F426642

General Info

Members Datasets Scaffolds Average Seq Length
374 206 748 261

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100298967|Ga0070664_1002989672
Length 304
Sequence MLVSRPGAARRRTNGVRSRPRAVLEGESGVRRKVDRMSTRMVGDDLVRLLELMKGADSVELKLTVPEESHRSALAALGVDPLEAQIRQVFFFDTPDLALNAAGVVARVRRIQGRDGDSVVKLRPVVPDQIPDDVRRSPTFGVEVDAMPGGYVCSASLKGTVRPAAVLKSVSGEKRLSKLFSSDQRAFFRTHAPDGLTIDDLSVLGPIFVLKLKLPSATFRRRIVVEMWLYPDGARILELSTKASPEEALMVAIEVRQFLEDRGIDTSGEQQTKTRTALEFFAAELRSAPGPAASPEPTSTRKRS

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
118 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.27
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 7.49
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 9.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100298967 3300005564 Bacteria 1454
2 rootL2_10120657 3300003322 Bacteria 1175
3 JGI25407J50210_10036300 3300003373 Unclassified 1268
4 Ga0058860_12169524 3300004801 Bacteria 1229
5 Ga0070658_10301608 3300005327 Bacteria 1366
6 Ga0070683_100000536 3300005329 Bacteria 26783
7 Ga0070683_100101956 3300005329 Bacteria 2703
8 Ga0068869_100113220 3300005334 Bacteria 2066
9 Ga0068869_100281206 3300005334 Unclassified 1338
10 Ga0070682_100012063 3300005337 Bacteria 4945
11 Ga0068868_100286001 3300005338 Bacteria 1397
12 Ga0070661_100315968 3300005344 Bacteria 1219
13 Ga0070692_10028065 3300005345 Bacteria 2796
14 Ga0070668_100420692 3300005347 Bacteria 1144
15 Ga0070671_100093183 3300005355 Bacteria 2524
16 Ga0070671_100557805 3300005355 Bacteria 988
17 Ga0070674_100148265 3300005356 Bacteria 1768
18 Ga0070674_100335658 3300005356 Bacteria 1216
19 Ga0070674_100541355 3300005356 Unclassified 975
20 Ga0070659_100104312 3300005366 Bacteria 2284
21 Ga0070667_100087700 3300005367 Bacteria 2671
22 Ga0070700_100129818 3300005441 Bacteria 1699
23 Ga0070708_100030680 3300005445 Bacteria 4648
24 Ga0070678_100093110 3300005456 Bacteria 2317
25 Ga0070662_100011113 3300005457 Bacteria 5929
26 Ga0070662_100289847 3300005457 Bacteria 1327
27 Ga0070707_100031969 3300005468 Bacteria 5013
28 Ga0070707_100770090 3300005468 Bacteria 926
29 Ga0070698_100048898 3300005471 Bacteria 4320
30 Ga0070684_100002523 3300005535 Bacteria 13502
31 Ga0068853_100144395 3300005539 Bacteria 2138
32 Ga0070686_100399248 3300005544 Bacteria 1045
33 Ga0070695_100035546 3300005545 Bacteria 3130
34 Ga0070696_100024579 3300005546 Bacteria 4096
35 Ga0070693_100359036 3300005547 Bacteria 999
36 Ga0070665_100403406 3300005548 Bacteria 1375
37 Ga0070704_100076632 3300005549 Bacteria 2446
38 Ga0070704_100130178 3300005549 Bacteria 1949
39 Ga0070704_100302159 3300005549 Bacteria 1334
40 Ga0070704_100491077 3300005549 Bacteria 1064
41 Ga0068855_100436376 3300005563 Bacteria 1431
42 Ga0068857_100041301 3300005577 Bacteria 4091
43 Ga0068856_100029641 3300005614 Bacteria 5345
44 Ga0070702_100113299 3300005615 Bacteria 1686
45 Ga0068852_100335672 3300005616 Bacteria 1472
46 Ga0068866_10006587 3300005718 Bacteria 4842
47 Ga0068861_100005908 3300005719 Bacteria 8318
48 Ga0068870_10017642 3300005840 Bacteria 3432
49 Ga0068858_100026388 3300005842 Bacteria 5399
50 Ga0068860_100172232 3300005843 Bacteria 2091
51 Ga0068860_100749387 3300005843 Bacteria 988
52 Ga0081455_10006277 3300005937 Bacteria 12781
53 Ga0081455_10085530 3300005937 Bacteria 2571
54 Ga0081538_10006963 3300005981 Bacteria 9836
55 Ga0081538_10007343 3300005981 Bacteria 9544
56 Ga0081539_10010278 3300005985 Bacteria 7637
57 Ga0070717_10001744 3300006028 Bacteria 15172
58 Ga0070717_10242093 3300006028 Bacteria 1591
59 Ga0075365_10087628 3300006038 Bacteria 2117
