F426627

General Info

Members Datasets Scaffolds Average Seq Length
374 158 748 122

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100765178|Ga0070706_1007651781
Length 116
Sequence MGKMWRVYSGADGESHIAELPLAFKPFHDVEGAHGEGTPLQAASGIAFRVAPPGYVLDWHCAPRRQYSISLSGAAEIEVGDGTIAVLAEDLTGRGHVTRVVGAEPRLYAIVPLTDG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
110 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 99.73
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100765178 3300005467 Bacteria 895
2 JGI25406J46586_10040884 3300003203 Bacteria 1638
3 JGI25404J52841_10088224 3300003659 Bacteria 648
4 Ga0065707_10114627 3300005295 Bacteria 2290
5 Ga0070690_100143611 3300005330 Bacteria 1622
6 Ga0068869_100017717 3300005334 Bacteria 4836
7 Ga0068869_100181790 3300005334 Bacteria 1649
8 Ga0070680_100992901 3300005336 Unclassified 725
9 Ga0070689_100339230 3300005340 Unclassified 1258
10 Ga0070689_100476277 3300005340 Bacteria 1066
11 Ga0070691_10464529 3300005341 Unclassified 725
12 Ga0070692_10178896 3300005345 Bacteria 1228
13 Ga0070692_10832405 3300005345 Bacteria 633
14 Ga0070668_101051490 3300005347 Bacteria 733
15 Ga0070669_100103629 3300005353 Bacteria 2150
16 Ga0070669_100436062 3300005353 Bacteria 1078
17 Ga0070675_100947808 3300005354 Bacteria 790
18 Ga0070688_100424379 3300005365 Bacteria 989
19 Ga0070688_100471039 3300005365 Bacteria 943
20 Ga0070659_102087413 3300005366 Bacteria 509
21 Ga0070703_10074401 3300005406 Bacteria 1142
22 Ga0070703_10241152 3300005406 Bacteria 729
23 Ga0070701_10241514 3300005438 Bacteria 1087
24 Ga0070711_100092241 3300005439 Unclassified 2185
25 Ga0070705_100024314 3300005440 Bacteria 3268
26 Ga0070705_100684335 3300005440 Unclassified 804
27 Ga0070700_100118330 3300005441 Bacteria 1771
28 Ga0070694_100014423 3300005444 Bacteria 4947
29 Ga0070694_100120309 3300005444 Bacteria 1883
30 Ga0070694_100337759 3300005444 Bacteria 1164
31 Ga0070708_100007087 3300005445 Bacteria 8944
32 Ga0070708_100008615 3300005445 Bacteria 8194
33 Ga0070708_100021646 3300005445 Bacteria 5440
34 Ga0070708_100350939 3300005445 Bacteria 1390
35 Ga0070708_100429166 3300005445 Bacteria 1246
36 Ga0070662_100281891 3300005457 Bacteria 1345
37 Ga0068867_100309214 3300005459 Bacteria 1305
38 Ga0068867_100679579 3300005459 Bacteria 906
39 Ga0068867_101593117 3300005459 Bacteria 610
40 Ga0070706_100027844 3300005467 Bacteria 5198
41 Ga0070706_100098122 3300005467 Bacteria 2722
42 Ga0070706_100267594 3300005467 Unclassified 1595
43 Ga0070706_100294512 3300005467 Bacteria 1514
44 Ga0070707_100030598 3300005468 Bacteria 5126
45 Ga0070707_100040880 3300005468 Bacteria 4436
46 Ga0070707_100107739 3300005468 Bacteria 2703
47 Ga0070707_100306080 3300005468 Bacteria 1544
48 Ga0070707_101317781 3300005468 Bacteria 688
49 Ga0070698_100058998 3300005471 Bacteria 3877
50 Ga0070698_100096548 3300005471 Bacteria 2932
51 Ga0070698_100255085 3300005471 Unclassified 1686
52 Ga0070698_100580050 3300005471 Bacteria 1061
53 Ga0070699_100076151 3300005518 Bacteria 2920
54 Ga0070699_100154925 3300005518 Bacteria 2027
55 Ga0070699_100209114 3300005518 Unclassified 1736
56 Ga0070699_100233433 3300005518 Bacteria 1641
57 Ga0070699_100622091 3300005518 Bacteria 985
58 Ga0070699_100891387 3300005518 Unclassified 815
59 Ga0070697_100005592 3300005536 Bacteria 9688
60 Ga0070697_100091517 3300005536 Bacteria 2515
61 Ga0070697_100233461 3300005536 Bacteria 1569
62 Ga0070697_100602748 3300005536 Bacteria 965
63 Ga0070697_100661143 3300005536 Bacteria 920
64 Ga0070697_101503943 3300005536 Unclassified 602
65 Ga0070672_100006026 3300005543 Bacteria 8101
