F426693

General Info

Members Datasets Scaffolds Average Seq Length
374 233 368 218

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10256084|Ga0105238_102560842
Length 256
Sequence MSAAAPPHRGAAPSVASGDASPVVFATREERSSPDPKRSEEVSAQRTEGALSAEAFADLAGATPAQVADLERFRQMLVERNAVMNLVGPATLPDFWNRHAWDSAQLIKIAPDALTWADLGAGAGFPGLVLAILGKGRPGFHVDLVESMAKRCRFLSEVVEALDLPASVRHDRAENLDLAVDIVTARACAPLWRLLGYARPYFKRGALGLFLKGQDVASELEEATRYWEYEADIVASLSDPRGRIVRVRRLGRARKV

Samples

Sample ID Description Type Environment
1 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
5 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
6 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
221 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
226 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
227 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
228 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
229 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
230 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
233 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 4.01
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000313 3300003791 Bacteria 44170
2 Ga0055531_10005382 3300003794 Bacteria 7501
3 Ga0055531_10008950 3300003794 Bacteria 5185
4 Ga0065165_1003306 3300005262 Bacteria 11574
5 Ga0065165_1023846 3300005262 Bacteria 2066
6 Ga0070658_10337567 3300005327 Bacteria 1288
7 Ga0070670_100000004 3300005331 Bacteria 392110
8 Ga0068869_101022944 3300005334 Bacteria 720
9 Ga0070666_10022684 3300005335 Bacteria 4079
10 Ga0070680_100097190 3300005336 Bacteria 2442
11 Ga0070691_10028902 3300005341 Bacteria 2592
12 Ga0070691_10078062 3300005341 Bacteria 1617
13 Ga0070668_100001643 3300005347 Bacteria 16208
14 Ga0070668_100002624 3300005347 Bacteria 13203
15 Ga0070668_100021118 3300005347 Bacteria 4922
16 Ga0070668_100383191 3300005347 Bacteria 1197
17 Ga0070669_100326733 3300005353 Bacteria 1240
18 Ga0070671_100088253 3300005355 Bacteria 2595
19 Ga0070674_100571534 3300005356 Bacteria 951
20 Ga0070667_100000105 3300005367 Bacteria 106633
21 Ga0070667_100029043 3300005367 Bacteria 4606
22 Ga0070667_100080910 3300005367 Bacteria 2779
23 Ga0070678_100135744 3300005456 Bacteria 1961
24 Ga0070678_100202837 3300005456 Bacteria 1638
25 Ga0070681_10001804 3300005458 Bacteria 19261
26 Ga0070681_10558454 3300005458 Unclassified 1059
27 Ga0070684_100706990 3300005535 Bacteria 940
28 Ga0068853_100052073 3300005539 Bacteria 3525
29 Ga0068853_100073631 3300005539 Bacteria 2979
30 Ga0070693_100126496 3300005547 Bacteria 1592
31 Ga0070665_100000198 3300005548 Bacteria 105999
32 Ga0070665_100000721 3300005548 Bacteria 44003
33 Ga0070665_100001194 3300005548 Bacteria 31673
34 Ga0070665_100053905 3300005548 Bacteria 4034
35 Ga0070665_100699013 3300005548 Bacteria 1027
36 Ga0070704_100254485 3300005549 Bacteria 1444
37 Ga0068855_100073731 3300005563 Bacteria 3965
38 Ga0068855_100232516 3300005563 Bacteria 2063
39 Ga0070664_100075655 3300005564 Bacteria 2892
40 Ga0070664_100230851 3300005564 Bacteria 1659
41 Ga0068854_100090723 3300005578 Bacteria 2273
42 Ga0068859_100001699 3300005617 Bacteria 22416
43 Ga0068859_100855931 3300005617 Bacteria 995
44 Ga0068864_100000082 3300005618 Bacteria 101182
45 Ga0068864_100042690 3300005618 Bacteria 3880
46 Ga0068864_100154609 3300005618 Bacteria 2081
47 Ga0068864_100303747 3300005618 Bacteria 1495
48 Ga0068861_100558137 3300005719 Bacteria 1045
49 Ga0068863_100000560 3300005841 Bacteria 37696
50 Ga0068863_100058955 3300005841 Bacteria 3632
51 Ga0068863_100090236 3300005841 Bacteria 2906
52 Ga0068863_100187577 3300005841 Bacteria 1987
53 Ga0068863_100697724 3300005841 Bacteria 1009
54 Ga0068858_100575691 3300005842 Bacteria 1091
55 Ga0068860_100000077 3300005843 Bacteria 171297
56 Ga0068860_100003451 3300005843 Bacteria 16259
57 Ga0068862_100000183 3300005844 Bacteria 68758
58 Ga0068862_100011020 3300005844 Bacteria 7470
59 Ga0068862_100024894 3300005844 Bacteria 5023
60 Ga0068862_100055197 3300005844 Bacteria 3403
61 Ga0068862_100233383 3300005844 Bacteria 1670
62 Ga0070717_10506191 3300006028 Bacteria 1092
63 Ga0075364_10005041 3300006051 Bacteria 7655
64 Ga0075369_10128095 3300006186 Bacteria 1152
65 Ga0068871_100698866 3300006358 Bacteria 929
66 Ga0075431_100506441 3300006847 Bacteria 1198
67 Ga0068865_100005249 3300006881 Bacteria 7831
68 Ga0097620_100001698 3300006931 Bacteria 22416
69 Ga0097620_100855906 3300006931 Bacteria 995
70 Ga0105240_10003418 3300009093 Bacteria 24667
71 Ga0105240_10091747 3300009093 Bacteria 3710
72 Ga0105240_10095791 3300009093 Bacteria 3618
73 Ga0105240_10455999 3300009093 Bacteria 1430
74 Ga0105240_10807718 3300009093 Unclassified 1015
75 Ga0105240_10876485 3300009093 Bacteria 967
76 Ga0105240_11201612 3300009093 Bacteria 803
77 Ga0105241_10150492 3300009174 Bacteria 1903
78 Ga0105242_10039370 3300009176 Bacteria 3804
79 Ga0105242_10597341 3300009176 Bacteria 1065
80 Ga0105242_10638966 3300009176 Bacteria 1033
81 Ga0105248_10001644 3300009177 Bacteria 24861
82 Ga0105248_10014093 3300009177 Bacteria 8796
83 Ga0105238_10016414 3300009551 Bacteria 7496
84 Ga0105238_10112053 3300009551 Bacteria 2708
85 Ga0105238_10116190 3300009551 Bacteria 2655
86 Ga0105238_10256084 3300009551 Bacteria 1729
87 Ga0105238_10414078 3300009551 Bacteria 1342
88 Ga0105249_10000838 3300009553 Bacteria 27558
89 Ga0105239_10118522 3300010375 Bacteria 2938
