F426630

General Info

Members Datasets Scaffolds Average Seq Length
374 223 748 152

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100204438|Ga0070707_1002044383
Length 183
Sequence VVRTNNSDRAAWIIPTGKLGRSMLRPANERERGAMRAVVQRVSRARVTVGGEVTGEIDAGLMILLGVGRGDSSATASALAEKAANLRIFADENEKMNLSLLDVKGGALVVSQFTLYGDASGGRRPSFIAAAPPELGKALYEEFCGALRKLGVHVATGIFQAMMSVELVNEGPVTILLDSEKTF

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
152 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 5.08
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 22.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100204438 3300005468 Unclassified 1925
2 Ga0065704_10327188 3300005289 Unclassified 843
3 Ga0065715_10001413 3300005293 Bacteria 7197
4 Ga0065715_10126348 3300005293 Bacteria 2110
5 Ga0065715_10674082 3300005293 Bacteria 666
6 Ga0070676_10017219 3300005328 Bacteria 3999
7 Ga0070690_100307122 3300005330 Unclassified 1139
8 Ga0070677_10016177 3300005333 Bacteria 2653
9 Ga0070666_10000768 3300005335 Bacteria 19407
10 Ga0070682_100512984 3300005337 Bacteria 931
11 Ga0070668_100020421 3300005347 Bacteria 4998
12 Ga0070669_100000834 3300005353 Bacteria 22364
13 Ga0070675_100024646 3300005354 Bacteria 4818
14 Ga0070671_100018826 3300005355 Bacteria 5613
15 Ga0070674_100010162 3300005356 Bacteria 5671
16 Ga0070674_100545596 3300005356 Unclassified 972
17 Ga0070673_100016045 3300005364 Bacteria 5283
18 Ga0070659_100029311 3300005366 Bacteria 4253
19 Ga0070667_100008134 3300005367 Bacteria 8696
20 Ga0070667_100360074 3300005367 Bacteria 1318
21 Ga0070703_10001856 3300005406 Bacteria 6218
22 Ga0070709_10501885 3300005434 Bacteria 922
23 Ga0070714_100323103 3300005435 Unclassified 1444
24 Ga0070713_100221942 3300005436 Bacteria 1715
25 Ga0070713_100254371 3300005436 Bacteria 1603
26 Ga0070713_100330271 3300005436 Unclassified 1410
27 Ga0070710_10130734 3300005437 Unclassified 1530
28 Ga0070710_11323627 3300005437 Bacteria 536
29 Ga0070711_100082138 3300005439 Bacteria 2299
30 Ga0070711_100176372 3300005439 Bacteria 1633
31 Ga0070711_100279798 3300005439 Unclassified 1319
32 Ga0070705_100002256 3300005440 Bacteria 9763
33 Ga0070705_100771364 3300005440 Bacteria 762
34 Ga0070694_100003278 3300005444 Bacteria 9669
35 Ga0070708_100024979 3300005445 Bacteria 5106
36 Ga0070708_100035512 3300005445 Bacteria 4343
37 Ga0070708_100068665 3300005445 Bacteria 3186
38 Ga0070708_100206072 3300005445 Bacteria 1842
39 Ga0070663_100365557 3300005455 Bacteria 1171
40 Ga0070663_101085944 3300005455 Unclassified 699
41 Ga0070662_100276230 3300005457 Bacteria 1358
42 Ga0070681_10105490 3300005458 Bacteria 2760
43 Ga0068867_100470060 3300005459 Bacteria 1075
44 Ga0070706_100006454 3300005467 Bacteria 11070
45 Ga0070706_100028990 3300005467 Bacteria 5098
46 Ga0070706_100187395 3300005467 Unclassified 1933
47 Ga0070706_100212121 3300005467 Unclassified 1808
48 Ga0070707_100061756 3300005468 Unclassified 3594
49 Ga0070707_100246858 3300005468 Bacteria 1737
50 Ga0070707_100266057 3300005468 Unclassified 1667
51 Ga0070707_100832064 3300005468 Unclassified 887
52 Ga0070707_101524571 3300005468 Bacteria 635
53 Ga0070698_100058706 3300005471 Bacteria 3889
54 Ga0070699_100004213 3300005518 Bacteria 12718
55 Ga0070699_100046007 3300005518 Unclassified 3776
56 Ga0070699_100058406 3300005518 Unclassified 3342
57 Ga0070699_100259263 3300005518 Unclassified 1555
58 Ga0070699_100360125 3300005518 Unclassified 1311
59 Ga0070697_100000061 3300005536 Bacteria 85209
60 Ga0070697_100012677 3300005536 Bacteria 6604
61 Ga0070697_100018874 3300005536 Bacteria 5442
62 Ga0070697_100026204 3300005536 Unclassified 4654