66 Ga0070695_100006448 3300005545 Bacteria 6938
67 Ga0070695_100066268 3300005545 Bacteria 2353
68 Ga0070695_101111936 3300005545 Bacteria 647
69 Ga0070695_101151006 3300005545 Bacteria 636
70 Ga0070696_100192939 3300005546 Bacteria 1517
71 Ga0070696_100718894 3300005546 Bacteria 816
72 Ga0070696_101217814 3300005546 Bacteria 637
73 Ga0070693_100056919 3300005547 Bacteria 2258
74 Ga0070704_100088185 3300005549 Bacteria 2304
75 Ga0070704_100293375 3300005549 Bacteria 1352
76 Ga0070704_100842257 3300005549 Bacteria 822
77 Ga0070704_100933874 3300005549 Bacteria 782
78 Ga0070704_101386254 3300005549 Unclassified 645
79 Ga0070704_101526524 3300005549 Bacteria 615
80 Ga0068854_101347891 3300005578 Unclassified 644
81 Ga0070702_101293080 3300005615 Unclassified 592
82 Ga0068859_100223821 3300005617 Bacteria 1969
83 Ga0068859_102162656 3300005617 Bacteria 614
84 Ga0068864_100323610 3300005618 Bacteria 1449
85 Ga0068864_101273164 3300005618 Unclassified 735
86 Ga0068866_10341901 3300005718 Bacteria 948
87 Ga0068866_10881022 3300005718 Bacteria 628
88 Ga0068861_100177493 3300005719 Bacteria 1770
89 Ga0068870_10348148 3300005840 Bacteria 950
90 Ga0068860_100411946 3300005843 Bacteria 1338
91 Ga0068860_100874341 3300005843 Bacteria 914
92 Ga0068862_100016206 3300005844 Bacteria 6200
93 Ga0068862_100124814 3300005844 Bacteria 2272
94 Ga0068862_101574907 3300005844 Unclassified 664
95 Ga0081455_10296518 3300005937 Bacteria 1162
96 Ga0081540_1007685 3300005983 Bacteria 7644
97 Ga0081539_10000044 3300005985 Bacteria 284021
98 Ga0075432_10356619 3300006058 Bacteria 621
99 Ga0070716_100677234 3300006173 Unclassified 785
100 Ga0070716_101087544 3300006173 Unclassified 637
101 Ga0070712_100008516 3300006175 Bacteria 6453
102 Ga0075428_100006518 3300006844 Bacteria 12982
103 Ga0075428_102244504 3300006844 Bacteria 562
104 Ga0075430_100105632 3300006846 Bacteria 2350
105 Ga0075430_100860933 3300006846 Bacteria 747
106 Ga0075430_101062693 3300006846 Bacteria 667
107 Ga0075430_101452727 3300006846 Bacteria 563
108 Ga0075430_101457658 3300006846 Bacteria 562
109 Ga0075431_100000635 3300006847 Bacteria 29710
110 Ga0075431_100005838 3300006847 Bacteria 12178
111 Ga0075431_100009346 3300006847 Bacteria 9841
112 Ga0075431_100124254 3300006847 Bacteria 2663
113 Ga0075431_100640527 3300006847 Bacteria 1044
114 Ga0075431_100858699 3300006847 Bacteria 879
115 Ga0075431_101833621 3300006847 Bacteria 562
116 Ga0075433_10101438 3300006852 Bacteria 2548
117 Ga0075433_10158132 3300006852 Bacteria 2016
118 Ga0075433_10535895 3300006852 Bacteria 1030
119 Ga0075433_10809334 3300006852 Bacteria 819
120 Ga0075433_10968971 3300006852 Bacteria 741
121 Ga0075434_100013819 3300006871 Bacteria 7699
122 Ga0075434_100019747 3300006871 Bacteria 6524
123 Ga0075434_100027934 3300006871 Bacteria 5539
124 Ga0075434_100057678 3300006871 Bacteria 3859
125 Ga0075434_100390005 3300006871 Bacteria 1414
126 Ga0075434_100718282 3300006871 Bacteria 1016
127 Ga0075429_100003182 3300006880 Bacteria 13956
128 Ga0075429_100010899 3300006880 Bacteria 7864
129 Ga0075429_100045716 3300006880 Bacteria 3809
130 Ga0075429_100605840 3300006880 Bacteria 960
131 Ga0075429_101019487 3300006880 Bacteria 723
132 Ga0075429_101204844 3300006880 Bacteria 661
133 Ga0068865_100630423 3300006881 Bacteria 909
134 Ga0075436_100113707 3300006914 Bacteria 1890
135 Ga0097620_100223812 3300006931 Bacteria 1969
136 Ga0097620_102162089 3300006931 Bacteria 614
137 Ga0075435_100002353 3300007076 Bacteria 12527
138 Ga0075435_100007018 3300007076 Bacteria 7994