60 Ga0075365_10360996 3300006038 Bacteria 1024
61 Ga0070712_100374220 3300006175 Bacteria 1171
62 Ga0070712_100696713 3300006175 Unclassified 866
63 Ga0068871_100102990 3300006358 Bacteria 2393
64 Ga0075428_100384796 3300006844 Bacteria 1504
65 Ga0075428_100407249 3300006844 Bacteria 1457
66 Ga0075430_100008200 3300006846 Bacteria 8821
67 Ga0075430_100317765 3300006846 Bacteria 1287
68 Ga0075431_100002336 3300006847 Bacteria 18211
69 Ga0075431_100259443 3300006847 Bacteria 1764
70 Ga0075431_100332764 3300006847 Bacteria 1529
71 Ga0075429_100000104 3300006880 Bacteria 47352
72 Ga0075429_100254913 3300006880 Bacteria 1536
73 Ga0068865_100057020 3300006881 Bacteria 2724
74 Ga0068865_100108527 3300006881 Bacteria 2043
75 Ga0075435_100168431 3300007076 Bacteria 1848
76 Ga0105240_10334100 3300009093 Bacteria 1723
77 Ga0111539_10004257 3300009094 Bacteria 18747
78 Ga0111539_10170708 3300009094 Bacteria 2541
79 Ga0111539_10197380 3300009094 Bacteria 2347
80 Ga0111539_10326066 3300009094 Bacteria 1787
81 Ga0105245_10071506 3300009098 Bacteria 3150
82 Ga0105243_10208748 3300009148 Bacteria 1718
83 Ga0105243_10210486 3300009148 Bacteria 1712
84 Ga0105242_10009112 3300009176 Bacteria 7620
85 Ga0105242_10099817 3300009176 Bacteria 2458
86 Ga0105242_10258213 3300009176 Bacteria 1573
87 Ga0105248_10025603 3300009177 Bacteria 6560
88 Ga0105238_10149110 3300009551 Bacteria 2315
89 Ga0105249_10022994 3300009553 Bacteria 5588
90 Ga0105249_10132428 3300009553 Bacteria 2382
91 Ga0105249_10375414 3300009553 Bacteria 1446
92 Ga0105249_10433048 3300009553 Unclassified 1351
93 Ga0105249_10706070 3300009553 Bacteria 1069
94 Ga0105249_11096577 3300009553 Bacteria 866
95 Ga0105239_10009600 3300010375 Bacteria 10885
96 Ga0105239_10052359 3300010375 Bacteria 4477
97 Ga0105239_10359835 3300010375 Bacteria 1643
98 Ga0105246_10000634 3300011119 Bacteria 19605
99 Ga0105246_10078317 3300011119 Bacteria 2347
100 Ga0157369_10148117 3300013105 Bacteria 2481
101 Ga0157378_10019165 3300013297 Bacteria 6013
102 Ga0163162_10052307 3300013306 Bacteria 4101
103 Ga0157372_10012700 3300013307 Bacteria 8970
104 Ga0157375_10057015 3300013308 Bacteria 3860
105 Ga0157375_10356805 3300013308 Bacteria 1628
106 Ga0163163_10297447 3300014325 Bacteria 1666
107 Ga0163163_10448561 3300014325 Bacteria 1350
108 Ga0163163_10500125 3300014325 Unclassified 1277
109 Ga0157377_10083048 3300014745 Bacteria 1876
110 Ga0157379_10352947 3300014968 Bacteria 1347
111 Ga0163161_10221893 3300017792 Bacteria 1464
112 Ga0207653_10000985 3300025885 Bacteria 9398
113 Ga0207688_10166771 3300025901 Bacteria 1308
114 Ga0207684_10012231 3300025910 Bacteria 7471
115 Ga0207657_10095854 3300025919 Bacteria 2468
116 Ga0207646_10057194 3300025922 Bacteria 3484
117 Ga0207694_10232723 3300025924 Bacteria 1505
118 Ga0207687_10014294 3300025927 Bacteria 5193
119 Ga0207687_10395079 3300025927 Bacteria 1136
120 Ga0207644_10068659 3300025931 Bacteria 2586
121 Ga0207690_10244644 3300025932 Bacteria 1383
122 Ga0207706_10031907 3300025933 Bacteria 4694
123 Ga0207706_10259501 3300025933 Bacteria 1517
124 Ga0207709_10055424 3300025935 Bacteria 2449
125 Ga0207709_10261947 3300025935 Bacteria 1268
126 Ga0207669_10064838 3300025937 Bacteria 2263
127 Ga0207669_10069439 3300025937 Bacteria 2205
128 Ga0207669_10261657 3300025937 Bacteria 1294
129 Ga0207704_10052791 3300025938 Bacteria 2466
130 Ga0207704_10197240 3300025938 Bacteria 1470
131 Ga0207691_10326575 3300025940 Bacteria 1315
132 Ga0207711_10580772 3300025941 Unclassified 1045
133 Ga0207661_10044922 3300025944 Bacteria 3494
134 Ga0207661_10183086 3300025944 Bacteria 1831