63 Ga0070697_100145655 3300005536 Bacteria 1993
64 Ga0070695_100001117 3300005545 Bacteria 14697
65 Ga0070695_100158522 3300005545 Bacteria 1586
66 Ga0070695_100365141 3300005545 Bacteria 1085
67 Ga0070696_100002008 3300005546 Bacteria 13350
68 Ga0070693_100000014 3300005547 Bacteria 68137
69 Ga0070693_100027830 3300005547 Unclassified 3068
70 Ga0070693_100033767 3300005547 Bacteria 2826
71 Ga0070693_100442416 3300005547 Unclassified 910
72 Ga0070665_100001678 3300005548 Bacteria 25511
73 Ga0070665_101067162 3300005548 Unclassified 819
74 Ga0070704_100003164 3300005549 Bacteria 9400
75 Ga0068855_101847612 3300005563 Bacteria 613
76 Ga0070664_100101868 3300005564 Bacteria 2498
77 Ga0068859_101497403 3300005617 Bacteria 745
78 Ga0068864_100205080 3300005618 Bacteria 1813
79 Ga0068866_10221305 3300005718 Bacteria 1142
80 Ga0068863_100008359 3300005841 Bacteria 10108
81 Ga0068863_100504821 3300005841 Bacteria 1191
82 Ga0068858_100068330 3300005842 Bacteria 3293
83 Ga0068860_100021553 3300005843 Bacteria 6240
84 Ga0068860_100234973 3300005843 Bacteria 1782
85 Ga0081455_10001439 3300005937 Bacteria 29437
86 Ga0081455_10017516 3300005937 Bacteria 6864
87 Ga0081455_10019468 3300005937 Bacteria 6421
88 Ga0081538_10078914 3300005981 Bacteria 1764
89 Ga0081540_1000215 3300005983 Bacteria 61058
90 Ga0081539_10275441 3300005985 Bacteria 735
91 Ga0070717_10004992 3300006028 Bacteria 9654
92 Ga0070717_10213466 3300006028 Unclassified 1694
93 Ga0070715_10025128 3300006163 Bacteria 2356
94 Ga0070715_10365859 3300006163 Bacteria 792
95 Ga0070716_100000707 3300006173 Bacteria 14236
96 Ga0070716_100001222 3300006173 Bacteria 11299
97 Ga0070716_100254769 3300006173 Bacteria 1198
98 Ga0070716_101259847 3300006173 Bacteria 596
99 Ga0070712_100045332 3300006175 Unclassified 3035
100 Ga0070712_100067446 3300006175 Bacteria 2545
101 Ga0070712_101290680 3300006175 Unclassified 636
102 Ga0075367_10027708 3300006178 Bacteria 3226
103 Ga0097621_100008198 3300006237 Bacteria 7515
104 Ga0097621_100028046 3300006237 Unclassified 4434
105 Ga0068871_100013996 3300006358 Bacteria 5968
106 Ga0068871_100449755 3300006358 Bacteria 1154
107 Ga0075428_100046532 3300006844 Bacteria 4765
108 Ga0075431_100186624 3300006847 Unclassified 2126
109 Ga0075433_10214053 3300006852 Unclassified 1712
110 Ga0075433_10322891 3300006852 Unclassified 1366
111 Ga0075434_100079401 3300006871 Unclassified 3278
112 Ga0075434_100276655 3300006871 Bacteria 1698
113 Ga0075434_100418775 3300006871 Bacteria 1361
114 Ga0075429_100004127 3300006880 Bacteria 12435
115 Ga0068865_100129011 3300006881 Unclassified 1892
116 Ga0068865_100447204 3300006881 Unclassified 1068
117 Ga0075436_100424969 3300006914 Unclassified 965
118 Ga0097620_101497566 3300006931 Bacteria 745
119 Ga0075435_100189611 3300007076 Bacteria 1740
120 Ga0075435_100281734 3300007076 Bacteria 1419
121 Ga0075435_100717687 3300007076 Unclassified 869
122 Ga0075435_101367814 3300007076 Unclassified 620
123 Ga0099794_10002081 3300007265 Bacteria 7270
124 Ga0099794_10011591 3300007265 Bacteria 3779
125 Ga0099794_10012579 3300007265 Bacteria 3657
126 Ga0099794_10025022 3300007265 Bacteria 2745
127 Ga0099794_10025695 3300007265 Bacteria 2715
128 Ga0099794_10073383 3300007265 Unclassified 1679
129 Ga0099795_10083771 3300007788 Bacteria 1225
130 Ga0099795_10355776 3300007788 Unclassified 656
131 Ga0105247_10209840 3300009101 Bacteria 1313
132 Ga0114129_10221520 3300009147 Bacteria 2552
133 Ga0105242_10725418 3300009176 Bacteria 975
134 Ga0105248_10552485 3300009177 Bacteria 1299
135 Ga0105249_10098975 3300009553 Bacteria 2740