139 Ga0075435_100084359 3300007076 Bacteria 2614
140 Ga0075435_100426126 3300007076 Bacteria 1143
141 Ga0075435_100543510 3300007076 Bacteria 1006
142 Ga0075435_100935417 3300007076 Unclassified 756
143 Ga0099794_10022209 3300007265 Bacteria 2891
144 Ga0111539_10006976 3300009094 Bacteria 14497
145 Ga0111539_10118443 3300009094 Bacteria 3104
146 Ga0105245_10657596 3300009098 Bacteria 1078
147 Ga0105245_12229598 3300009098 Bacteria 601
148 Ga0114129_10000149 3300009147 Bacteria 73883
149 Ga0114129_10003297 3300009147 Bacteria 22665
150 Ga0114129_10335865 3300009147 Bacteria 2005
151 Ga0114129_10365445 3300009147 Bacteria 1908
152 Ga0114129_10514036 3300009147 Unclassified 1562
153 Ga0114129_10836561 3300009147 Bacteria 1171
154 Ga0114129_11871138 3300009147 Bacteria 728
155 Ga0114129_12496763 3300009147 Bacteria 618
156 Ga0114129_12504072 3300009147 Unclassified 617
157 Ga0105243_10032987 3300009148 Bacteria 4002
158 Ga0105243_10438413 3300009148 Bacteria 1222
159 Ga0105242_10525158 3300009176 Bacteria 1130
160 Ga0105248_10508222 3300009177 Bacteria 1359
161 Ga0105248_12071006 3300009177 Bacteria 647
162 Ga0105237_11986465 3300009545 Bacteria 590
163 Ga0105249_10066238 3300009553 Bacteria 3325
164 Ga0105249_10136541 3300009553 Bacteria 2347
165 Ga0105249_10651747 3300009553 Bacteria 1111
166 Ga0105249_10829611 3300009553 Bacteria 989
167 Ga0105249_11446640 3300009553 Bacteria 759
168 Ga0105249_13561424 3300009553 Unclassified 502
169 Ga0105246_11435679 3300011119 Bacteria 645
170 Ga0157378_10289375 3300013297 Bacteria 1582
171 Ga0163162_10495277 3300013306 Bacteria 1353
172 Ga0163162_10832691 3300013306 Bacteria 1039
173 Ga0163162_11269915 3300013306 Unclassified 836
174 Ga0163163_10581205 3300014325 Bacteria 1183
175 Ga0157380_10254140 3300014326 Bacteria 1592
176 Ga0207653_10188897 3300025885 Unclassified 773
177 Ga0207642_10870621 3300025899 Bacteria 576
178 Ga0207684_10002344 3300025910 Bacteria 19186
179 Ga0207684_10003868 3300025910 Bacteria 14381
180 Ga0207684_10019957 3300025910 Bacteria 5727
181 Ga0207684_10158816 3300025910 Bacteria 1946
182 Ga0207684_10879525 3300025910 Bacteria 754
183 Ga0207654_10399356 3300025911 Bacteria 955
184 Ga0207693_10071208 3300025915 Bacteria 2721
185 Ga0207660_10028751 3300025917 Bacteria 3806
186 Ga0207660_10940282 3300025917 Bacteria 705
187 Ga0207652_10909635 3300025921 Bacteria 777
188 Ga0207646_10001218 3300025922 Bacteria 32306
189 Ga0207646_10025275 3300025922 Bacteria 5434
190 Ga0207646_10248343 3300025922 Bacteria 1607
191 Ga0207646_10402457 3300025922 Bacteria 1236
192 Ga0207646_10480248 3300025922 Bacteria 1120
193 Ga0207681_10151427 3300025923 Bacteria 1739
194 Ga0207681_11045468 3300025923 Bacteria 685
195 Ga0207687_10419980 3300025927 Bacteria 1103
196 Ga0207706_10184216 3300025933 Bacteria 1834
197 Ga0207709_10080369 3300025935 Bacteria 2099
198 Ga0207670_10413184 3300025936 Bacteria 1081
199 Ga0207670_11819561 3300025936 Unclassified 518
200 Ga0207665_10860424 3300025939 Unclassified 718
201 Ga0207691_10008541 3300025940 Bacteria 9833
202 Ga0207691_10568038 3300025940 Unclassified 961
203 Ga0207689_10005769 3300025942 Bacteria 10993
204 Ga0207712_10061384 3300025961 Bacteria 2668
205 Ga0207712_10090231 3300025961 Bacteria 2255
206 Ga0207712_10549063 3300025961 Bacteria 993
207 Ga0207668_10490219 3300025972 Bacteria 1055
208 Ga0207640_11385423 3300025981 Unclassified 630
209 Ga0207703_10894046 3300026035 Bacteria 850
210 Ga0207708_10343621 3300026075 Bacteria 1223
211 Ga0207648_10265458 3300026089 Bacteria 1532
212 Ga0207648_10765838 3300026089 Bacteria 897