90 Ga0157373_10000879 3300013100 Bacteria 23263
91 Ga0157373_10015482 3300013100 Bacteria 5576
92 Ga0157370_10009953 3300013104 Bacteria 10063
93 Ga0157369_10455825 3300013105 Bacteria 1324
94 Ga0163162_10059972 3300013306 Bacteria 3838
95 Ga0163162_10116458 3300013306 Bacteria 2773
96 Ga0163162_11450565 3300013306 Bacteria 781
97 Ga0157375_10231940 3300013308 Bacteria 2005
98 Ga0163163_10012064 3300014325 Bacteria 7861
99 Ga0163163_10087223 3300014325 Bacteria 3131
100 Ga0163163_10248343 3300014325 Bacteria 1830
101 Ga0163163_10366028 3300014325 Bacteria 1499
102 Ga0163163_10477673 3300014325 Bacteria 1307
103 Ga0157380_10146663 3300014326 Bacteria 2034
104 Ga0157379_10018883 3300014968 Bacteria 6083
105 Ga0157376_10493932 3300014969 Bacteria 1201
106 Ga0213876_10008313 3300021384 Bacteria 5616
107 Ga0213876_10137202 3300021384 Bacteria 1301
108 Ga0213875_10000053 3300021388 Bacteria 141791
109 Ga0209676_1000140 3300025292 Bacteria 176735
110 Ga0209676_1002399 3300025292 Bacteria 13401
111 Ga0209758_1001380 3300025297 Bacteria 28958
112 Ga0209050_1000053 3300025298 Bacteria 349521
113 Ga0209050_1024805 3300025298 Bacteria 2061
114 Ga0209257_1000292 3300025304 Bacteria 110440
115 Ga0209257_1000419 3300025304 Bacteria 81956
116 Ga0209257_1002736 3300025304 Bacteria 16714
117 Ga0209257_1083598 3300025304 Bacteria 813
118 Ga0207680_10005098 3300025903 Bacteria 6260
119 Ga0207645_10152223 3300025907 Bacteria 1510
120 Ga0207705_10001195 3300025909 Bacteria 21043
121 Ga0207654_10210521 3300025911 Bacteria 1285
122 Ga0207707_10032448 3300025912 Bacteria 4571
123 Ga0207695_10000269 3300025913 Bacteria 130183
124 Ga0207695_10015201 3300025913 Bacteria 9077
125 Ga0207695_10076084 3300025913 Bacteria 3413
126 Ga0207660_10033019 3300025917 Bacteria 3576
127 Ga0207660_10116152 3300025917 Bacteria 2021
128 Ga0207657_10000235 3300025919 Bacteria 58394
129 Ga0207657_10238176 3300025919 Bacteria 1453
130 Ga0207652_10001724 3300025921 Bacteria 19078
131 Ga0207681_10229265 3300025923 Bacteria 1441
132 Ga0207694_10017435 3300025924 Bacteria 5428
133 Ga0207694_10105581 3300025924 Bacteria 2236
134 Ga0207694_10211805 3300025924 Bacteria 1579
135 Ga0207650_10000033 3300025925 Bacteria 226809
136 Ga0207644_10139634 3300025931 Bacteria 1864
137 Ga0207690_10000031 3300025932 Bacteria 154724
138 Ga0207690_10018445 3300025932 Bacteria 4280
139 Ga0207706_10047675 3300025933 Bacteria 3790
140 Ga0207686_10003342 3300025934 Bacteria 8616
141 Ga0207669_10614714 3300025937 Bacteria 885
142 Ga0207704_10004551 3300025938 Bacteria 6345
143 Ga0207711_10000331 3300025941 Bacteria 50472
144 Ga0207711_10035362 3300025941 Bacteria 4234
145 Ga0207711_10303855 3300025941 Bacteria 1472
146 Ga0207661_10261813 3300025944 Bacteria 1541
147 Ga0207679_10057794 3300025945 Bacteria 2871
148 Ga0207679_10181305 3300025945 Bacteria 1742
149 Ga0207667_10033523 3300025949 Bacteria 5520
150 Ga0207667_10263509 3300025949 Bacteria 1762
151 Ga0207651_10135321 3300025960 Bacteria 1894
152 Ga0207712_10000651 3300025961 Bacteria 27001
153 Ga0207668_10000004 3300025972 Bacteria 201204
154 Ga0207668_10000426 3300025972 Bacteria 26589
155 Ga0207668_10018347 3300025972 Bacteria 4400
156 Ga0207668_10021380 3300025972 Bacteria 4126
157 Ga0207668_10761865 3300025972 Bacteria 855
158 Ga0207658_10000229 3300025986 Bacteria 58984
159 Ga0207658_10024073 3300025986 Bacteria 4255
160 Ga0207658_10053000 3300025986 Bacteria 2995
161 Ga0207639_10036946 3300026041 Bacteria 3624
162 Ga0207702_10332147 3300026078 Bacteria 1450
163 Ga0207641_10001887 3300026088 Bacteria 20119
164 Ga0207641_10055756 3300026088 Bacteria 3356
165 Ga0207641_10076737 3300026088 Bacteria 2890
166 Ga0207676_10000068 3300026095 Bacteria 104705
167 Ga0207676_10041640 3300026095 Bacteria 3527
168 Ga0207676_10119436 3300026095 Bacteria 2220
169 Ga0207675_100030878 3300026118 Bacteria 4990
170 Ga0207683_10205676 3300026121 Bacteria 1790
171 Ga0207683_10282093 3300026121 Bacteria 1518
172 Ga0268266_10000003 3300028379 Bacteria 1701703
173 Ga0268266_10001373 3300028379 Bacteria 29333
174 Ga0268266_10004139 3300028379 Bacteria 14009
175 Ga0268266_10072903 3300028379 Bacteria 2979
176 Ga0268266_10084536 3300028379 Bacteria 2771
177 Ga0268266_10930695 3300028379 Bacteria 841
178 Ga0268265_10004547 3300028380 Bacteria 9593
179 Ga0268265_10103153 3300028380 Bacteria 2309
180 Ga0268265_10157983 3300028380 Bacteria 1921
181 Ga0268264_10000032 3300028381 Bacteria 408337
182 Ga0268264_10030197 3300028381 Bacteria 4443
183 Ga0265337_1003622 3300028556 Bacteria 6638
184 Ga0307517_10038138 3300028786 Bacteria 5336
185 Ga0265338_10019196 3300028800 Bacteria 7274
186 Ga0265338_10098538 3300028800 Bacteria 2391
187 Ga0307511_10004780 3300030521 Bacteria 13849
188 Ga0265327_10000331 3300031251 Bacteria 89636
189 Ga0265327_10000591 3300031251 Bacteria 60639
190 Ga0265327_10001088 3300031251 Bacteria 37825
191 Ga0307513_10025275 3300031456 Bacteria 6886
192 Ga0307508_10133853 3300031616 Bacteria 2082
193 Ga0265314_10277918 3300031711 Bacteria 949
194 Ga0307410_10121312 3300031852 Bacteria 1907
195 Ga0307406_10000963 3300031901 Bacteria 16112
196 Ga0307414_10018376 3300032004 Bacteria 4303
197 Ga0307414_10080312 3300032004 Bacteria 2384
198 Ga0307414_10101378 3300032004 Bacteria 2167
199 Ga0307414_10354385 3300032004 Bacteria 1260
200 Ga0307414_10395448 3300032004 Bacteria 1199