135 Ga0207668_10079674 3300025972 Bacteria 2370
136 Ga0207658_10576803 3300025986 Unclassified 1009
137 Ga0207677_10340305 3300026023 Bacteria 1253
138 Ga0207677_10495106 3300026023 Bacteria 1056
139 Ga0207703_10271221 3300026035 Bacteria 1537
140 Ga0207703_10290098 3300026035 Bacteria 1489
141 Ga0207639_10104410 3300026041 Bacteria 2297
142 Ga0207678_10447599 3300026067 Bacteria 1122
143 Ga0207708_10076407 3300026075 Bacteria 2569
144 Ga0207702_10288448 3300026078 Bacteria 1554
145 Ga0207702_10457258 3300026078 Bacteria 1239
146 Ga0207648_10141689 3300026089 Bacteria 2119
147 Ga0207674_10053519 3300026116 Bacteria 4114
148 Ga0207675_100000962 3300026118 Bacteria 28741
149 Ga0207675_100087223 3300026118 Bacteria 2930
150 Ga0207683_10020069 3300026121 Bacteria 5711
151 Ga0207683_10491693 3300026121 Bacteria 1133
152 Ga0207698_10037309 3300026142 Bacteria 3578
153 Ga0207698_10071106 3300026142 Bacteria 2760
154 Ga0207698_10545216 3300026142 Bacteria 1136
155 Ga0207428_10213858 3300027907 Bacteria 1448
156 Ga0268264_10105932 3300028381 Bacteria 2454
157 Ga0268264_10140776 3300028381 Bacteria 2151
158 Ga0265327_10023267 3300031251 Bacteria 3674
159 Ga0307513_10009850 3300031456 Bacteria 12067
160 Ga0307413_10131113 3300031824 Unclassified 1716
161 Ga0307406_10199046 3300031901 Bacteria 1473
162 Ga0307407_10051566 3300031903 Bacteria 2359
163 Ga0307409_100017437 3300031995 Bacteria 4787
164 Ga0307409_100053936 3300031995 Bacteria 3093
165 Ga0307409_100292974 3300031995 Bacteria 1510
166 Ga0307416_100088677 3300032002 Bacteria 2646
167 Ga0373945_0053175 3300035116 Bacteria 1494
168 Ga0373937_0098531 3300036401 Bacteria 2711
169 Ga0395900_0053792 3300037418 Bacteria 4144
170 Ga0395898_0037182 3300037466 Bacteria 4831
171 Ga0395898_0349163 3300037466 Bacteria 1411
172 Ga0395905_0255126 3300037471 Bacteria 1638
173 Ga0395901_0005617 3300038443 Bacteria 12695
174 Ga0395901_0197232 3300038443 Bacteria 2111
175 Ga0395901_0216108 3300038443 Bacteria 2005
176 Ga0450907_006129 3300042146 Bacteria 2015
177 Ga0450918_008055 3300042531 Bacteria 1855
178 Ga0466960_0008687 3300044901 Bacteria 4168
179 Ga0495592_0191518 3300046454 Unclassified 1386
180 Ga0495603_0006946 3300046455 Bacteria 6790
181 Ga0495629_0050648 3300046459 Bacteria 2908
182 Ga0495653_0015387 3300046463 Bacteria 6235
183 Ga0495653_0086211 3300046463 Bacteria 2308
184 Ga0495653_0099566 3300046463 Bacteria 2109
185 Ga0495582_0013133 3300046473 Bacteria 4559
186 Ga0495662_0063699 3300046476 Unclassified 1781
187 Ga0495664_0129084 3300046477 Bacteria 1530
188 Ga0495664_0194947 3300046477 Bacteria 1228
189 Ga0495594_0106652 3300046499 Bacteria 1578
190 Ga0495594_0113944 3300046499 Unclassified 1526
191 Ga0495618_0032301 3300046514 Bacteria 3278
192 Ga0495628_0046616 3300046516 Bacteria 3442
193 Ga0495630_0029386 3300046517 Bacteria 4087
194 Ga0495652_0144068 3300046529 Bacteria 1870
195 Ga0495652_0215102 3300046529 Bacteria 1448
196 Ga0495665_0099577 3300046531 Unclassified 1526
197 Ga0495640_0026241 3300046533 Bacteria 4213
198 Ga0495586_0009671 3300046535 Bacteria 5134
199 Ga0495586_0071595 3300046535 Bacteria 1895
200 Ga0495586_0115710 3300046535 Bacteria 1495
201 Ga0495587_0053509 3300046536 Bacteria 2380
202 Ga0495667_0002204 3300046559 Bacteria 13031
203 Ga0495667_0052301 3300046559 Bacteria 2691
204 Ga0495656_0126039 3300046615 Bacteria 1214
205 Ga0495613_0031698 3300046689 Bacteria 3926
206 Ga0495613_0077917 3300046689 Bacteria 2411
207 Ga0495600_0049879 3300046809 Bacteria 2731
208 Ga0495581_0086899 3300047315 Unclassified 1813
209 Ga0495604_0146145 3300047317 Bacteria 1685