213 Ga0207648_10895764 3300026089 Unclassified 829
214 Ga0207648_11209957 3300026089 Bacteria 710
215 Ga0209588_1004308 3300027671 Bacteria 4005
216 Ga0207428_10000029 3300027907 Bacteria 241338
217 Ga0207428_10000613 3300027907 Bacteria 42147
218 Ga0268265_10004536 3300028380 Bacteria 9607
219 Ga0268265_11559131 3300028380 Unclassified 665
220 Ga0268264_10416113 3300028381 Bacteria 1295
221 Ga0268264_10769098 3300028381 Bacteria 960
222 Ga0268264_10798157 3300028381 Bacteria 943
223 Ga0307408_100475666 3300031548 Bacteria 1089
224 Ga0307406_10320936 3300031901 Bacteria 1198
225 Ga0307409_100285401 3300031995 Bacteria 1528
226 Ga0307409_100373445 3300031995 Unclassified 1353
227 Ga0307416_100841289 3300032002 Bacteria 1015
228 Ga0307411_10157470 3300032005 Bacteria 1696
229 Ga0307411_10750050 3300032005 Bacteria 855
230 Ga0373948_0125614 3300034817 Unclassified 623
231 Ga0373940_0005103 3300035088 Bacteria 2825
232 Ga0373949_0043941 3300035090 Unclassified 1107
233 Ga0373949_0271784 3300035090 Bacteria 530
234 Ga0373932_0068842 3300035112 Bacteria 1093
235 Ga0373932_0180125 3300035112 Bacteria 741
236 Ga0373960_0052457 3300035121 Bacteria 1214
237 Ga0373942_0321015 3300035207 Unclassified 541
238 Ga0373962_0009527 3300035242 Bacteria 2409
239 Ga0373962_0088397 3300035242 Bacteria 951
240 Ga0373931_0003204 3300035691 Bacteria 7303
241 Ga0373931_0037364 3300035691 Unclassified 2536
242 Ga0373931_0226450 3300035691 Bacteria 1128
243 Ga0439444_0032508 3300042437 Bacteria 987
244 Ga0439460_0028086 3300042461 Bacteria 1585
245 Ga0451577_0005520 3300042876 Bacteria 12912
246 Ga0453684_0584043 3300044712 Bacteria 1227
247 Ga0451576_0005892 3300045051 Bacteria 15209
248 Ga0451576_0367396 3300045051 Unclassified 1507
249 Ga0451576_0416386 3300045051 Unclassified 1409
250 Ga0451576_1503705 3300045051 Bacteria 699
251 Ga0495603_0204404 3300046455 Bacteria 1141
252 Ga0495580_0018281 3300046472 Bacteria 5221
253 Ga0495580_0030004 3300046472 Bacteria 3941
254 Ga0495580_0169254 3300046472 Bacteria 1511
255 Ga0495594_0347095 3300046499 Bacteria 845
256 Ga0496107_0854091 3300048910 Bacteria 665
257 Ga0501031_0563112 3300049568 Bacteria 734
258 Ga0501033_0881208 3300049570 Bacteria 602
259 Ga0501036_0015819 3300049572 Bacteria 6301
260 Ga0501036_0475366 3300049572 Bacteria 1041
261 Ga0501036_1256013 3300049572 Bacteria 603
262 Ga0501038_0019949 3300049574 Bacteria 6034
263 Ga0501038_0916121 3300049574 Bacteria 647
264 Ga0501039_0019175 3300049575 Bacteria 5249
265 Ga0501039_0082984 3300049575 Bacteria 2496
266 Ga0501039_0217601 3300049575 Bacteria 1502
267 Ga0501040_0047998 3300049576 Bacteria 2917
268 Ga0501040_0501729 3300049576 Bacteria 875
269 Ga0501041_0097507 3300049577 Unclassified 1818
270 Ga0501042_0017669 3300049578 Bacteria 4924
271 Ga0501042_0077768 3300049578 Bacteria 2376
272 Ga0501043_0353508 3300049579 Unclassified 1116
273 Ga0501043_0439178 3300049579 Bacteria 982
274 Ga0501046_0047656 3300049580 Bacteria 3397
275 Ga0501046_1008598 3300049580 Bacteria 578
276 Ga0501048_1397348 3300049582 Bacteria 503
277 Ga0501068_0138191 3300049584 Unclassified 1527
278 Ga0501068_0200464 3300049584 Bacteria 1266
279 Ga0501068_0350182 3300049584 Bacteria 949
280 Ga0501069_0280006 3300049585 Bacteria 976
281 Ga0501069_0494420 3300049585 Bacteria 729
282 Ga0501070_0348241 3300049586 Bacteria 1203
283 Ga0501071_0153478 3300049587 Bacteria 1718
284 Ga0501071_0484461 3300049587 Bacteria 948
285 Ga0501071_0634716 3300049587 Bacteria 822
286 Ga0501071_1547439 3300049587 Bacteria 512
287 Ga0501072_0015488 3300049588 Bacteria 5845
288 Ga0501072_0035669 3300049588 Bacteria 3896