201 Ga0307414_10409354 3300032004 Bacteria 1180
202 Ga0307414_10545524 3300032004 Bacteria 1032
203 Ga0307411_10031616 3300032005 Bacteria 3260
204 Ga0373934_0013861 3300035086 Bacteria 3050
205 Ga0373944_0002545 3300035089 Bacteria 4631
206 Ga0373936_0001805 3300035113 Bacteria 7873
207 Ga0373939_0135141 3300035114 Bacteria 884
208 Ga0373957_0112990 3300035120 Bacteria 1095
209 Ga0373943_0139553 3300035170 Bacteria 1304
210 Ga0373943_0193036 3300035170 Bacteria 1124
211 Ga0373946_0141212 3300035171 Bacteria 1116
212 Ga0373955_0046631 3300035172 Bacteria 2343
213 Ga0373924_0022705 3300035410 Bacteria 2454
214 Ga0373927_0000111 3300035695 Bacteria 62031
215 Ga0373933_0000565 3300035724 Bacteria 23136
216 Ga0373933_0247848 3300035724 Bacteria 1147
217 Ga0373947_0039086 3300035725 Bacteria 2822
218 Ga0373947_0095102 3300035725 Bacteria 1864
219 Ga0373937_0006584 3300036401 Bacteria 10030
220 Ga0373937_0168962 3300036401 Bacteria 2052
221 Ga0373937_0464025 3300036401 Bacteria 1203
222 Ga0373925_0000209 3300037068 Bacteria 64086
223 Ga0373925_0021600 3300037068 Bacteria 4692
224 Ga0373925_0135379 3300037068 Bacteria 1925
225 Ga0395899_0002875 3300037312 Bacteria 13838
226 Ga0395899_0242936 3300037312 Bacteria 1238
227 Ga0395900_0000002 3300037418 Bacteria 671103
228 Ga0395900_0042203 3300037418 Bacteria 4699
229 Ga0395898_0004909 3300037466 Bacteria 14517
230 Ga0395898_0062705 3300037466 Bacteria 3610
231 Ga0395898_0134999 3300037466 Bacteria 2362
232 Ga0395898_0241605 3300037466 Bacteria 1722
233 Ga0395905_0076354 3300037471 Bacteria 3140
234 Ga0395905_0747593 3300037471 Bacteria 880
235 Ga0395905_0757329 3300037471 Bacteria 874
236 Ga0436364_0121626 3300037853 Bacteria 20150
237 Ga0395901_0000013 3300038443 Bacteria 375733
238 Ga0395901_0198689 3300038443 Bacteria 2102
239 Ga0395901_0221273 3300038443 Bacteria 1978
240 Ga0436365_0337983 3300039437 Bacteria 1329
241 Ga0436365_0961511 3300039437 Bacteria 5073
242 Ga0436360_1087198 3300039438 Bacteria 4982
243 Ga0466972_0183465 3300044658 Bacteria 981
244 Ga0466961_0131153 3300044693 Bacteria 1571
245 Ga0466961_0228974 3300044693 Bacteria 1144
246 Ga0466968_0031679 3300044735 Bacteria 2195
247 Ga0466967_0635463 3300045976 Bacteria 1055
248 Ga0495592_0025358 3300046454 Bacteria 4501
249 Ga0495629_0001993 3300046459 Bacteria 15861
250 Ga0495629_0083946 3300046459 Bacteria 2223
251 Ga0495638_0164743 3300046460 Bacteria 1276
252 Ga0495651_0000136 3300046462 Bacteria 54665
253 Ga0495653_0001743 3300046463 Bacteria 17165
254 Ga0495664_0173716 3300046477 Bacteria 1307
255 Ga0495583_0031132 3300046506 Bacteria 2590
256 Ga0495620_0026678 3300046515 Bacteria 2714
257 Ga0495628_0045069 3300046516 Bacteria 3508
258 Ga0495628_0059706 3300046516 Bacteria 2993
259 Ga0495631_0174729 3300046518 Bacteria 921
260 Ga0495643_0003478 3300046522 Bacteria 11494
261 Ga0495643_0294329 3300046522 Bacteria 742
262 Ga0495643_0323181 3300046522 Bacteria 697
263 Ga0495642_0055273 3300046528 Bacteria 1638
264 Ga0495652_0005586 3300046529 Bacteria 11817
265 Ga0495654_0040912 3300046530 Bacteria 2307
266 Ga0495665_0162625 3300046531 Bacteria 1163
267 Ga0495640_0001369 3300046533 Bacteria 19192
268 Ga0495587_0001140 3300046536 Bacteria 17405
269 Ga0495609_0018329 3300046538 Bacteria 3243
270 Ga0495597_0005187 3300046542 Bacteria 6937
271 Ga0495597_0005527 3300046542 Bacteria 6684
272 Ga0495645_0042832 3300046543 Bacteria 3301
273 Ga0495622_0006592 3300046557 Bacteria 5384
274 Ga0495633_0001899 3300046558 Bacteria 15216
275 Ga0495667_0000392 3300046559 Bacteria 27924
276 Ga0495668_0009231 3300046616 Bacteria 6069
277 Ga0495668_0045000 3300046616 Bacteria 2453
278 Ga0495668_0069443 3300046616 Bacteria 1937
279 Ga0495668_0205058 3300046616 Bacteria 1079
280 Ga0495634_0044299 3300046642 Bacteria 3012
281 Ga0495611_0010467 3300046648 Bacteria 3924
282 Ga0495611_0051424 3300046648 Bacteria 1857
283 Ga0495625_0087963 3300046660 Bacteria 2153
284 Ga0495635_0001645 3300046663 Bacteria 15067
285 Ga0495657_0002613 3300046675 Bacteria 15065
286 Ga0495599_0060536 3300046678 Bacteria 2367
287 Ga0495623_0001489 3300046679 Bacteria 15874
288 Ga0495646_0008281 3300046680 Bacteria 6610
289 Ga0495669_0044447 3300046684 Bacteria 1979
290 Ga0495624_0130445 3300046690 Bacteria 1541
291 Ga0495649_0000048 3300046694 Bacteria 118180
292 Ga0495600_0034397 3300046809 Bacteria 3289
293 Ga0495674_0000573 3300047319 Bacteria 34362
294 Ga0495674_0664516 3300047319 Bacteria 821
295 Ga0495672_0258491 3300047320 Bacteria 842
296 Ga0495680_0000285 3300047322 Bacteria 56843
297 Ga0495687_077061 3300047443 Bacteria 1318
298 Ga0495675_0008016 3300047444 Bacteria 6534
299 Ga0495677_0021352 3300047445 Bacteria 2347
300 Ga0495686_0011750 3300047472 Bacteria 6164
301 Ga0495602_0002627 3300048088 Bacteria 18358
302 Ga0495602_0184807 3300048088 Bacteria 1604
303 Ga0496100_0171874 3300048903 Bacteria 1561
304 Ga0496101_0319438 3300048904 Bacteria 1218
305 Ga0496102_0049042 3300048905 Bacteria 3841
306 Ga0496102_0344027 3300048905 Bacteria 1404
307 Ga0496103_0192531 3300048906 Bacteria 1311
308 Ga0496106_0131962 3300048909 Bacteria 1960
309 Ga0496109_0004453 3300048912 Bacteria 11699
310 Ga0496112_0012413 3300048915 Bacteria 7832
311 Ga0496112_0057392 3300048915 Bacteria 3833
312 Ga0496112_0081507 3300048915 Bacteria 3200
313 Ga0496115_0001609 3300048918 Bacteria 16223