136 Ga0105249_10510609 3300009553 Bacteria 1248
137 Ga0099796_10042025 3300010159 Bacteria 1551
138 Ga0105239_10086550 3300010375 Bacteria 3454
139 Ga0157374_10002703 3300013296 Bacteria 14913
140 Ga0157374_10133209 3300013296 Unclassified 2407
141 Ga0157378_10000694 3300013297 Bacteria 31676
142 Ga0157378_10009421 3300013297 Bacteria 8509
143 Ga0157378_10025370 3300013297 Bacteria 5220
144 Ga0157378_10161270 3300013297 Bacteria 2097
145 Ga0157378_10177816 3300013297 Bacteria 2000
146 Ga0163162_10009094 3300013306 Bacteria 9657
147 Ga0163162_10078020 3300013306 Bacteria 3377
148 Ga0163162_10373693 3300013306 Bacteria 1559
149 Ga0157375_10010726 3300013308 Bacteria 8074
150 Ga0157375_10108714 3300013308 Unclassified 2868
151 Ga0157375_10121469 3300013308 Bacteria 2722
152 Ga0163163_10329708 3300014325 Bacteria 1581
153 Ga0182008_10098900 3300014497 Bacteria 1441
154 Ga0157377_10673063 3300014745 Unclassified 748
155 Ga0157379_10014642 3300014968 Bacteria 6877
156 Ga0157376_10000070 3300014969 Bacteria 82778
157 Ga0157376_10002813 3300014969 Bacteria 11893
158 Ga0157376_10056228 3300014969 Bacteria 3286
159 Ga0207697_10001004 3300025315 Bacteria 15789
160 Ga0207697_10003011 3300025315 Bacteria 8478
161 Ga0207653_10001171 3300025885 Bacteria 8566
162 Ga0207692_10060046 3300025898 Unclassified 1965
163 Ga0207642_10128413 3300025899 Bacteria 1319
164 Ga0207688_10010039 3300025901 Bacteria 5149
165 Ga0207685_10229726 3300025905 Bacteria 887
166 Ga0207685_10533363 3300025905 Bacteria 622
167 Ga0207699_10160790 3300025906 Unclassified 1495
168 Ga0207699_10291151 3300025906 Bacteria 1138
169 Ga0207699_10307447 3300025906 Bacteria 1109
170 Ga0207645_10013243 3300025907 Bacteria 5564
171 Ga0207684_10009365 3300025910 Bacteria 8653
172 Ga0207684_10867585 3300025910 Unclassified 760
173 Ga0207707_10096315 3300025912 Bacteria 2586
174 Ga0207693_10007292 3300025915 Bacteria 9099
175 Ga0207693_10019972 3300025915 Bacteria 5328
176 Ga0207693_10090033 3300025915 Unclassified 2405
177 Ga0207693_10232526 3300025915 Unclassified 1447
178 Ga0207693_10426859 3300025915 Unclassified 1036
179 Ga0207663_10129828 3300025916 Unclassified 1739
180 Ga0207663_10130588 3300025916 Bacteria 1735
181 Ga0207663_10214474 3300025916 Unclassified 1397
182 Ga0207663_10568349 3300025916 Unclassified 888
183 Ga0207660_10361306 3300025917 Unclassified 1165
184 Ga0207649_10311736 3300025920 Bacteria 1153
185 Ga0207646_10010921 3300025922 Bacteria 8822
186 Ga0207646_10218647 3300025922 Bacteria 1721
187 Ga0207646_10270413 3300025922 Bacteria 1536
188 Ga0207646_10501366 3300025922 Unclassified 1094
189 Ga0207646_10612655 3300025922 Unclassified 977
190 Ga0207681_10275990 3300025923 Bacteria 1321
191 Ga0207650_10109512 3300025925 Bacteria 2136
192 Ga0207659_10083816 3300025926 Bacteria 2364
193 Ga0207659_10436189 3300025926 Bacteria 1101
194 Ga0207700_10001708 3300025928 Bacteria 12470
195 Ga0207700_10015067 3300025928 Bacteria 5086
196 Ga0207700_10061685 3300025928 Bacteria 2844
197 Ga0207664_10932582 3300025929 Unclassified 779
198 Ga0207706_10493581 3300025933 Unclassified 1057
199 Ga0207686_10306639 3300025934 Bacteria 1181
200 Ga0207704_10021918 3300025938 Bacteria 3413
201 Ga0207704_10335134 3300025938 Bacteria 1172
202 Ga0207665_10000032 3300025939 Bacteria 91671
203 Ga0207665_10003427 3300025939 Bacteria 10609
204 Ga0207665_10014542 3300025939 Bacteria 5182
205 Ga0207665_10042964 3300025939 Unclassified 3022
206 Ga0207665_10059011 3300025939 Unclassified 2595
207 Ga0207665_10364311 3300025939 Bacteria 1094
208 Ga0207665_11137649 3300025939 Unclassified 622
209 Ga0207665_11220604 3300025939 Bacteria 600