289 Ga0501072_0137964 3300049588 Bacteria 1945
290 Ga0501072_0419854 3300049588 Bacteria 1060
291 Ga0501073_0435095 3300049589 Unclassified 907
292 Ga0501073_1100620 3300049589 Bacteria 546
293 Ga0501074_0067339 3300049590 Bacteria 2575
294 Ga0501074_0286433 3300049590 Bacteria 1171
295 Ga0501074_0380610 3300049590 Bacteria 1001
296 Ga0501074_0644827 3300049590 Bacteria 748
297 Ga0501075_0007961 3300049591 Bacteria 7362
298 Ga0501075_0010855 3300049591 Bacteria 6423
299 Ga0501075_0133182 3300049591 Bacteria 1894
300 Ga0501075_0564442 3300049591 Bacteria 868
301 Ga0501075_0728241 3300049591 Bacteria 755
302 Ga0501076_0008818 3300049592 Bacteria 7412
303 Ga0501076_0069910 3300049592 Bacteria 2806
304 Ga0501076_0084459 3300049592 Bacteria 2550
305 Ga0501076_0876430 3300049592 Bacteria 740
306 Ga0501077_0000795 3300049593 Bacteria 19101
307 Ga0501077_0098389 3300049593 Bacteria 1854
308 Ga0501077_0367074 3300049593 Bacteria 919
309 Ga0501079_0005919 3300049741 Bacteria 9163
310 Ga0501079_0046181 3300049741 Bacteria 3360
311 Ga0501079_0071438 3300049741 Bacteria 2682
312 Ga0501079_0083817 3300049741 Bacteria 2466
313 Ga0501080_0408940 3300049742 Bacteria 1220
314 Ga0501080_0715712 3300049742 Bacteria 882
315 Ga0501081_0006349 3300049743 Bacteria 7665
316 Ga0501081_0061053 3300049743 Bacteria 2613
317 Ga0501081_0159293 3300049743 Bacteria 1626
318 Ga0501081_0543855 3300049743 Unclassified 867
319 Ga0501081_0629834 3300049743 Bacteria 804
320 Ga0501081_0737917 3300049743 Bacteria 740
321 Ga0501083_0993272 3300049744 Bacteria 546
322 Ga0501045_0038161 3300049824 Bacteria 3493
323 Ga0501045_0093615 3300049824 Bacteria 2222
324 Ga0501045_0271580 3300049824 Bacteria 1262
325 nmdc:mga05p37_1308_c1 3300050507 Bacteria 28963
326 nmdc:mga05p37_1705994_c1 3300050507 Bacteria 614
327 nmdc:mga05p37_68076_c1 3300050507 Bacteria 4378
328 nmdc:mga05p37_71108_c1 3300050507 Bacteria 4280
329 nmdc:mga05p37_737997_c1 3300050507 Bacteria 1088
330 nmdc:mga05p37_826253_c1 3300050507 Bacteria 1010
331 nmdc:mga09592_1275226_c1 3300050508 Bacteria 605
332 nmdc:mga09592_27142_c1 3300050508 Bacteria 4751
333 nmdc:mga09592_3499_c1 3300050508 Bacteria 12676
334 nmdc:mga09592_467418_c1 3300050508 Bacteria 1088
335 nmdc:mga09592_60318_c1 3300050508 Bacteria 3207
336 nmdc:mga09592_667273_c1 3300050508 Bacteria 887
337 nmdc:mga0qj67_206394_c1 3300050509 Bacteria 1596
338 nmdc:mga0qj67_232089_c1 3300050509 Bacteria 1497
339 nmdc:mga0qj67_57784_c1 3300050509 Bacteria 3076
340 nmdc:mga06r32_1135276_c1 3300050510 Bacteria 730
341 nmdc:mga06r32_216787_c1 3300050510 Bacteria 1902
342 nmdc:mga06r32_406844_c1 3300050510 Bacteria 1343
343 nmdc:mga06r32_432836_c1 3300050510 Bacteria 1296
344 nmdc:mga08y16_1300_c1 3300050511 Bacteria 24801
345 nmdc:mga08y16_136952_c1 3300050511 Bacteria 2545
346 nmdc:mga0n895_166025_c1 3300050512 Bacteria 2239
347 nmdc:mga0n895_169853_c1 3300050512 Bacteria 2213
348 nmdc:mga0n895_181753_c1 3300050512 Bacteria 2135
349 nmdc:mga0n895_19021_c1 3300050512 Bacteria 6373
350 nmdc:mga0n895_237279_c1 3300050512 Bacteria 1850
351 nmdc:mga0n895_49098_c1 3300050512 Bacteria 4133
352 nmdc:mga0n895_62199_c1 3300050512 Bacteria 3689
353 nmdc:mga0rr50_223859_c1 3300050513 Bacteria 1554
354 nmdc:mga0rr50_262575_c1 3300050513 Bacteria 1437
355 nmdc:mga0rr50_695604_c1 3300050513 Bacteria 868
356 nmdc:mga0rr50_7002_c1 3300050513 Bacteria 6919
357 nmdc:mga0rr50_908796_c1 3300050513 Bacteria 751
358 nmdc:mga08x19_541436_c1 3300050514 Unclassified 823
359 nmdc:mga0a205_1141607_c1 3300050515 Bacteria 627
360 nmdc:mga0a205_202751_c1 3300050515 Bacteria 1874