314 Ga0496115_0003176 3300048918 Bacteria 11807
315 Ga0496115_0023013 3300048918 Bacteria 4833
316 Ga0496115_0035491 3300048918 Bacteria 3945
317 Ga0496115_0154124 3300048918 Bacteria 1898
318 Ga0496116_0076875 3300048919 Bacteria 2089
319 Ga0496122_0002925 3300048925 Bacteria 23284
320 Ga0496123_0005419 3300048926 Bacteria 12853
321 Ga0496125_0004796 3300048928 Bacteria 15397
322 Ga0495682_0051463 3300049460 Bacteria 1498
323 Ga0501034_0005426 3300049571 Bacteria 13941
324 Ga0501034_0355036 3300049571 Bacteria 1394
325 Ga0501036_0143828 3300049572 Bacteria 2012
326 Ga0501037_0043920 3300049573 Bacteria 3284
327 Ga0501037_0230604 3300049573 Bacteria 1300
328 Ga0501047_0007096 3300049581 Bacteria 10520
329 Ga0501047_0058652 3300049581 Bacteria 3718
330 Ga0501047_0208033 3300049581 Bacteria 1816
331 Ga0501047_0278951 3300049581 Bacteria 1516
332 Ga0501044_0003338 3300049823 Bacteria 18099
333 Ga0501044_0019605 3300049823 Bacteria 7231
334 Ga0501044_0212173 3300049823 Bacteria 1890
335 nmdc:mga00v17_1658_c1 3300050491 Bacteria 11600
336 nmdc:mga06z11_20990_c1 3300050494 Bacteria 3028
337 nmdc:mga05p37_632927_c1 3300050507 Bacteria 1201
338 nmdc:mga06r32_257055_c1 3300050510 Bacteria 1734
339 nmdc:mga0sz30_49639_c1 3300050516 Bacteria 1778
340 Ga0495601_0348829 3300053077 Bacteria 962
341 Ga0495612_0029595 3300053078 Bacteria 2206
342 Ga0495595_0000996 3300053084 Bacteria 10935
343 Ga0495619_0000309 3300053085 Bacteria 34322
344 Ga0500578_0162040 3300053086 Bacteria 1387
345 Ga0500644_0048681 3300053088 Bacteria 1443
346 Ga0500583_0036900 3300053092 Bacteria 2192
347 Ga0500651_0008681 3300053093 Bacteria 5998
348 Ga0500651_0105076 3300053093 Bacteria 1728
349 Ga0500566_0026071 3300053094 Bacteria 3423
350 Ga0500650_0166730 3300053098 Bacteria 1014
351 Ga0500569_012335 3300053109 Bacteria 2064
352 Ga0500594_0061492 3300053118 Bacteria 1084
353 Ga0500595_018532 3300053119 Bacteria 2543
354 Ga0500595_069959 3300053119 Bacteria 1043
355 Ga0500607_148439 3300053121 Bacteria 1091
356 Ga0500608_039611 3300053122 Bacteria 2256
357 Ga0500652_202915 3300053131 Bacteria 804
358 Ga0500655_009628 3300053133 Bacteria 1744
359 Ga0500559_0003202 3300053136 Bacteria 8138
360 Ga0500590_004837 3300053148 Bacteria 6422
361 Ga0500619_021130 3300053154 Bacteria 1870
362 Ga0500620_089906 3300053155 Bacteria 1069
363 Ga0500637_0050315 3300053178 Bacteria 2373
364 Ga0500576_058127 3300053725 Bacteria 1698
365 Ga0500625_015593 3300053729 Bacteria 3529
366 Ga0500645_000539 3300053730 Bacteria 25211
367 Ga0500552_025931 3300053733 Bacteria 871
368 Ga0500596_003607 3300053735 Bacteria 2916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100383191 Ga0070668_1003831912 195
2 3300028379 Ga0268266_10072903 Ga0268266_100729032 195
3 3300005548 Ga0070665_100053905 Ga0070665_1000539054 197
4 3300006051 Ga0075364_10005041 Ga0075364_100050416 197
5 3300006186 Ga0075369_10128095 Ga0075369_101280952 197
6 3300047320 Ga0495672_0258491 Ga0495672_0258491_48_713 197
7 3300050491 nmdc:mga00v17_1658_c1 nmdc:mga00v17_1658_c1_5068_5730 197
8 3300050516 nmdc:mga0sz30_49639_c1 nmdc:mga0sz30_49639_c1_238_900 197
9 3300005618 Ga0068864_100303747 Ga0068864_1003037472 199
10 3300006881 Ga0068865_100005249 Ga0068865_1000052498 199
11 3300014325 Ga0163163_10366028 Ga0163163_103660282 199
12 3300025938 Ga0207704_10004551 Ga0207704_100045516 199
13 3300049581 Ga0501047_0278951 Ga0501047_0278951_50_745 199
14 3300005563 Ga0068855_100232516 Ga0068855_1002325163 202
15 3300005578 Ga0068854_100090723 Ga0068854_1000907232 202
16 3300005353 Ga0070669_100326733 Ga0070669_1003267332 203
17 3300048915 Ga0496112_0081507 Ga0496112_0081507_2327_3004 203
18 3300005844 Ga0068862_100233383 Ga0068862_1002333832 204
19 3300025972 Ga0207668_10018347 Ga0207668_100183475 204
20 3300005262 Ga0065165_1003306 Ga0065165_100330611 205
21 3300005456 Ga0070678_100202837 Ga0070678_1002028372 205
22 3300005458 Ga0070681_10001804 Ga0070681_100018049 205
23 3300005539 Ga0068853_100052073 Ga0068853_1000520732 205
24 3300005539 Ga0068853_100073631 Ga0068853_1000736312 205
25 3300005548 Ga0070665_100699013 Ga0070665_1006990132 205
26 3300005564 Ga0070664_100075655 Ga0070664_1000756552 205
27 3300013100 Ga0157373_10000879 Ga0157373_100008798 205
28 3300013100 Ga0157373_10015482 Ga0157373_100154826 205
29 3300025907 Ga0207645_10152223 Ga0207645_101522232 205
30 3300025909 Ga0207705_10001195 Ga0207705_100011952 205
31 3300025912 Ga0207707_10032448 Ga0207707_100324486 205
32 3300025917 Ga0207660_10033019 Ga0207660_100330195 205
33 3300025919 Ga0207657_10000235 Ga0207657_1000023526 205
34 3300025919 Ga0207657_10238176 Ga0207657_102381762 205
35 3300025921 Ga0207652_10001724 Ga0207652_100017248 205
36 3300025932 Ga0207690_10018445 Ga0207690_100184452 205
37 3300025934 Ga0207686_10003342 Ga0207686_100033422 205
38 3300025945 Ga0207679_10057794 Ga0207679_100577942 205
39 3300025949 Ga0207667_10033523 Ga0207667_100335233 205
40 3300026041 Ga0207639_10036946 Ga0207639_100369464 205
41 3300026078 Ga0207702_10332147 Ga0207702_103321472 205
42 3300026121 Ga0207683_10282093 Ga0207683_102820932 205
43 3300028379 Ga0268266_10084536 Ga0268266_100845362 205
44 3300031616 Ga0307508_10133853 Ga0307508_101338532 205
45 3300031852 Ga0307410_10121312 Ga0307410_101213122 205
46 3300032005 Ga0307411_10031616 Ga0307411_100316164 205
47 3300036401 Ga0373937_0464025 Ga0373937_0464025_362_1009 205