210 Ga0495674_0013158 3300047319 Bacteria 7780
211 Ga0495674_0111216 3300047319 Unclassified 2322
212 Ga0495674_0136958 3300047319 Unclassified 2059
213 Ga0495676_0019013 3300047321 Bacteria 6051
214 Ga0495676_0106407 3300047321 Bacteria 2067
215 Ga0495680_0003780 3300047322 Bacteria 14723
216 Ga0495680_0327893 3300047322 Unclassified 1070
217 Ga0495684_0009455 3300047471 Bacteria 7524
218 Ga0495602_0063094 3300048088 Bacteria 3212
219 Ga0496100_0004966 3300048903 Bacteria 7110
220 Ga0496101_0009973 3300048904 Bacteria 6259
221 Ga0496101_0022265 3300048904 Bacteria 4362
222 Ga0496102_0008858 3300048905 Bacteria 8635
223 Ga0496102_0419740 3300048905 Bacteria 1257
224 Ga0496104_0035393 3300048907 Bacteria 4662
225 Ga0496105_0019519 3300048908 Bacteria 5468
226 Ga0496105_0545844 3300048908 Bacteria 905
227 Ga0496106_0023732 3300048909 Bacteria 4558
228 Ga0496106_0281731 3300048909 Bacteria 1332
229 Ga0496107_0017303 3300048910 Bacteria 5069
230 Ga0496107_0035317 3300048910 Bacteria 3584
231 Ga0496108_0211689 3300048911 Bacteria 1683
232 Ga0496108_0275062 3300048911 Bacteria 1466
233 Ga0496109_0002198 3300048912 Bacteria 16192
234 Ga0496109_0102166 3300048912 Bacteria 2661
235 Ga0496109_0332639 3300048912 Unclassified 1434
236 Ga0496110_0006949 3300048913 Bacteria 9002
237 Ga0496110_0441403 3300048913 Unclassified 1186
238 Ga0496111_0005559 3300048914 Bacteria 8099
239 Ga0496111_0104488 3300048914 Bacteria 2084
240 Ga0496111_0387189 3300048914 Bacteria 1034
241 Ga0496112_0517676 3300048915 Bacteria 1128
242 Ga0496113_0074899 3300048916 Bacteria 2582
243 Ga0496113_0173565 3300048916 Bacteria 1708
244 Ga0496114_0029453 3300048917 Bacteria 4513
245 Ga0496114_0085286 3300048917 Bacteria 2675
246 Ga0496114_0294730 3300048917 Unclassified 1432
247 Ga0501031_0014344 3300049568 Bacteria 5151
248 Ga0501031_0050403 3300049568 Bacteria 2712
249 Ga0501031_0070365 3300049568 Bacteria 2279
250 Ga0501032_0011842 3300049569 Bacteria 6248
251 Ga0501032_0033005 3300049569 Bacteria 3547
252 Ga0501033_0008551 3300049570 Bacteria 7919
253 Ga0501033_0405518 3300049570 Bacteria 950
254 Ga0501034_0244856 3300049571 Bacteria 1738
255 Ga0501036_0012210 3300049572 Bacteria 7116
256 Ga0501036_0063571 3300049572 Bacteria 3124
257 Ga0501036_0105559 3300049572 Bacteria 2382
258 Ga0501036_0119695 3300049572 Bacteria 2224
259 Ga0501036_0243164 3300049572 Bacteria 1509
260 Ga0501036_0388098 3300049572 Unclassified 1165
261 Ga0501037_0004665 3300049573 Bacteria 9956
262 Ga0501037_0019433 3300049573 Bacteria 5011
263 Ga0501038_0022289 3300049574 Bacteria 5677
264 Ga0501038_0052184 3300049574 Bacteria 3526
265 Ga0501039_0007373 3300049575 Bacteria 8388
266 Ga0501039_0031389 3300049575 Bacteria 4095
267 Ga0501039_0035366 3300049575 Bacteria 3855
268 Ga0501039_0067088 3300049575 Bacteria 2786
269 Ga0501040_0052853 3300049576 Bacteria 2781
270 Ga0501040_0127496 3300049576 Bacteria 1788
271 Ga0501040_0314665 3300049576 Bacteria 1119
272 Ga0501041_0007096 3300049577 Bacteria 6569
273 Ga0501042_0043911 3300049578 Bacteria 3183
274 Ga0501042_0089099 3300049578 Bacteria 2214
275 Ga0501042_0223245 3300049578 Bacteria 1359
276 Ga0501042_0287405 3300049578 Unclassified 1188
277 Ga0501043_0012403 3300049579 Bacteria 6665
278 Ga0501043_0030403 3300049579 Bacteria 4244
279 Ga0501046_0007691 3300049580 Bacteria 9448
280 Ga0501046_0190618 3300049580 Bacteria 1529
281 Ga0501048_0020252 3300049582 Bacteria 4875
282 Ga0501048_0034626 3300049582 Bacteria 3641
283 Ga0501048_0048443 3300049582 Bacteria 3031
284 Ga0501048_0049677 3300049582 Bacteria 2989