210 Ga0207665_11379175 3300025939 Unclassified 561
211 Ga0207691_10135022 3300025940 Bacteria 2177
212 Ga0207689_10103476 3300025942 Bacteria 2339
213 Ga0207689_11538345 3300025942 Bacteria 555
214 Ga0207679_10034196 3300025945 Bacteria 3583
215 Ga0207667_10526596 3300025949 Bacteria 1197
216 Ga0207712_10930395 3300025961 Bacteria 769
217 Ga0207658_10127271 3300025986 Bacteria 2041
218 Ga0207658_10608179 3300025986 Unclassified 982
219 Ga0207703_10009243 3300026035 Bacteria 7750
220 Ga0207703_10761512 3300026035 Unclassified 923
221 Ga0207639_10414017 3300026041 Bacteria 1217
222 Ga0207641_10001717 3300026088 Bacteria 21227
223 Ga0207675_100102967 3300026118 Bacteria 2690
224 Ga0209984_1048794 3300027424 Unclassified 617
225 Ga0209588_1001584 3300027671 Bacteria 5983
226 Ga0209588_1001716 3300027671 Bacteria 5788
227 Ga0209588_1004870 3300027671 Bacteria 3817
228 Ga0209588_1011853 3300027671 Unclassified 2640
229 Ga0209588_1081859 3300027671 Bacteria 1043
230 Ga0265354_1000080 3300028016 Bacteria 16422
231 Ga0268266_10001361 3300028379 Bacteria 29494
232 Ga0268266_10161824 3300028379 Bacteria 2025
233 Ga0268266_11002664 3300028379 Unclassified 808
234 Ga0268264_10015634 3300028381 Bacteria 6217
235 Ga0268264_10419589 3300028381 Unclassified 1290
236 Ga0265338_10011642 3300028800 Bacteria 10135
237 Ga0265338_10170053 3300028800 Bacteria 1673
238 Ga0265338_10494412 3300028800 Bacteria 862
239 Ga0265770_1022925 3300030878 Unclassified 1002
240 Ga0265765_1005106 3300030879 Bacteria 1368
241 Ga0265760_10081603 3300031090 Bacteria 1002
242 Ga0265332_10032221 3300031238 Bacteria 2284
243 Ga0265325_10004388 3300031241 Bacteria 8916
244 Ga0265339_10003047 3300031249 Bacteria 11803
245 Ga0265331_10001140 3300031250 Bacteria 20266
246 Ga0307408_101687166 3300031548 Unclassified 603
247 Ga0265313_10006586 3300031595 Bacteria 8174
248 Ga0265314_10002353 3300031711 Bacteria 19496
249 Ga0265314_10339017 3300031711 Unclassified 831
250 Ga0265342_10006265 3300031712 Bacteria 8880
251 Ga0316576_10003935 3300031727 Bacteria 8816
252 Ga0307405_10025090 3300031731 Bacteria 3417
253 Ga0307406_11261287 3300031901 Bacteria 644
254 Ga0307409_100984299 3300031995 Bacteria 861
255 Ga0307416_100045471 3300032002 Bacteria 3457
256 Ga0316212_1003351 3300033547 Bacteria 2310
257 Ga0373931_0074730 3300035691 Bacteria 1857
258 Ga0373935_0730526 3300035692 Bacteria 729
259 Ga0373925_0016296 3300037068 Bacteria 5381
260 Ga0373925_0173519 3300037068 Bacteria 1703
261 Ga0395899_0016364 3300037312 Bacteria 5652
262 Ga0395900_0004966 3300037418 Bacteria 13993
263 Ga0395900_0200781 3300037418 Bacteria 2018
264 Ga0395900_0469964 3300037418 Unclassified 1211
265 Ga0395898_0010351 3300037466 Bacteria 9754
266 Ga0395898_0196821 3300037466 Bacteria 1925
267 Ga0395898_0449533 3300037466 Unclassified 1227
268 Ga0395905_0041863 3300037471 Unclassified 4299
269 Ga0395901_0001162 3300038443 Bacteria 27968
270 Ga0395901_0048692 3300038443 Bacteria 4402
271 Ga0395901_0551006 3300038443 Unclassified 1169
272 Ga0436363_1445196 3300039450 Bacteria 2595
273 Ga0451849_0282255 3300041505 Bacteria 858
274 Ga0439450_205866 3300042008 Bacteria 527
275 Ga0451577_1320442 3300042876 Bacteria 641
276 Ga0439440_0133417 3300042993 Bacteria 700
277 Ga0466961_0135619 3300044693 Bacteria 1542
278 Ga0466963_0458290 3300044694 Unclassified 900
279 Ga0453684_0000301 3300044712 Bacteria 207812
280 Ga0453684_0088426 3300044712 Bacteria 3836
281 Ga0453684_0235848 3300044712 Bacteria 2109
282 Ga0453684_0517778 3300044712 Bacteria 1318
283 Ga0466957_0090616 3300044842 Unclassified 1915