48 3300037312 Ga0395899_0242936 Ga0395899_0242936_303_935 205
49 3300037418 Ga0395900_0042203 Ga0395900_0042203_2103_2762 205
50 3300037466 Ga0395898_0062705 Ga0395898_0062705_827_1486 205
51 3300037466 Ga0395898_0241605 Ga0395898_0241605_1047_1679 205
52 3300037471 Ga0395905_0076354 Ga0395905_0076354_2255_2914 205
53 3300048909 Ga0496106_0131962 Ga0496106_0131962_673_1323 205
54 3300048918 Ga0496115_0023013 Ga0496115_0023013_3579_4214 205
55 3300048918 Ga0496115_0035491 Ga0496115_0035491_1320_1940 205
56 3300048918 Ga0496115_0154124 Ga0496115_0154124_953_1603 205
57 iso_pu_bacteria 2643221614 2644087633 205
58 iso_pu_bacteria 2643221661 2644344323 205
59 iso_pu_bacteria 2643221666 2644366992 205
60 iso_pu_bacteria 2928972540 2928974608 205
61 iso_pu_bacteria 2977240413 2977243531 205
62 3300005355 Ga0070671_100088253 Ga0070671_1000882531 206
63 3300005456 Ga0070678_100135744 Ga0070678_1001357442 206
64 3300005564 Ga0070664_100230851 Ga0070664_1002308512 206
65 3300005618 Ga0068864_100042690 Ga0068864_1000426905 206
66 3300005841 Ga0068863_100058955 Ga0068863_1000589555 206
67 3300005844 Ga0068862_100024894 Ga0068862_1000248944 206
68 3300009093 Ga0105240_10807718 Ga0105240_108077181 206
69 3300013306 Ga0163162_10059972 Ga0163162_100599722 206
70 3300013308 Ga0157375_10231940 Ga0157375_102319402 206
71 3300014969 Ga0157376_10493932 Ga0157376_104939322 206
72 3300025931 Ga0207644_10139634 Ga0207644_101396342 206
73 3300025933 Ga0207706_10047675 Ga0207706_100476755 206
74 3300025941 Ga0207711_10303855 Ga0207711_103038552 206
75 3300025945 Ga0207679_10181305 Ga0207679_101813052 206
76 3300025960 Ga0207651_10135321 Ga0207651_101353212 206
77 3300026088 Ga0207641_10055756 Ga0207641_100557562 206
78 3300026095 Ga0207676_10041640 Ga0207676_100416404 206
79 3300026121 Ga0207683_10205676 Ga0207683_102056762 206
80 3300028380 Ga0268265_10103153 Ga0268265_101031532 206
81 3300028800 Ga0265338_10019196 Ga0265338_100191968 206
82 3300031251 Ga0265327_10000591 Ga0265327_100005915 206
83 3300031251 Ga0265327_10001088 Ga0265327_100010882 206
84 3300032004 Ga0307414_10354385 Ga0307414_103543852 206
85 3300032004 Ga0307414_10409354 Ga0307414_104093542 206
86 3300032004 Ga0307414_10545524 Ga0307414_105455241 206
87 3300035114 Ga0373939_0135141 Ga0373939_0135141_36_683 206
88 3300037471 Ga0395905_0747593 Ga0395905_0747593_122_781 206
89 3300038443 Ga0395901_0198689 Ga0395901_0198689_951_1610 206
90 3300039438 Ga0436360_1087198 Ga0436360_1087198_951_1607 206
91 3300046460 Ga0495638_0164743 Ga0495638_0164743_421_1053 206
92 3300046528 Ga0495642_0055273 Ga0495642_0055273_465_1085 206
93 3300046684 Ga0495669_0044447 Ga0495669_0044447_363_983 206
94 3300046694 Ga0495649_0000048 Ga0495649_0000048_110123_110755 206
95 3300048904 Ga0496101_0319438 Ga0496101_0319438_417_1094 206
96 3300048905 Ga0496102_0049042 Ga0496102_0049042_251_928 206
97 3300048906 Ga0496103_0192531 Ga0496103_0192531_301_978 206
98 3300048912 Ga0496109_0004453 Ga0496109_0004453_7730_8407 206
99 3300048915 Ga0496112_0057392 Ga0496112_0057392_2794_3471 206
100 3300005341 Ga0070691_10078062 Ga0070691_100780622 207
101 3300005458 Ga0070681_10558454 Ga0070681_105584542 207
102 3300005547 Ga0070693_100126496 Ga0070693_1001264962 207
103 3300006358 Ga0068871_100698866 Ga0068871_1006988661 207
104 3300009093 Ga0105240_10095791 Ga0105240_100957912 207
105 3300009176 Ga0105242_10597341 Ga0105242_105973412 207
106 3300013306 Ga0163162_11450565 Ga0163162_114505652 207
107 3300014325 Ga0163163_10087223 Ga0163163_100872232 207
108 3300025913 Ga0207695_10076084 Ga0207695_100760843 207
109 3300025937 Ga0207669_10614714 Ga0207669_106147141 207
110 3300025944 Ga0207661_10261813 Ga0207661_102618132 207
111 3300028556 Ga0265337_1003622 Ga0265337_10036226 207
112 3300031251 Ga0265327_10000331 Ga0265327_1000033190 207
113 3300032004 Ga0307414_10101378 Ga0307414_101013782 207
114 3300035170 Ga0373943_0193036 Ga0373943_0193036_396_1046 207
115 3300037068 Ga0373925_0021600 Ga0373925_0021600_2889_3539 207
116 3300044693 Ga0466961_0228974 Ga0466961_0228974_139_789 207
117 3300046542 Ga0495597_0005527 Ga0495597_0005527_232_912 207
118 3300046616 Ga0495668_0205058 Ga0495668_0205058_116_796 207
119 3300048919 Ga0496116_0076875 Ga0496116_0076875_1414_2037 207
120 3300048928 Ga0496125_0004796 Ga0496125_0004796_13619_14242 207
121 3300049571 Ga0501034_0005426 Ga0501034_0005426_580_1242 207
122 3300049573 Ga0501037_0043920 Ga0501037_0043920_719_1381 207
123 3300049581 Ga0501047_0007096 Ga0501047_0007096_2590_3240 207
124 3300049581 Ga0501047_0058652 Ga0501047_0058652_509_1171 207
125 3300049581 Ga0501047_0208033 Ga0501047_0208033_852_1505 207
126 3300049823 Ga0501044_0003338 Ga0501044_0003338_812_1474 207
127 3300049823 Ga0501044_0212173 Ga0501044_0212173_342_995 207
128 iso_pu_bacteria 2928531327 2928532172 207
129 3300014325 Ga0163163_10248343 Ga0163163_102483432 208
130 3300021384 Ga0213876_10137202 Ga0213876_101372021 208
131 3300028800 Ga0265338_10098538 Ga0265338_100985382 208
132 3300036401 Ga0373937_0168962 Ga0373937_0168962_454_1113 208
133 3300039437 Ga0436365_0337983 Ga0436365_0337983_659_1291 208
134 3300045976 Ga0466967_0635463 Ga0466967_0635463_105_764 208
135 3300046522 Ga0495643_0323181 Ga0495643_0323181_32_658 208
136 3300049571 Ga0501034_0355036 Ga0501034_0355036_500_1159 208