285 Ga0501048_0198202 3300049582 Unclassified 1423
286 Ga0501048_0262039 3300049582 Unclassified 1228
287 Ga0501067_0033866 3300049583 Bacteria 2834
288 Ga0501068_0009338 3300049584 Bacteria 5482
289 Ga0501068_0184507 3300049584 Bacteria 1320
290 Ga0501069_0013266 3300049585 Bacteria 4390
291 Ga0501070_0063046 3300049586 Bacteria 3070
292 Ga0501070_0314737 3300049586 Bacteria 1274
293 Ga0501071_0009448 3300049587 Bacteria 6496
294 Ga0501071_0013481 3300049587 Bacteria 5571
295 Ga0501071_0017882 3300049587 Bacteria 4900
296 Ga0501071_0068012 3300049587 Unclassified 2592
297 Ga0501071_0085276 3300049587 Bacteria 2316
298 Ga0501071_0225488 3300049587 Bacteria 1411
299 Ga0501071_0345993 3300049587 Unclassified 1131
300 Ga0501071_0458251 3300049587 Archaea 976
301 Ga0501072_0006145 3300049588 Bacteria 9155
302 Ga0501072_0063656 3300049588 Bacteria 2909
303 Ga0501072_0106433 3300049588 Unclassified 2231
304 Ga0501072_0209860 3300049588 Unclassified 1552
305 Ga0501072_0225669 3300049588 Unclassified 1492
306 Ga0501073_0017990 3300049589 Bacteria 5110
307 Ga0501073_0018644 3300049589 Bacteria 5015
308 Ga0501074_0058850 3300049590 Bacteria 2768
309 Ga0501074_0388827 3300049590 Unclassified 989
310 Ga0501075_0046749 3300049591 Bacteria 3252
311 Ga0501075_0056283 3300049591 Bacteria 2960
312 Ga0501075_0075205 3300049591 Unclassified 2554
313 Ga0501075_0147333 3300049591 Bacteria 1794
314 Ga0501075_0176851 3300049591 Bacteria 1628
315 Ga0501075_0423715 3300049591 Bacteria 1015
316 Ga0501076_0032135 3300049592 Bacteria 4095
317 Ga0501076_0164375 3300049592 Bacteria 1809
318 Ga0501076_0195166 3300049592 Bacteria 1652
319 Ga0501076_0222908 3300049592 Bacteria 1541
320 Ga0501077_0063976 3300049593 Bacteria 2333
321 Ga0501077_0244957 3300049593 Unclassified 1139
322 Ga0501079_0085714 3300049741 Bacteria 2438
323 Ga0501079_0098887 3300049741 Bacteria 2261
324 Ga0501079_0161249 3300049741 Bacteria 1749
325 Ga0501079_0179359 3300049741 Bacteria 1652
326 Ga0501079_0270770 3300049741 Unclassified 1328
327 Ga0501080_0027192 3300049742 Bacteria 5320
328 Ga0501080_0119898 3300049742 Bacteria 2438
329 Ga0501080_0142409 3300049742 Bacteria 2217
330 Ga0501080_0325523 3300049742 Bacteria 1391
331 Ga0501081_0037778 3300049743 Bacteria 3295
332 Ga0501081_0190757 3300049743 Bacteria 1484
333 Ga0501081_0350739 3300049743 Bacteria 1087
334 Ga0501081_0388692 3300049743 Bacteria 1032
335 Ga0501083_0017848 3300049744 Bacteria 4949
336 Ga0501083_0446859 3300049744 Unclassified 841
337 Ga0501035_0054319 3300049822 Bacteria 3579
338 Ga0501035_0587867 3300049822 Bacteria 909
339 Ga0501044_0056853 3300049823 Bacteria 4016
340 Ga0501044_0092609 3300049823 Bacteria 3048
341 Ga0501045_0037764 3300049824 Bacteria 3511
342 Ga0501045_0047977 3300049824 Bacteria 3112
343 Ga0501045_0053507 3300049824 Bacteria 2950
344 Ga0501045_0059142 3300049824 Bacteria 2807
345 Ga0501045_0059723 3300049824 Bacteria 2794
346 Ga0501045_0146475 3300049824 Bacteria 1757
347 nmdc:mga0yw44_14258_c2 3300050492 Bacteria 2600
348 nmdc:mga05p37_385588_c1 3300050507 Bacteria 1641
349 nmdc:mga09592_125812_c1 3300050508 Bacteria 2203
350 nmdc:mga06r32_62982_c1 3300050510 Bacteria 3574
351 nmdc:mga08y16_149313_c1 3300050511 Bacteria 2430
352 nmdc:mga08y16_97929_c1 3300050511 Bacteria 3054
353 Ga0495601_0103818 3300053077 Unclassified 1837
354 Ga0495601_0128457 3300053077 Bacteria 1650
355 Ga0495655_0017616 3300053083 Bacteria 1559
356 Ga0495595_0062918 3300053084 Bacteria 1741
357 Ga0495619_0028561 3300053085 Bacteria 3599
358 Ga0495619_0095296 3300053085 Unclassified 2019
359 Ga0501084_0040959 3300054114 Bacteria 3875
