_10408481
638 Ga0207676_10702234
639 Ga0207674_10011134
640 Ga0207674_10043607
641 Ga0207674_10187438
642 Ga0207674_11469899
643 Ga0207675_100193355
644 Ga0207698_10233105
645 Ga0207698_10777357
646 Ga0207698_11348249
647 Ga0207698_12087026
648 Ga0268265_10434051
649 Ga0268265_11106903
650 Ga0268265_11472058
651 Ga0268264_10004650
652 Ga0268264_10444633
653 Ga0307408_100265212
654 Ga0307408_100851279
655 Ga0307408_101648798
656 Ga0307516_10441525
657 Ga0307405_10021901
658 Ga0307405_10451670
659 Ga0307405_10783563
660 Ga0307413_10099097
661 Ga0307413_10152744
662 Ga0307413_10421975
663 Ga0307413_10761334
664 Ga0307410_10005416
665 Ga0307410_10010198
666 Ga0307410_10189180
667 Ga0307406_10023671
668 Ga0307406_10036888
669 Ga0307406_10042904
670 Ga0307406_10367920
671 Ga0307407_10072933
672 Ga0307407_10425473
673 Ga0307412_10040756
674 Ga0307412_10292485
675 Ga0307412_10635863
676 Ga0307409_100027061
677 Ga0307409_100121404
678 Ga0307409_100339022
679 Ga0307409_101463925
680 Ga0307416_100160682
681 Ga0307416_100284701
682 Ga0307416_100571822
683 Ga0307416_100943819
684 Ga0307416_101451974
685 Ga0307414_10009811
686 Ga0307411_10002633
687 Ga0307411_10011856
688 Ga0307411_10024998
689 Ga0307415_100074598
690 Ga0307415_100429984
691 Ga0373950_0052287
692 Ga0373928_0006196
693 Ga0373941_0063049
694 Ga0373962_0027166
695 Ga0373931_0232333
696 Ga0395900_0237519
697 Ga0395905_0437404
698 Ga0395901_0791255
699 Ga0436362_0980027
700 Ga0451576_0604222
701 Ga0495616_0154188
702 Ga0495663_0000097
703 Ga0495598_0000344
704 Ga0495598_0091366
705 Ga0495621_0000252
706 Ga0495668_0077763
707 Ga0495672_0119746
708 Ga0496112_0125561
709 Ga0496112_0971429
710 Ga0501291_009325
711 Ga0501077_0538187
712 Ga0501198_013656
713 Ga0501207_001909
714 Ga0501223_006557
715 Ga0501224_002414
716 Ga0501227_003981
717 Ga0501230_003641
718 Ga0501235_089160
719 Ga0501240_001156
720 Ga0501259_014382
721 Ga0501261_001352
722 Ga0501261_050519
723 Ga0501221_047406
724 Ga0501225_0041048
725 Ga0501229_017933
726 Ga0501232_010015
727 Ga0501241_101867
728 Ga0501268_003571
729 Ga0501270_115801
730 Ga0501272_003750
731 Ga0501279_032659
732 Ga0501212_016656
733 Ga0501226_017271
734 nmdc:mga05p37_123205_c1
735 nmdc:mga05p37_235525_c1
736 nmdc:mga09592_1156047_c1
737 nmdc:mga09592_425308_c1
738 nmdc:mga09592_683241_c1
739 nmdc:mga0qj67_141381_c1
740 nmdc:mga0qj67_181070_c1
741 nmdc:mga0qj67_21714_c1
742 nmdc:mga0qj67_933593_c1
743 nmdc:mga06r32_79496_c1
744 nmdc:mga08y16_129761_c1
745 nmdc:mga0n895_197456_c1
746 nmdc:mga0n895_242955_c1
747 nmdc:mga0a205_60887_c1
748 nmdc:mga0a205_789757_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

74

151

0.98

PF14539

DUF4442

Domain of unknown function (DUF4442)

30

158

0.88

PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

29

156

0.86

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

68

158

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9333 22 126
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9295 20 127
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9125 20 126
3r34-assembly1.cif.gz_A crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant e73d complexed with coa 0.9108 23 129
3r37-assembly1.cif.gz_A crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant e73q complexed with 4-hydroxyphenacyl coa 0.9106 23 129
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9323 20 127 3.10.129.10
af_Q9M2E4_49_183_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8992 22 126 3.10.129.10
3r32A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8871 18 128 3.10.129.10
af_I1N3I1_40_174_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8797 22 126 3.10.129.10
af_A0A0R0KY19_2_94_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8794 24 104 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7V9P7Z3-F1-model_v4 PaaI family thioesterase 0.972 1 104 GO:0016289
AF-A0A831WZX6-F1-model_v4 PaaI family thioesterase 0.9577 7 128 GO:0047617
AF-A0A2V8QBW2-F1-model_v4 Thioesterase domain-containing protein 0.9574 1 127 GO:0047617
AF-A0A1F4X5G0-F1-model_v4 Thioesterase domain-containing protein 0.9568 4 126 GO:0047617
AF-A0A7V8Z7T4-F1-model_v4 PaaI family thioesterase 0.956 1 127 GO:0047617

Map