137 3300050507 nmdc:mga05p37_632927_c1 nmdc:mga05p37_632927_c1_436_1131 208
138 3300050510 nmdc:mga06r32_257055_c1 nmdc:mga06r32_257055_c1_684_1379 208
139 3300003791 Ga0055530_10000313 Ga0055530_1000031316 209
140 3300003794 Ga0055531_10005382 Ga0055531_100053823 209
141 3300003794 Ga0055531_10008950 Ga0055531_100089504 209
142 3300005262 Ga0065165_1023846 Ga0065165_10238462 209
143 3300005327 Ga0070658_10337567 Ga0070658_103375671 209
144 3300005331 Ga0070670_100000004 Ga0070670_100000004127 209
145 3300005334 Ga0068869_101022944 Ga0068869_1010229441 209
146 3300005335 Ga0070666_10022684 Ga0070666_100226842 209
147 3300005336 Ga0070680_100097190 Ga0070680_1000971902 209
148 3300005341 Ga0070691_10028902 Ga0070691_100289022 209
149 3300005347 Ga0070668_100001643 Ga0070668_1000016437 209
150 3300005347 Ga0070668_100002624 Ga0070668_1000026249 209
151 3300005347 Ga0070668_100021118 Ga0070668_1000211184 209
152 3300005356 Ga0070674_100571534 Ga0070674_1005715341 209
153 3300005367 Ga0070667_100000105 Ga0070667_10000010510 209
154 3300005367 Ga0070667_100029043 Ga0070667_1000290432 209
155 3300005367 Ga0070667_100080910 Ga0070667_1000809102 209
156 3300005535 Ga0070684_100706990 Ga0070684_1007069902 209
157 3300005548 Ga0070665_100000198 Ga0070665_10000019833 209
158 3300005548 Ga0070665_100000721 Ga0070665_1000007212 209
159 3300005548 Ga0070665_100001194 Ga0070665_10000119427 209
160 3300005549 Ga0070704_100254485 Ga0070704_1002544852 209
161 3300005563 Ga0068855_100073731 Ga0068855_1000737314 209
162 3300005617 Ga0068859_100001699 Ga0068859_1000016993 209
163 3300005617 Ga0068859_100855931 Ga0068859_1008559312 209
164 3300005618 Ga0068864_100000082 Ga0068864_100000082104 209
165 3300005618 Ga0068864_100154609 Ga0068864_1001546092 209
166 3300005719 Ga0068861_100558137 Ga0068861_1005581372 209
167 3300005841 Ga0068863_100000560 Ga0068863_10000056027 209
168 3300005841 Ga0068863_100090236 Ga0068863_1000902363 209
169 3300005841 Ga0068863_100187577 Ga0068863_1001875772 209
170 3300005841 Ga0068863_100697724 Ga0068863_1006977242 209
171 3300005842 Ga0068858_100575691 Ga0068858_1005756912 209
172 3300005843 Ga0068860_100000077 Ga0068860_100000077127 209
173 3300005843 Ga0068860_100003451 Ga0068860_10000345115 209
174 3300005844 Ga0068862_100000183 Ga0068862_1000001836 209
175 3300005844 Ga0068862_100011020 Ga0068862_1000110203 209
176 3300005844 Ga0068862_100055197 Ga0068862_1000551973 209
177 3300006028 Ga0070717_10506191 Ga0070717_105061912 209
178 3300006847 Ga0075431_100506441 Ga0075431_1005064412 209
179 3300006931 Ga0097620_100001698 Ga0097620_10000169820 209
180 3300006931 Ga0097620_100855906 Ga0097620_1008559062 209
181 3300009093 Ga0105240_10003418 Ga0105240_100034187 209
182 3300009093 Ga0105240_10091747 Ga0105240_100917472 209
183 3300009093 Ga0105240_10455999 Ga0105240_104559992 209
184 3300009093 Ga0105240_10876485 Ga0105240_108764852 209
185 3300009093 Ga0105240_11201612 Ga0105240_112016122 209
186 3300009174 Ga0105241_10150492 Ga0105241_101504922 209
187 3300009176 Ga0105242_10039370 Ga0105242_100393702 209
188 3300009176 Ga0105242_10638966 Ga0105242_106389662 209
189 3300009177 Ga0105248_10001644 Ga0105248_100016442 209
190 3300009177 Ga0105248_10014093 Ga0105248_100140933 209
191 3300009551 Ga0105238_10016414 Ga0105238_100164143 209
192 3300009551 Ga0105238_10112053 Ga0105238_101120532 209
193 3300009551 Ga0105238_10116190 Ga0105238_101161902 209
194 3300009551 Ga0105238_10256084 Ga0105238_102560842 209
195 3300009551 Ga0105238_10414078 Ga0105238_104140782 209
196 3300009553 Ga0105249_10000838 Ga0105249_100008384 209
197 3300010375 Ga0105239_10118522 Ga0105239_101185222 209
198 3300013104 Ga0157370_10009953 Ga0157370_100099539 209
199 3300013105 Ga0157369_10455825 Ga0157369_104558252 209
200 3300013306 Ga0163162_10116458 Ga0163162_101164582 209
201 3300014325 Ga0163163_10012064 Ga0163163_100120646 209
202 3300014325 Ga0163163_10477673 Ga0163163_104776732 209
203 3300014326 Ga0157380_10146663 Ga0157380_101466632 209
204 3300014968 Ga0157379_10018883 Ga0157379_100188833 209
205 3300021384 Ga0213876_10008313 Ga0213876_100083137 209
206 3300021388 Ga0213875_10000053 Ga0213875_1000005365 209
207 3300025292 Ga0209676_1000140 Ga0209676_100014065 209
208 3300025292 Ga0209676_1002399 Ga0209676_10023997 209
209 3300025297 Ga0209758_1001380 Ga0209758_100138014 209
210 3300025298 Ga0209050_1000053 Ga0209050_100005378 209
211 3300025298 Ga0209050_1024805 Ga0209050_10248052 209
212 3300025304 Ga0209257_1000292 Ga0209257_100029225 209
213 3300025304 Ga0209257_1000419 Ga0209257_100041970 209
214 3300025304 Ga0209257_1002736 Ga0209257_100273611 209
215 3300025304 Ga0209257_1083598 Ga0209257_10835982 209
216 3300025903 Ga0207680_10005098 Ga0207680_100050986 209
217 3300025911 Ga0207654_10210521 Ga0207654_102105212 209
218 3300025913 Ga0207695_10000269 Ga0207695_1000026984 209
219 3300025913 Ga0207695_10015201 Ga0207695_100152016 209
220 3300025917 Ga0207660_10116152 Ga0207660_101161522 209
221 3300025923 Ga0207681_10229265 Ga0207681_102292651 209
222 3300025924 Ga0207694_10017435 Ga0207694_100174355 209
223 3300025924 Ga0207694_10105581 Ga0207694_101055812 209
224 3300025924 Ga0207694_10211805 Ga0207694_102118052 209
225 3300025925 Ga0207650_10000033 Ga0207650_10000033221 209
226 3300025932 Ga0207690_10000031 Ga0207690_1000003189 209
227 3300025941 Ga0207711_10000331 Ga0207711_1000033146 209