360 Ga0501084_0110041 3300054114 Bacteria 2315
361 Ga0501084_0204690 3300054114 Bacteria 1665
362 Ga0501084_0364562 3300054114 Bacteria 1221
363 Ga0501084_0440009 3300054114 Bacteria 1102
364 Ga0590077_035739 3300059426 Unclassified 1095
365 Ga0501082_0033524 3300060353 Bacteria 4431
366 Ga0501082_0215968 3300060353 Bacteria 1668
367 Ga0501082_0217458 3300060353 Bacteria 1662
368 Ga0501082_0221059 3300060353 Bacteria 1648
369 Ga0501082_0260776 3300060353 Bacteria 1508
370 Ga0501082_0313605 3300060353 Bacteria 1366
371 Ga0530510_0066895 3300061734 Bacteria 2606
372 Ga0530510_0079458 3300061734 Bacteria 2385
373 Ga0530510_0292440 3300061734 Bacteria 1218
374 2989775085 2989771324 Bacteria 5605128
375 Ga0070664_100298967
376 rootL2_10120657
377 JGI25407J50210_10036300
378 Ga0058860_12169524
379 Ga0070658_10301608
380 Ga0070683_100000536
381 Ga0070683_100101956
382 Ga0068869_100113220
383 Ga0068869_100281206
384 Ga0070682_100012063
385 Ga0068868_100286001
386 Ga0070661_100315968
387 Ga0070692_10028065
388 Ga0070668_100420692
389 Ga0070671_100093183
390 Ga0070671_100557805
391 Ga0070674_100148265
392 Ga0070674_100335658
393 Ga0070674_100541355
394 Ga0070659_100104312
395 Ga0070667_100087700
396 Ga0070700_100129818
397 Ga0070708_100030680
398 Ga0070678_100093110
399 Ga0070662_100011113
400 Ga0070662_100289847
401 Ga0070707_100031969
402 Ga0070707_100770090
403 Ga0070698_100048898
404 Ga0070684_100002523
405 Ga0068853_100144395
406 Ga0070686_100399248
407 Ga0070695_100035546
408 Ga0070696_100024579
409 Ga0070693_100359036
410 Ga0070665_100403406
411 Ga0070704_100076632
412 Ga0070704_100130178
413 Ga0070704_100302159
414 Ga0070704_100491077
415 Ga0068855_100436376
416 Ga0068857_100041301
417 Ga0068856_100029641
418 Ga0070702_100113299
419 Ga0068852_100335672
420 Ga0068866_10006587
421 Ga0068861_100005908
422 Ga0068870_10017642
423 Ga0068858_100026388
424 Ga0068860_100172232
425 Ga0068860_100749387
426 Ga0081455_10006277
427 Ga0081455_10085530
428 Ga0081538_10006963
429 Ga0081538_10007343
430 Ga0081539_10010278
431 Ga0070717_10001744
432 Ga0070717_10242093
433 Ga0075365_10087628
434 Ga0075365_10360996
435 Ga0070712_100374220
436 Ga0070712_100696713
437 Ga0068871_100102990
438 Ga0075428_100384796
439 Ga0075428_100407249
440 Ga0075430_100008200
441 Ga0075430_100317765
442 Ga0075431_100002336
443 Ga0075431_100259443
444 Ga0075431_100332764
445 Ga0075429_100000104
446 Ga0075429_100254913
447 Ga0068865_100057020
448 Ga0068865_100108527
449 Ga0075435_100168431
450 Ga0105240_10334100
451 Ga0111539_10004257
452 Ga0111539_10170708
453 Ga0111539_10197380
454 Ga0111539_10326066
455 Ga0105245_10071506
456 Ga0105243_10208748
457 Ga0105243_10210486
458 Ga0105242_10009112
459 Ga0105242_10099817
460 Ga0105242_10258213
461 Ga0105248_10025603
462 Ga0105238_10149110
463 Ga0105249_10022994
464 Ga0105249_10132428
465 Ga0105249_10375414
466 Ga0105249_10433048
467 Ga0105249_10706070
468 Ga0105249_11096577
469 Ga0105239_10009600
470 Ga0105239_10052359
471 Ga0105239_10359835
472 Ga0105246_10000634
473 Ga0105246_10078317
474 Ga0157369_10148117
475 Ga0157378_10019165
476 Ga0163162_10052307
477 Ga0157372_10012700
478 Ga0157375_10057015
479 Ga0157375_10356805
480 Ga0163163_10297447
481 Ga0163163_10448561
482 Ga0163163_10500125
483 Ga0157377_10083048
484 Ga0157379_10352947
485 Ga0163161_10221893
486 Ga0207653_10000985
487 Ga0207688_10166771
488 Ga0207684_10012231
489 Ga0207657_10095854
490 Ga0207646_10057194
491 Ga0207694_10232723
492 Ga0207687_10014294
493 Ga0207687_10395079
494 Ga0207644_10068659
495 Ga0207690_10244644
496 Ga0207706_10031907
497 Ga0207706_10259501