361 nmdc:mga0a205_30369_c1 3300050515 Bacteria 5174
362 nmdc:mga0a205_853411_c1 3300050515 Unclassified 758
363 nmdc:mga0a205_99500_c1 3300050515 Bacteria 2806
364 Ga0501084_0011887 3300054114 Bacteria 7207
365 Ga0501084_0321554 3300054114 Bacteria 1307
366 Ga0501084_0351741 3300054114 Unclassified 1245
367 Ga0501084_0798105 3300054114 Unclassified 795
368 Ga0501084_0834983 3300054114 Bacteria 775
369 Ga0501082_0002253 3300060353 Bacteria 16888
370 Ga0501082_0280901 3300060353 Bacteria 1449
371 Ga0501082_0425324 3300060353 Bacteria 1160
372 Ga0530510_0064207 3300061734 Bacteria 2659
373 Ga0530510_0303430 3300061734 Bacteria 1195
374 Ga0530510_1279327 3300061734 Unclassified 562
375 Ga0070706_100765178
376 JGI25406J46586_10040884
377 JGI25404J52841_10088224
378 Ga0065707_10114627
379 Ga0070690_100143611
380 Ga0068869_100017717
381 Ga0068869_100181790
382 Ga0070680_100992901
383 Ga0070689_100339230
384 Ga0070689_100476277
385 Ga0070691_10464529
386 Ga0070692_10178896
387 Ga0070692_10832405
388 Ga0070668_101051490
389 Ga0070669_100103629
390 Ga0070669_100436062
391 Ga0070675_100947808
392 Ga0070688_100424379
393 Ga0070688_100471039
394 Ga0070659_102087413
395 Ga0070703_10074401
396 Ga0070703_10241152
397 Ga0070701_10241514
398 Ga0070711_100092241
399 Ga0070705_100024314
400 Ga0070705_100684335
401 Ga0070700_100118330
402 Ga0070694_100014423
403 Ga0070694_100120309
404 Ga0070694_100337759
405 Ga0070708_100007087
406 Ga0070708_100008615
407 Ga0070708_100021646
408 Ga0070708_100350939
409 Ga0070708_100429166
410 Ga0070662_100281891
411 Ga0068867_100309214
412 Ga0068867_100679579
413 Ga0068867_101593117
414 Ga0070706_100027844
415 Ga0070706_100098122
416 Ga0070706_100267594
417 Ga0070706_100294512
418 Ga0070707_100030598
419 Ga0070707_100040880
420 Ga0070707_100107739
421 Ga0070707_100306080
422 Ga0070707_101317781
423 Ga0070698_100058998
424 Ga0070698_100096548
425 Ga0070698_100255085
426 Ga0070698_100580050
427 Ga0070699_100076151
428 Ga0070699_100154925
429 Ga0070699_100209114
430 Ga0070699_100233433
431 Ga0070699_100622091
432 Ga0070699_100891387
433 Ga0070697_100005592
434 Ga0070697_100091517
435 Ga0070697_100233461
436 Ga0070697_100602748
437 Ga0070697_100661143
438 Ga0070697_101503943
439 Ga0070672_100006026
440 Ga0070695_100006448
441 Ga0070695_100066268
442 Ga0070695_101111936
443 Ga0070695_101151006
444 Ga0070696_100192939
445 Ga0070696_100718894
446 Ga0070696_101217814
447 Ga0070693_100056919
448 Ga0070704_100088185
449 Ga0070704_100293375
450 Ga0070704_100842257
451 Ga0070704_100933874
452 Ga0070704_101386254
453 Ga0070704_101526524
454 Ga0068854_101347891
455 Ga0070702_101293080
456 Ga0068859_100223821
457 Ga0068859_102162656
458 Ga0068864_100323610
459 Ga0068864_101273164
460 Ga0068866_10341901
461 Ga0068866_10881022
462 Ga0068861_100177493
463 Ga0068870_10348148
464 Ga0068860_100411946
465 Ga0068860_100874341
466 Ga0068862_100016206
467 Ga0068862_100124814
468 Ga0068862_101574907
469 Ga0081455_10296518
470 Ga0081540_1007685
471 Ga0081539_10000044
472 Ga0075432_10356619
473 Ga0070716_100677234
474 Ga0070716_101087544
475 Ga0070712_100008516
476 Ga0075428_100006518
477 Ga0075428_102244504
478 Ga0075430_100105632
479 Ga0075430_100860933
480 Ga0075430_101062693
481 Ga0075430_101452727
482 Ga0075430_101457658
483 Ga0075431_100000635
484 Ga0075431_100005838
485 Ga0075431_100009346
486 Ga0075431_100124254
487 Ga0075431_100640527
488 Ga0075431_100858699
489 Ga0075431_101833621
490 Ga0075433_10101438
491 Ga0075433_10158132
492 Ga0075433_10535895
493 Ga0075433_10809334
494 Ga0075433_10968971