228 3300025941 Ga0207711_10035362 Ga0207711_100353622 209
229 3300025949 Ga0207667_10263509 Ga0207667_102635092 209
230 3300025961 Ga0207712_10000651 Ga0207712_100006514 209
231 3300025972 Ga0207668_10000004 Ga0207668_1000000490 209
232 3300025972 Ga0207668_10000426 Ga0207668_100004266 209
233 3300025972 Ga0207668_10021380 Ga0207668_100213802 209
234 3300025972 Ga0207668_10761865 Ga0207668_107618652 209
235 3300025986 Ga0207658_10000229 Ga0207658_1000022960 209
236 3300025986 Ga0207658_10024073 Ga0207658_100240734 209
237 3300025986 Ga0207658_10053000 Ga0207658_100530002 209
238 3300026088 Ga0207641_10001887 Ga0207641_100018876 209
239 3300026088 Ga0207641_10076737 Ga0207641_100767373 209
240 3300026095 Ga0207676_10000068 Ga0207676_1000006887 209
241 3300026095 Ga0207676_10119436 Ga0207676_101194362 209
242 3300026118 Ga0207675_100030878 Ga0207675_1000308783 209
243 3300028379 Ga0268266_10000003 Ga0268266_100000031449 209
244 3300028379 Ga0268266_10001373 Ga0268266_100013739 209
245 3300028379 Ga0268266_10004139 Ga0268266_100041396 209
246 3300028379 Ga0268266_10930695 Ga0268266_109306951 209
247 3300028380 Ga0268265_10004547 Ga0268265_100045473 209
248 3300028380 Ga0268265_10157983 Ga0268265_101579832 209
249 3300028381 Ga0268264_10000032 Ga0268264_10000032288 209
250 3300028381 Ga0268264_10030197 Ga0268264_100301973 209
251 3300028786 Ga0307517_10038138 Ga0307517_100381383 209
252 3300030521 Ga0307511_10004780 Ga0307511_100047806 209
253 3300031456 Ga0307513_10025275 Ga0307513_100252753 209
254 3300031711 Ga0265314_10277918 Ga0265314_102779181 209
255 3300031901 Ga0307406_10000963 Ga0307406_1000096317 209
256 3300032004 Ga0307414_10018376 Ga0307414_100183763 209
257 3300032004 Ga0307414_10080312 Ga0307414_100803122 209
258 3300032004 Ga0307414_10395448 Ga0307414_103954481 209
259 3300035086 Ga0373934_0013861 Ga0373934_0013861_544_1266 209
260 3300035089 Ga0373944_0002545 Ga0373944_0002545_1335_2000 209
261 3300035113 Ga0373936_0001805 Ga0373936_0001805_1802_2467 209
262 3300035120 Ga0373957_0112990 Ga0373957_0112990_117_839 209
263 3300035170 Ga0373943_0139553 Ga0373943_0139553_601_1266 209
264 3300035171 Ga0373946_0141212 Ga0373946_0141212_77_742 209
265 3300035172 Ga0373955_0046631 Ga0373955_0046631_51_743 209
266 3300035410 Ga0373924_0022705 Ga0373924_0022705_843_1565 209
267 3300035695 Ga0373927_0000111 Ga0373927_0000111_12815_13480 209
268 3300035724 Ga0373933_0000565 Ga0373933_0000565_22037_22759 209
269 3300035724 Ga0373933_0247848 Ga0373933_0247848_407_1087 209
270 3300035725 Ga0373947_0039086 Ga0373947_0039086_990_1712 209
271 3300035725 Ga0373947_0095102 Ga0373947_0095102_1144_1809 209
272 3300036401 Ga0373937_0006584 Ga0373937_0006584_1801_2523 209
273 3300037068 Ga0373925_0000209 Ga0373925_0000209_50620_51285 209
274 3300037068 Ga0373925_0135379 Ga0373925_0135379_603_1325 209
275 3300037312 Ga0395899_0002875 Ga0395899_0002875_5471_6121 209
276 3300037418 Ga0395900_0000002 Ga0395900_0000002_332974_333624 209
277 3300037466 Ga0395898_0004909 Ga0395898_0004909_5134_5784 209
278 3300037466 Ga0395898_0134999 Ga0395898_0134999_143_799 209
279 3300037471 Ga0395905_0757329 Ga0395905_0757329_183_824 209
280 3300037853 Ga0436364_0121626 Ga0436364_0121626_10541_11218 209
281 3300038443 Ga0395901_0000013 Ga0395901_0000013_370161_370811 209
282 3300038443 Ga0395901_0221273 Ga0395901_0221273_201_857 209
283 3300039437 Ga0436365_0961511 Ga0436365_0961511_2285_2947 209
284 3300044658 Ga0466972_0183465 Ga0466972_0183465_167_823 209
285 3300044693 Ga0466961_0131153 Ga0466961_0131153_628_1284 209
286 3300044735 Ga0466968_0031679 Ga0466968_0031679_1294_1950 209
287 3300046454 Ga0495592_0025358 Ga0495592_0025358_3576_4298 209
288 3300046459 Ga0495629_0001993 Ga0495629_0001993_12801_13523 209
289 3300046459 Ga0495629_0083946 Ga0495629_0083946_79_744 209
290 3300046462 Ga0495651_0000136 Ga0495651_0000136_13701_14423 209
291 3300046463 Ga0495653_0001743 Ga0495653_0001743_6029_6751 209
292 3300046477 Ga0495664_0173716 Ga0495664_0173716_493_1215 209
293 3300046506 Ga0495583_0031132 Ga0495583_0031132_1548_2213 209
294 3300046515 Ga0495620_0026678 Ga0495620_0026678_1673_2338 209
295 3300046516 Ga0495628_0045069 Ga0495628_0045069_1143_1799 209
296 3300046516 Ga0495628_0059706 Ga0495628_0059706_1501_2223 209
297 3300046518 Ga0495631_0174729 Ga0495631_0174729_193_858 209
298 3300046522 Ga0495643_0003478 Ga0495643_0003478_1019_1684 209
299 3300046522 Ga0495643_0294329 Ga0495643_0294329_56_685 209
300 3300046529 Ga0495652_0005586 Ga0495652_0005586_8137_8859 209
301 3300046530 Ga0495654_0040912 Ga0495654_0040912_294_959 209
302 3300046531 Ga0495665_0162625 Ga0495665_0162625_67_789 209
303 3300046533 Ga0495640_0001369 Ga0495640_0001369_8941_9663 209
304 3300046536 Ga0495587_0001140 Ga0495587_0001140_7697_8419 209
305 3300046538 Ga0495609_0018329 Ga0495609_0018329_1755_2420 209
306 3300046542 Ga0495597_0005187 Ga0495597_0005187_3285_3950 209
307 3300046543 Ga0495645_0042832 Ga0495645_0042832_1138_1794 209
308 3300046557 Ga0495622_0006592 Ga0495622_0006592_3475_4140 209
309 3300046558 Ga0495633_0001899 Ga0495633_0001899_4101_4733 209
310 3300046559 Ga0495667_0000392 Ga0495667_0000392_22246_22968 209
311 3300046616 Ga0495668_0009231 Ga0495668_0009231_4822_5451 209
312 3300046616 Ga0495668_0045000 Ga0495668_0045000_409_1074 209
313 3300046616 Ga0495668_0069443 Ga0495668_0069443_1004_1669 209