498 Ga0207709_10055424
499 Ga0207709_10261947
500 Ga0207669_10064838
501 Ga0207669_10069439
502 Ga0207669_10261657
503 Ga0207704_10052791
504 Ga0207704_10197240
505 Ga0207691_10326575
506 Ga0207711_10580772
507 Ga0207661_10044922
508 Ga0207661_10183086
509 Ga0207668_10079674
510 Ga0207658_10576803
511 Ga0207677_10340305
512 Ga0207677_10495106
513 Ga0207703_10271221
514 Ga0207703_10290098
515 Ga0207639_10104410
516 Ga0207678_10447599
517 Ga0207708_10076407
518 Ga0207702_10288448
519 Ga0207702_10457258
520 Ga0207648_10141689
521 Ga0207674_10053519
522 Ga0207675_100000962
523 Ga0207675_100087223
524 Ga0207683_10020069
525 Ga0207683_10491693
526 Ga0207698_10037309
527 Ga0207698_10071106
528 Ga0207698_10545216
529 Ga0207428_10213858
530 Ga0268264_10105932
531 Ga0268264_10140776
532 Ga0265327_10023267
533 Ga0307513_10009850
534 Ga0307413_10131113
535 Ga0307406_10199046
536 Ga0307407_10051566
537 Ga0307409_100017437
538 Ga0307409_100053936
539 Ga0307409_100292974
540 Ga0307416_100088677
541 Ga0373945_0053175
542 Ga0373937_0098531
543 Ga0395900_0053792
544 Ga0395898_0037182
545 Ga0395898_0349163
546 Ga0395905_0255126
547 Ga0395901_0005617
548 Ga0395901_0197232
549 Ga0395901_0216108
550 Ga0450907_006129
551 Ga0450918_008055
552 Ga0466960_0008687
553 Ga0495592_0191518
554 Ga0495603_0006946
555 Ga0495629_0050648
556 Ga0495653_0015387
557 Ga0495653_0086211
558 Ga0495653_0099566
559 Ga0495582_0013133
560 Ga0495662_0063699
561 Ga0495664_0129084
562 Ga0495664_0194947
563 Ga0495594_0106652
564 Ga0495594_0113944
565 Ga0495618_0032301
566 Ga0495628_0046616
567 Ga0495630_0029386
568 Ga0495652_0144068
569 Ga0495652_0215102
570 Ga0495665_0099577
571 Ga0495640_0026241
572 Ga0495586_0009671
573 Ga0495586_0071595
574 Ga0495586_0115710
575 Ga0495587_0053509
576 Ga0495667_0002204
577 Ga0495667_0052301
578 Ga0495656_0126039
579 Ga0495613_0031698
580 Ga0495613_0077917
581 Ga0495600_0049879
582 Ga0495581_0086899
583 Ga0495604_0146145
584 Ga0495674_0013158
585 Ga0495674_0111216
586 Ga0495674_0136958
587 Ga0495676_0019013
588 Ga0495676_0106407
589 Ga0495680_0003780
590 Ga0495680_0327893
591 Ga0495684_0009455
592 Ga0495602_0063094
593 Ga0496100_0004966
594 Ga0496101_0009973
595 Ga0496101_0022265
596 Ga0496102_0008858
597 Ga0496102_0419740
598 Ga0496104_0035393
599 Ga0496105_0019519
600 Ga0496105_0545844
601 Ga0496106_0023732
602 Ga0496106_0281731
603 Ga0496107_0017303
604 Ga0496107_0035317
605 Ga0496108_0211689
606 Ga0496108_0275062
607 Ga0496109_0002198
608 Ga0496109_0102166
609 Ga0496109_0332639
610 Ga0496110_0006949
611 Ga0496110_0441403
612 Ga0496111_0005559
613 Ga0496111_0104488
614 Ga0496111_0387189
615 Ga0496112_0517676
616 Ga0496113_0074899
617 Ga0496113_0173565
618 Ga0496114_0029453
619 Ga0496114_0085286
620 Ga0496114_0294730
621 Ga0501031_0014344
622 Ga0501031_0050403
623 Ga0501031_0070365
624 Ga0501032_0011842
625 Ga0501032_0033005
626 Ga0501033_0008551
627 Ga0501033_0405518
628 Ga0501034_0244856
629 Ga0501036_0012210
630 Ga0501036_0063571
631 Ga0501036_0105559
632 Ga0501036_0119695
633 Ga0501036_0243164
634 Ga0501036_0388098
635 Ga0501037_0004665
636 Ga0501037_0019433
637 Ga0501038_0022289
638 Ga0501038_0052184
639 Ga0501039_0007373
640 Ga0501039_0031389
641 Ga0501039_0035366
642 Ga0501039_0067088
643 Ga0501040_0052853
644 Ga0501040_0127496
645 Ga0501040_0314665
646 Ga0501041_0007096
647 Ga0501042_0043911
648 Ga0501042_0089099
649 Ga0501042_0223245
650 Ga0501042_0287405
651 Ga0501043_0012403
652 Ga0501043_0030403
653 Ga0501046_0007691
654 Ga0501046_0190618
655 Ga0501048_0020252
656 Ga0501048_0034626
657 Ga0501048_0048443