284 Ga0466959_0099014 3300045049 Bacteria 2088
285 Ga0451576_0150252 3300045051 Bacteria 2429
286 Ga0451576_0591875 3300045051 Bacteria 1166
287 Ga0451576_1031066 3300045051 Unclassified 862
288 Ga0466958_0031058 3300045836 Bacteria 3175
289 Ga0495603_0347125 3300046455 Bacteria 851
290 Ga0495629_0362659 3300046459 Bacteria 987
291 Ga0495638_0020439 3300046460 Bacteria 4375
292 Ga0495641_0016386 3300046461 Bacteria 3907
293 Ga0495641_0383006 3300046461 Bacteria 637
294 Ga0495653_0445189 3300046463 Bacteria 816
295 Ga0495580_0001454 3300046472 Bacteria 20769
296 Ga0495580_0083375 3300046472 Bacteria 2227
297 Ga0495580_0105846 3300046472 Bacteria 1954
298 Ga0495582_0002105 3300046473 Bacteria 11130
299 Ga0495582_0158506 3300046473 Bacteria 1286
300 Ga0495639_0013975 3300046475 Bacteria 3473
301 Ga0495662_0006574 3300046476 Bacteria 5804
302 Ga0495664_0081424 3300046477 Bacteria 1941
303 Ga0495594_0057038 3300046499 Bacteria 2156
304 Ga0495630_0058564 3300046517 Bacteria 2888
305 Ga0495630_0165203 3300046517 Bacteria 1685
306 Ga0495666_0004799 3300046526 Bacteria 6834
307 Ga0495666_0032690 3300046526 Bacteria 2545
308 Ga0495665_0026418 3300046531 Bacteria 3118
309 Ga0495640_0168665 3300046533 Bacteria 1399
310 Ga0495586_0095030 3300046535 Bacteria 1649
311 Ga0495622_0096327 3300046557 Bacteria 1358
312 Ga0495634_0040639 3300046642 Bacteria 3161
313 Ga0495647_0012313 3300046681 Bacteria 2944
314 Ga0495658_0105732 3300046683 Bacteria 1686
315 Ga0495658_0156328 3300046683 Bacteria 1403
316 Ga0495613_0017914 3300046689 Bacteria 5280
317 Ga0495624_0143806 3300046690 Unclassified 1460
318 Ga0495581_0210984 3300047315 Bacteria 1135
319 Ga0495604_0143753 3300047317 Bacteria 1702
320 Ga0495604_0672974 3300047317 Bacteria 659
321 Ga0495674_0018147 3300047319 Bacteria 6550
322 Ga0495672_0346067 3300047320 Unclassified 692
323 Ga0495676_0069002 3300047321 Bacteria 2729
324 Ga0495680_0160302 3300047322 Bacteria 1634
325 Ga0495684_0537257 3300047471 Bacteria 798
326 Ga0495593_0265888 3300047673 Bacteria 858
327 Ga0495614_0023342 3300048089 Bacteria 2669
328 Ga0496100_0292562 3300048903 Bacteria 1217
329 Ga0496101_0150991 3300048904 Bacteria 1777
330 Ga0496102_0005385 3300048905 Bacteria 10865
331 Ga0496102_0183735 3300048905 Unclassified 1970
332 Ga0496103_0035202 3300048906 Bacteria 3065
333 Ga0496103_0449286 3300048906 Unclassified 827
334 Ga0496104_0057863 3300048907 Unclassified 3669
335 Ga0496105_0109090 3300048908 Unclassified 2285
336 Ga0496106_0017697 3300048909 Bacteria 5271
337 Ga0496107_0039468 3300048910 Bacteria 3387
338 Ga0496108_1020713 3300048911 Unclassified 706
339 Ga0496109_0798715 3300048912 Bacteria 882
340 Ga0496110_1208960 3300048913 Unclassified 665
341 Ga0496114_0003660 3300048917 Bacteria 11827
342 Ga0496114_0093324 3300048917 Bacteria 2559
343 Ga0496114_0225959 3300048917 Bacteria 1644
344 Ga0496114_0458054 3300048917 Unclassified 1129
345 Ga0496115_0007604 3300048918 Bacteria 7982
346 Ga0496115_0037858 3300048918 Bacteria 3824
347 Ga0501031_0238739 3300049568 Bacteria 1182
348 Ga0501071_0768135 3300049587 Bacteria 743
349 Ga0501072_1285145 3300049588 Bacteria 567
350 Ga0501076_1039772 3300049592 Unclassified 675
351 Ga0501077_0889041 3300049593 Bacteria 573
352 Ga0501079_0482640 3300049741 Bacteria 974
353 nmdc:mga05p37_140506_c1 3300050507 Bacteria 2959
354 nmdc:mga05p37_794531_c1 3300050507 Bacteria 1036
355 nmdc:mga09592_101090_c1 3300050508 Bacteria 2470
356 nmdc:mga0qj67_612091_c1 3300050509 Bacteria 871
357 nmdc:mga08y16_540715_c1 3300050511 Bacteria 1180
358 nmdc:mga0n895_186822_c1 3300050512 Bacteria 2103