495 Ga0075434_100013819
496 Ga0075434_100019747
497 Ga0075434_100027934
498 Ga0075434_100057678
499 Ga0075434_100390005
500 Ga0075434_100718282
501 Ga0075429_100003182
502 Ga0075429_100010899
503 Ga0075429_100045716
504 Ga0075429_100605840
505 Ga0075429_101019487
506 Ga0075429_101204844
507 Ga0068865_100630423
508 Ga0075436_100113707
509 Ga0097620_100223812
510 Ga0097620_102162089
511 Ga0075435_100002353
512 Ga0075435_100007018
513 Ga0075435_100084359
514 Ga0075435_100426126
515 Ga0075435_100543510
516 Ga0075435_100935417
517 Ga0099794_10022209
518 Ga0111539_10006976
519 Ga0111539_10118443
520 Ga0105245_10657596
521 Ga0105245_12229598
522 Ga0114129_10000149
523 Ga0114129_10003297
524 Ga0114129_10335865
525 Ga0114129_10365445
526 Ga0114129_10514036
527 Ga0114129_10836561
528 Ga0114129_11871138
529 Ga0114129_12496763
530 Ga0114129_12504072
531 Ga0105243_10032987
532 Ga0105243_10438413
533 Ga0105242_10525158
534 Ga0105248_10508222
535 Ga0105248_12071006
536 Ga0105237_11986465
537 Ga0105249_10066238
538 Ga0105249_10136541
539 Ga0105249_10651747
540 Ga0105249_10829611
541 Ga0105249_11446640
542 Ga0105249_13561424
543 Ga0105246_11435679
544 Ga0157378_10289375
545 Ga0163162_10495277
546 Ga0163162_10832691
547 Ga0163162_11269915
548 Ga0163163_10581205
549 Ga0157380_10254140
550 Ga0207653_10188897
551 Ga0207642_10870621
552 Ga0207684_10002344
553 Ga0207684_10003868
554 Ga0207684_10019957
555 Ga0207684_10158816
556 Ga0207684_10879525
557 Ga0207654_10399356
558 Ga0207693_10071208
559 Ga0207660_10028751
560 Ga0207660_10940282
561 Ga0207652_10909635
562 Ga0207646_10001218
563 Ga0207646_10025275
564 Ga0207646_10248343
565 Ga0207646_10402457
566 Ga0207646_10480248
567 Ga0207681_10151427
568 Ga0207681_11045468
569 Ga0207687_10419980
570 Ga0207706_10184216
571 Ga0207709_10080369
572 Ga0207670_10413184
573 Ga0207670_11819561
574 Ga0207665_10860424
575 Ga0207691_10008541
576 Ga0207691_10568038
577 Ga0207689_10005769
578 Ga0207712_10061384
579 Ga0207712_10090231
580 Ga0207712_10549063
581 Ga0207668_10490219
582 Ga0207640_11385423
583 Ga0207703_10894046
584 Ga0207708_10343621
585 Ga0207648_10265458
586 Ga0207648_10765838
587 Ga0207648_10895764
588 Ga0207648_11209957
589 Ga0209588_1004308
590 Ga0207428_10000029
591 Ga0207428_10000613
592 Ga0268265_10004536
593 Ga0268265_11559131
594 Ga0268264_10416113
595 Ga0268264_10769098
596 Ga0268264_10798157
597 Ga0307408_100475666
598 Ga0307406_10320936
599 Ga0307409_100285401
600 Ga0307409_100373445
601 Ga0307416_100841289
602 Ga0307411_10157470
603 Ga0307411_10750050
604 Ga0373948_0125614
605 Ga0373940_0005103
606 Ga0373949_0043941
607 Ga0373949_0271784
608 Ga0373932_0068842
609 Ga0373932_0180125
610 Ga0373960_0052457
611 Ga0373942_0321015
612 Ga0373962_0009527
613 Ga0373962_0088397
614 Ga0373931_0003204
615 Ga0373931_0037364
616 Ga0373931_0226450
617 Ga0439444_0032508
618 Ga0439460_0028086
619 Ga0451577_0005520
620 Ga0453684_0584043
621 Ga0451576_0005892
622 Ga0451576_0367396
623 Ga0451576_0416386
624 Ga0451576_1503705
625 Ga0495603_0204404
626 Ga0495580_0018281
627 Ga0495580_0030004
628 Ga0495580_0169254
629 Ga0495594_0347095
630 Ga0496107_0854091
631 Ga0501031_0563112
632 Ga0501033_0881208
633 Ga0501036_0015819
634 Ga0501036_0475366
635 Ga0501036_1256013
636 Ga0501038_0019949
637 Ga0501038_0916121
638 Ga0501039_0019175
639 Ga0501039_0082984
640 Ga0501039_0217601
641 Ga0501040_0047998
642 Ga0501040_0501729
643 Ga0501041_0097507
644 Ga0501042_0017669
645 Ga0501042_0077768
646 Ga0501043_0353508
647 Ga0501043_0439178
648 Ga0501046_0047656
649 Ga0501046_1008598
650 Ga0501048_1397348