658 Ga0501048_0049677
659 Ga0501048_0198202
660 Ga0501048_0262039
661 Ga0501067_0033866
662 Ga0501068_0009338
663 Ga0501068_0184507
664 Ga0501069_0013266
665 Ga0501070_0063046
666 Ga0501070_0314737
667 Ga0501071_0009448
668 Ga0501071_0013481
669 Ga0501071_0017882
670 Ga0501071_0068012
671 Ga0501071_0085276
672 Ga0501071_0225488
673 Ga0501071_0345993
674 Ga0501071_0458251
675 Ga0501072_0006145
676 Ga0501072_0063656
677 Ga0501072_0106433
678 Ga0501072_0209860
679 Ga0501072_0225669
680 Ga0501073_0017990
681 Ga0501073_0018644
682 Ga0501074_0058850
683 Ga0501074_0388827
684 Ga0501075_0046749
685 Ga0501075_0056283
686 Ga0501075_0075205
687 Ga0501075_0147333
688 Ga0501075_0176851
689 Ga0501075_0423715
690 Ga0501076_0032135
691 Ga0501076_0164375
692 Ga0501076_0195166
693 Ga0501076_0222908
694 Ga0501077_0063976
695 Ga0501077_0244957
696 Ga0501079_0085714
697 Ga0501079_0098887
698 Ga0501079_0161249
699 Ga0501079_0179359
700 Ga0501079_0270770
701 Ga0501080_0027192
702 Ga0501080_0119898
703 Ga0501080_0142409
704 Ga0501080_0325523
705 Ga0501081_0037778
706 Ga0501081_0190757
707 Ga0501081_0350739
708 Ga0501081_0388692
709 Ga0501083_0017848
710 Ga0501083_0446859
711 Ga0501035_0054319
712 Ga0501035_0587867
713 Ga0501044_0056853
714 Ga0501044_0092609
715 Ga0501045_0037764
716 Ga0501045_0047977
717 Ga0501045_0053507
718 Ga0501045_0059142
719 Ga0501045_0059723
720 Ga0501045_0146475
721 nmdc:mga0yw44_14258_c2
722 nmdc:mga05p37_385588_c1
723 nmdc:mga09592_125812_c1
724 nmdc:mga06r32_62982_c1
725 nmdc:mga08y16_149313_c1
726 nmdc:mga08y16_97929_c1
727 Ga0495601_0103818
728 Ga0495601_0128457
729 Ga0495655_0017616
730 Ga0495595_0062918
731 Ga0495619_0028561
732 Ga0495619_0095296
733 Ga0501084_0040959
734 Ga0501084_0110041
735 Ga0501084_0204690
736 Ga0501084_0364562
737 Ga0501084_0440009
738 Ga0590077_035739
739 Ga0501082_0033524
740 Ga0501082_0215968
741 Ga0501082_0217458
742 Ga0501082_0221059
743 Ga0501082_0260776
744 Ga0501082_0313605
745 Ga0530510_0066895
746 Ga0530510_0079458
747 Ga0530510_0292440
748 2989775085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gfg-assembly3.cif.gz_C crystal structure of a putative adenylate cyclase (bh2851) from bacillus halodurans at 2.12 a resolution 0.8199 10 228
3v85-assembly1.cif.gz_A 1.9 angstrom resolution crystal structure of the protein q9siy3 from arabidopsis thaliana 0.7968 10 231
5a68-assembly1.cif.gz_A crystal structure of the atttm3 product complex with two orthophosphates and manganese ions (form b) 0.7966 10 231
3sy3-assembly2.cif.gz_C gbaa_1210 protein, a putative adenylate cyclase, from bacillus anthracis 0.7898 10 219
6yp4-assembly1.cif.gz_A-2 putative adenylyl cyclase hpac1 from hippeastrum reveals a dominant triphophatase activity 0.7889 12 231
ID Description Score Start End Superfamily
af_Q18995_4_150_3.30.1460.50 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8169 158 187 3.30.1460.50
2gfgC00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.8135 10 228 2.40.320.10
af_I1MU21_1_199_2.40.320.10 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.8077 10 231 2.40.320.10
af_A8DYW8_348_442_3.30.1120.160 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.7929 156 193 3.30.1120.160
3sy3C00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7907 10 219 2.40.320.10
ID Description Score Start End GO Terms
AF-A0A0T0ME39-F1-model_v4 Adenylate cyclase 0.9958 3 239
AF-A0A3C0QAW9-F1-model_v4 Adenylate cyclase 0.9903 2 236
AF-A0A4T0V873-F1-model_v4 Adenylate cyclase 0.9891 2 235
AF-A0A552WPD0-F1-model_v4 Adenylate cyclase 0.9886 2 242
AF-A0A538GNM5-F1-model_v4 Adenylate cyclase 0.9879 2 240

Map