359 nmdc:mga0n895_204092_c1 3300050512 Bacteria 2007
360 nmdc:mga0n895_56059_c1 3300050512 Bacteria 3881
361 nmdc:mga0rr50_1275808_c1 3300050513 Unclassified 623
362 nmdc:mga0rr50_327417_c1 3300050513 Bacteria 1285
363 nmdc:mga0rr50_409062_c1 3300050513 Bacteria 1147
364 nmdc:mga0rr50_66249_c1 3300050513 Bacteria 1882
365 nmdc:mga08x19_1359_c1 3300050514 Bacteria 15167
366 nmdc:mga08x19_558488_c1 3300050514 Bacteria 810
367 nmdc:mga08x19_680304_c1 3300050514 Bacteria 730
368 nmdc:mga08x19_8109_c1 3300050514 Bacteria 6240
369 nmdc:mga0a205_377015_c1 3300050515 Bacteria 1284
370 Ga0495595_0398974 3300053084 Bacteria 697
371 Ga0495619_0019624 3300053085 Bacteria 4299
372 Ga0495619_0462405 3300053085 Unclassified 874
373 Ga0500592_015325 3300053116 Bacteria 1230
374 Ga0530510_0490667 3300061734 Bacteria 931
375 Ga0070707_100204438
376 Ga0065704_10327188
377 Ga0065715_10001413
378 Ga0065715_10126348
379 Ga0065715_10674082
380 Ga0070676_10017219
381 Ga0070690_100307122
382 Ga0070677_10016177
383 Ga0070666_10000768
384 Ga0070682_100512984
385 Ga0070668_100020421
386 Ga0070669_100000834
387 Ga0070675_100024646
388 Ga0070671_100018826
389 Ga0070674_100010162
390 Ga0070674_100545596
391 Ga0070673_100016045
392 Ga0070659_100029311
393 Ga0070667_100008134
394 Ga0070667_100360074
395 Ga0070703_10001856
396 Ga0070709_10501885
397 Ga0070714_100323103
398 Ga0070713_100221942
399 Ga0070713_100254371
400 Ga0070713_100330271
401 Ga0070710_10130734
402 Ga0070710_11323627
403 Ga0070711_100082138
404 Ga0070711_100176372
405 Ga0070711_100279798
406 Ga0070705_100002256
407 Ga0070705_100771364
408 Ga0070694_100003278
409 Ga0070708_100024979
410 Ga0070708_100035512
411 Ga0070708_100068665
412 Ga0070708_100206072
413 Ga0070663_100365557
414 Ga0070663_101085944
415 Ga0070662_100276230
416 Ga0070681_10105490
417 Ga0068867_100470060
418 Ga0070706_100006454
419 Ga0070706_100028990
420 Ga0070706_100187395
421 Ga0070706_100212121
422 Ga0070707_100061756
423 Ga0070707_100246858
424 Ga0070707_100266057
425 Ga0070707_100832064
426 Ga0070707_101524571
427 Ga0070698_100058706
428 Ga0070699_100004213
429 Ga0070699_100046007
430 Ga0070699_100058406
431 Ga0070699_100259263
432 Ga0070699_100360125
433 Ga0070697_100000061
434 Ga0070697_100012677
435 Ga0070697_100018874
436 Ga0070697_100026204
437 Ga0070697_100145655
438 Ga0070695_100001117
439 Ga0070695_100158522
440 Ga0070695_100365141
441 Ga0070696_100002008
442 Ga0070693_100000014
443 Ga0070693_100027830
444 Ga0070693_100033767
445 Ga0070693_100442416
446 Ga0070665_100001678
447 Ga0070665_101067162
448 Ga0070704_100003164
449 Ga0068855_101847612
450 Ga0070664_100101868
451 Ga0068859_101497403
452 Ga0068864_100205080
453 Ga0068866_10221305
454 Ga0068863_100008359
455 Ga0068863_100504821
456 Ga0068858_100068330
457 Ga0068860_100021553
458 Ga0068860_100234973
459 Ga0081455_10001439
460 Ga0081455_10017516
461 Ga0081455_10019468
462 Ga0081538_10078914
463 Ga0081540_1000215
464 Ga0081539_10275441
465 Ga0070717_10004992
466 Ga0070717_10213466
467 Ga0070715_10025128
468 Ga0070715_10365859
469 Ga0070716_100000707
470 Ga0070716_100001222
471 Ga0070716_100254769
472 Ga0070716_101259847
473 Ga0070712_100045332
474 Ga0070712_100067446
475 Ga0070712_101290680
476 Ga0075367_10027708
477 Ga0097621_100008198
478 Ga0097621_100028046
479 Ga0068871_100013996
480 Ga0068871_100449755
481 Ga0075428_100046532
482 Ga0075431_100186624
483 Ga0075433_10214053
484 Ga0075433_10322891
485 Ga0075434_100079401
486 Ga0075434_100276655
487 Ga0075434_100418775
488 Ga0075429_100004127
489 Ga0068865_100129011
490 Ga0068865_100447204
491 Ga0075436_100424969
492 Ga0097620_101497566