314 3300046642 Ga0495634_0044299 Ga0495634_0044299_860_1582 209
315 3300046648 Ga0495611_0010467 Ga0495611_0010467_1271_1948 209
316 3300046648 Ga0495611_0051424 Ga0495611_0051424_414_1079 209
317 3300046660 Ga0495625_0087963 Ga0495625_0087963_955_1620 209
318 3300046663 Ga0495635_0001645 Ga0495635_0001645_9587_10309 209
319 3300046675 Ga0495657_0002613 Ga0495657_0002613_6357_7079 209
320 3300046678 Ga0495599_0060536 Ga0495599_0060536_1332_2054 209
321 3300046679 Ga0495623_0001489 Ga0495623_0001489_5703_6425 209
322 3300046680 Ga0495646_0008281 Ga0495646_0008281_1891_2613 209
323 3300046690 Ga0495624_0130445 Ga0495624_0130445_548_1213 209
324 3300046809 Ga0495600_0034397 Ga0495600_0034397_1982_2704 209
325 3300047319 Ga0495674_0000573 Ga0495674_0000573_11579_12301 209
326 3300047319 Ga0495674_0664516 Ga0495674_0664516_93_749 209
327 3300047322 Ga0495680_0000285 Ga0495680_0000285_22165_22887 209
328 3300047443 Ga0495687_077061 Ga0495687_077061_517_1182 209
329 3300047444 Ga0495675_0008016 Ga0495675_0008016_1891_2613 209
330 3300047445 Ga0495677_0021352 Ga0495677_0021352_610_1287 209
331 3300047472 Ga0495686_0011750 Ga0495686_0011750_2958_3587 209
332 3300048088 Ga0495602_0002627 Ga0495602_0002627_10504_11226 209
333 3300048088 Ga0495602_0184807 Ga0495602_0184807_417_1082 209
334 3300048903 Ga0496100_0171874 Ga0496100_0171874_609_1286 209
335 3300048905 Ga0496102_0344027 Ga0496102_0344027_653_1315 209
336 3300048915 Ga0496112_0012413 Ga0496112_0012413_4921_5577 209
337 3300048918 Ga0496115_0001609 Ga0496115_0001609_9973_10641 209
338 3300048918 Ga0496115_0003176 Ga0496115_0003176_4675_5331 209
339 3300048925 Ga0496122_0002925 Ga0496122_0002925_22221_22853 209
340 3300048926 Ga0496123_0005419 Ga0496123_0005419_11881_12513 209
341 3300049460 Ga0495682_0051463 Ga0495682_0051463_375_1040 209
342 3300049572 Ga0501036_0143828 Ga0501036_0143828_1181_1834 209
343 3300049573 Ga0501037_0230604 Ga0501037_0230604_151_804 209
344 3300049823 Ga0501044_0019605 Ga0501044_0019605_4659_5312 209
345 3300050494 nmdc:mga06z11_20990_c1 nmdc:mga06z11_20990_c1_1974_2636 209
346 3300053077 Ga0495601_0348829 Ga0495601_0348829_59_781 209
347 3300053078 Ga0495612_0029595 Ga0495612_0029595_59_781 209
348 3300053084 Ga0495595_0000996 Ga0495595_0000996_7034_7756 209
349 3300053085 Ga0495619_0000309 Ga0495619_0000309_14228_14950 209
350 3300053086 Ga0500578_0162040 Ga0500578_0162040_219_884 209
351 3300053088 Ga0500644_0048681 Ga0500644_0048681_798_1427 209
352 3300053092 Ga0500583_0036900 Ga0500583_0036900_1137_1802 209
353 3300053093 Ga0500651_0008681 Ga0500651_0008681_4186_4851 209
354 3300053093 Ga0500651_0105076 Ga0500651_0105076_328_957 209
355 3300053094 Ga0500566_0026071 Ga0500566_0026071_391_1056 209
356 3300053098 Ga0500650_0166730 Ga0500650_0166730_137_802 209
357 3300053109 Ga0500569_012335 Ga0500569_012335_991_1656 209
358 3300053118 Ga0500594_0061492 Ga0500594_0061492_55_720 209
359 3300053119 Ga0500595_018532 Ga0500595_018532_579_1244 209
360 3300053119 Ga0500595_069959 Ga0500595_069959_155_784 209
361 3300053121 Ga0500607_148439 Ga0500607_148439_396_1061 209
362 3300053122 Ga0500608_039611 Ga0500608_039611_1195_1860 209
363 3300053131 Ga0500652_202915 Ga0500652_202915_86_760 209
364 3300053133 Ga0500655_009628 Ga0500655_009628_1020_1685 209
365 3300053136 Ga0500559_0003202 Ga0500559_0003202_5050_5715 209
366 3300053148 Ga0500590_004837 Ga0500590_004837_4026_4691 209
367 3300053154 Ga0500619_021130 Ga0500619_021130_395_1060 209
368 3300053155 Ga0500620_089906 Ga0500620_089906_72_737 209
369 3300053178 Ga0500637_0050315 Ga0500637_0050315_1299_1964 209
370 3300053725 Ga0500576_058127 Ga0500576_058127_969_1634 209
371 3300053729 Ga0500625_015593 Ga0500625_015593_394_1059 209
372 3300053730 Ga0500645_000539 Ga0500645_000539_12838_13467 209
373 3300053733 Ga0500552_025931 Ga0500552_025931_186_851 209
374 3300053735 Ga0500596_003607 Ga0500596_003607_1208_1873 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

66

243

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.7989 1 208
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.7922 1 208
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.7823 8 209
7cfe-assembly1.cif.gz_A crystal structure of rsmg methyltransferase of m. tuberculosis 0.7821 1 209
7cfe-assembly1.cif.gz_A crystal structure of rsmg methyltransferase of m. tuberculosis 0.7787 1 209
ID Description Score Start End Superfamily
af_P9WGW9_11_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8446 17 202 3.40.50.150
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8202 16 209 3.40.50.150
af_Q2FUQ4_1_237_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8123 6 209 3.40.50.150
af_Q54UI9_3_272_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8006 56 139 3.40.50.150
af_A0A1D6H089_1_96_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7967 94 152 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A841M2T0-F1-model_v4 deleted 0.9845 4 207
AF-B4RCZ9-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9819 1 207 GO:0005829
GO:0070043
AF-A0A4P7BSU1-F1-model_v4 deleted 0.9818 6 207
AF-A0A1R4FRJ2-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.981 6 207 GO:0005829
GO:0070043
AF-A0A1G2WLR0-F1-model_v4 deleted 0.9762 1 208

Feature Viewer

pLDDT pTM Quality
93.53 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map