493 Ga0075435_100189611
494 Ga0075435_100281734
495 Ga0075435_100717687
496 Ga0075435_101367814
497 Ga0099794_10002081
498 Ga0099794_10011591
499 Ga0099794_10012579
500 Ga0099794_10025022
501 Ga0099794_10025695
502 Ga0099794_10073383
503 Ga0099795_10083771
504 Ga0099795_10355776
505 Ga0105247_10209840
506 Ga0114129_10221520
507 Ga0105242_10725418
508 Ga0105248_10552485
509 Ga0105249_10098975
510 Ga0105249_10510609
511 Ga0099796_10042025
512 Ga0105239_10086550
513 Ga0157374_10002703
514 Ga0157374_10133209
515 Ga0157378_10000694
516 Ga0157378_10009421
517 Ga0157378_10025370
518 Ga0157378_10161270
519 Ga0157378_10177816
520 Ga0163162_10009094
521 Ga0163162_10078020
522 Ga0163162_10373693
523 Ga0157375_10010726
524 Ga0157375_10108714
525 Ga0157375_10121469
526 Ga0163163_10329708
527 Ga0182008_10098900
528 Ga0157377_10673063
529 Ga0157379_10014642
530 Ga0157376_10000070
531 Ga0157376_10002813
532 Ga0157376_10056228
533 Ga0207697_10001004
534 Ga0207697_10003011
535 Ga0207653_10001171
536 Ga0207692_10060046
537 Ga0207642_10128413
538 Ga0207688_10010039
539 Ga0207685_10229726
540 Ga0207685_10533363
541 Ga0207699_10160790
542 Ga0207699_10291151
543 Ga0207699_10307447
544 Ga0207645_10013243
545 Ga0207684_10009365
546 Ga0207684_10867585
547 Ga0207707_10096315
548 Ga0207693_10007292
549 Ga0207693_10019972
550 Ga0207693_10090033
551 Ga0207693_10232526
552 Ga0207693_10426859
553 Ga0207663_10129828
554 Ga0207663_10130588
555 Ga0207663_10214474
556 Ga0207663_10568349
557 Ga0207660_10361306
558 Ga0207649_10311736
559 Ga0207646_10010921
560 Ga0207646_10218647
561 Ga0207646_10270413
562 Ga0207646_10501366
563 Ga0207646_10612655
564 Ga0207681_10275990
565 Ga0207650_10109512
566 Ga0207659_10083816
567 Ga0207659_10436189
568 Ga0207700_10001708
569 Ga0207700_10015067
570 Ga0207700_10061685
571 Ga0207664_10932582
572 Ga0207706_10493581
573 Ga0207686_10306639
574 Ga0207704_10021918
575 Ga0207704_10335134
576 Ga0207665_10000032
577 Ga0207665_10003427
578 Ga0207665_10014542
579 Ga0207665_10042964
580 Ga0207665_10059011
581 Ga0207665_10364311
582 Ga0207665_11137649
583 Ga0207665_11220604
584 Ga0207665_11379175
585 Ga0207691_10135022
586 Ga0207689_10103476
587 Ga0207689_11538345
588 Ga0207679_10034196
589 Ga0207667_10526596
590 Ga0207712_10930395
591 Ga0207658_10127271
592 Ga0207658_10608179
593 Ga0207703_10009243
594 Ga0207703_10761512
595 Ga0207639_10414017
596 Ga0207641_10001717
597 Ga0207675_100102967
598 Ga0209984_1048794
599 Ga0209588_1001584
600 Ga0209588_1001716
601 Ga0209588_1004870
602 Ga0209588_1011853
603 Ga0209588_1081859
604 Ga0265354_1000080
605 Ga0268266_10001361
606 Ga0268266_10161824
607 Ga0268266_11002664
608 Ga0268264_10015634
609 Ga0268264_10419589
610 Ga0265338_10011642
611 Ga0265338_10170053
612 Ga0265338_10494412
613 Ga0265770_1022925
614 Ga0265765_1005106
615 Ga0265760_10081603
616 Ga0265332_10032221
617 Ga0265325_10004388
618 Ga0265339_10003047
619 Ga0265331_10001140
620 Ga0307408_101687166
621 Ga0265313_10006586
622 Ga0265314_10002353
623 Ga0265314_10339017
624 Ga0265342_10006265
625 Ga0316576_10003935
626 Ga0307405_10025090
627 Ga0307406_11261287
628 Ga0307409_100984299
629 Ga0307416_100045471
630 Ga0316212_1003351
631 Ga0373931_0074730
632 Ga0373935_0730526
633 Ga0373925_0016296
634 Ga0373925_0173519
635 Ga0395899_0016364
636 Ga0395900_0004966
637 Ga0395900_0200781
638 Ga0395900_0469964
639 Ga0395898_0010351
640 Ga0395898_0196821
641 Ga0395898_0449533
642 Ga0395905_0041863
643 Ga0395901_0001162
644 Ga0395901_0048692
645 Ga0395901_0551006
646 Ga0436363_1445196
647 Ga0451849_0282255
648 Ga0439450_205866
649 Ga0451577_1320442
650 Ga0439440_0133417
651 Ga0466961_0135619
652 Ga0466963_0458290
653 Ga0453684_0000301
654 Ga0453684_0088426
655 Ga0453684_0235848
656 Ga0453684_0517778
657 Ga0466957_0090616
658 Ga0466959_0099014
659 Ga0451576_0150252
660 Ga0451576_0591875
661 Ga0451576_1031066
662 Ga0466958_0031058
663 Ga0495603_0347125
664 Ga0495629_0362659
665 Ga0495638_0020439
666 Ga0495641_0016386
667 Ga0495641_0383006
668 Ga0495653_0445189
669 Ga0495580_0001454
670 Ga0495580_0083375
671 Ga0495580_0105846
672 Ga0495582_0002105
673 Ga0495582_0158506
674 Ga0495639_0013975
675 Ga0495662_0006574
676 Ga0495664_0081424
677 Ga0495594_0057038
678 Ga0495630_0058564
679 Ga0495630_0165203
680 Ga0495666_0004799
681 Ga0495666_0032690
682 Ga0495665_0026418
683 Ga0495640_0168665
684 Ga0495586_0095030
685 Ga0495622_0096327
686 Ga0495634_0040639
687 Ga0495647_0012313
688 Ga0495658_0105732
689 Ga0495658_0156328
690 Ga0495613_0017914
691 Ga0495624_0143806
692 Ga0495581_0210984
693 Ga0495604_0143753
694 Ga0495604_0672974
695 Ga0495674_0018147
696 Ga0495672_0346067
697 Ga0495676_0069002
698 Ga0495680_0160302
699 Ga0495684_0537257
700 Ga0495593_0265888
701 Ga0495614_0023342
702 Ga0496100_0292562
703 Ga0496101_0150991
704 Ga0496102_0005385
705 Ga0496102_0183735
706 Ga0496103_0035202
707 Ga0496103_0449286
708 Ga0496104_0057863
709 Ga0496105_0109090
710 Ga0496106_0017697
711 Ga0496107_0039468
712 Ga0496108_1020713
713 Ga0496109_0798715
714 Ga0496110_1208960
715 Ga0496114_0003660
716 Ga0496114_0093324
717 Ga0496114_0225959
718 Ga0496114_0458054
719 Ga0496115_0007604
720 Ga0496115_0037858
721 Ga0501031_0238739
722 Ga0501071_0768135
723 Ga0501072_1285145
724 Ga0501076_1039772
725 Ga0501077_0889041
726 Ga0501079_0482640
727 nmdc:mga05p37_140506_c1
728 nmdc:mga05p37_794531_c1
729 nmdc:mga09592_101090_c1
730 nmdc:mga0qj67_612091_c1
731 nmdc:mga08y16_540715_c1
732 nmdc:mga0n895_186822_c1
733 nmdc:mga0n895_204092_c1
734 nmdc:mga0n895_56059_c1
735 nmdc:mga0rr50_1275808_c1
736 nmdc:mga0rr50_327417_c1
737 nmdc:mga0rr50_409062_c1
738 nmdc:mga0rr50_66249_c1
739 nmdc:mga08x19_1359_c1
740 nmdc:mga08x19_558488_c1
741 nmdc:mga08x19_680304_c1
742 nmdc:mga08x19_8109_c1
743 nmdc:mga0a205_377015_c1
744 Ga0495595_0398974
745 Ga0495619_0019624
746 Ga0495619_0462405
747 Ga0500592_015325
748 Ga0530510_0490667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

36

178

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9791 1 143
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9787 1 144
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9697 1 148
3ko7-assembly2.cif.gz_D dtd from plasmodium falciparum in complex with d-lysine 0.9664 1 147
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9654 1 144
ID Description Score Start End Superfamily
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9787 1 144 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9751 1 144 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9718 1 147 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9697 1 148 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9693 1 147 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A418SHC7-F1-model_v4 D-aminoacyl-tRNA deacylase (EC 3.1.1.96) 0.9959 30 141 GO:0005737
GO:0051500
AF-A0A366W847-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9948 1 144 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1J5JLJ2-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9947 1 144 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-V9WGH0-F1-model_v4 deleted 0.9945 1 145
AF-A0A1X6YHA8-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.-.-) 0.9944 20 141 GO:0005737
GO:0051500

Map