651 Ga0501068_0138191
652 Ga0501068_0200464
653 Ga0501068_0350182
654 Ga0501069_0280006
655 Ga0501069_0494420
656 Ga0501070_0348241
657 Ga0501071_0153478
658 Ga0501071_0484461
659 Ga0501071_0634716
660 Ga0501071_1547439
661 Ga0501072_0015488
662 Ga0501072_0035669
663 Ga0501072_0137964
664 Ga0501072_0419854
665 Ga0501073_0435095
666 Ga0501073_1100620
667 Ga0501074_0067339
668 Ga0501074_0286433
669 Ga0501074_0380610
670 Ga0501074_0644827
671 Ga0501075_0007961
672 Ga0501075_0010855
673 Ga0501075_0133182
674 Ga0501075_0564442
675 Ga0501075_0728241
676 Ga0501076_0008818
677 Ga0501076_0069910
678 Ga0501076_0084459
679 Ga0501076_0876430
680 Ga0501077_0000795
681 Ga0501077_0098389
682 Ga0501077_0367074
683 Ga0501079_0005919
684 Ga0501079_0046181
685 Ga0501079_0071438
686 Ga0501079_0083817
687 Ga0501080_0408940
688 Ga0501080_0715712
689 Ga0501081_0006349
690 Ga0501081_0061053
691 Ga0501081_0159293
692 Ga0501081_0543855
693 Ga0501081_0629834
694 Ga0501081_0737917
695 Ga0501083_0993272
696 Ga0501045_0038161
697 Ga0501045_0093615
698 Ga0501045_0271580
699 nmdc:mga05p37_1308_c1
700 nmdc:mga05p37_1705994_c1
701 nmdc:mga05p37_68076_c1
702 nmdc:mga05p37_71108_c1
703 nmdc:mga05p37_737997_c1
704 nmdc:mga05p37_826253_c1
705 nmdc:mga09592_1275226_c1
706 nmdc:mga09592_27142_c1
707 nmdc:mga09592_3499_c1
708 nmdc:mga09592_467418_c1
709 nmdc:mga09592_60318_c1
710 nmdc:mga09592_667273_c1
711 nmdc:mga0qj67_206394_c1
712 nmdc:mga0qj67_232089_c1
713 nmdc:mga0qj67_57784_c1
714 nmdc:mga06r32_1135276_c1
715 nmdc:mga06r32_216787_c1
716 nmdc:mga06r32_406844_c1
717 nmdc:mga06r32_432836_c1
718 nmdc:mga08y16_1300_c1
719 nmdc:mga08y16_136952_c1
720 nmdc:mga0n895_166025_c1
721 nmdc:mga0n895_169853_c1
722 nmdc:mga0n895_181753_c1
723 nmdc:mga0n895_19021_c1
724 nmdc:mga0n895_237279_c1
725 nmdc:mga0n895_49098_c1
726 nmdc:mga0n895_62199_c1
727 nmdc:mga0rr50_223859_c1
728 nmdc:mga0rr50_262575_c1
729 nmdc:mga0rr50_695604_c1
730 nmdc:mga0rr50_7002_c1
731 nmdc:mga0rr50_908796_c1
732 nmdc:mga08x19_541436_c1
733 nmdc:mga0a205_1141607_c1
734 nmdc:mga0a205_202751_c1
735 nmdc:mga0a205_30369_c1
736 nmdc:mga0a205_853411_c1
737 nmdc:mga0a205_99500_c1
738 Ga0501084_0011887
739 Ga0501084_0321554
740 Ga0501084_0351741
741 Ga0501084_0798105
742 Ga0501084_0834983
743 Ga0501082_0002253
744 Ga0501082_0280901
745 Ga0501082_0425324
746 Ga0530510_0064207
747 Ga0530510_0303430
748 Ga0530510_1279327

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.7569 45 115
6xcv-assembly1.cif.gz_A crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7514 45 113
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.7508 45 113
6m9s-assembly2.cif.gz_C crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7506 45 113
6m9s-assembly2.cif.gz_D crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7505 45 113
ID Description Score Start End Superfamily
af_A0A0R0GUX4_36_216_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7594 46 112 2.60.120.10
af_Q852L2_251_463_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7337 46 113 2.60.120.10
af_P87113_7_211_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7324 46 114 1.10.10.1740
af_P38435_505_758_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7318 45 113 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7316 46 115 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V6WBF2-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.8115 1 115
AF-A0A2V6WBF2-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.7992 1 115
AF-A0A2W1ALS0-F1-model_v4 Cupin domain-containing protein 0.7967 3 115
AF-A0A1Y6CTC4-F1-model_v4 Anti-ECFsigma factor, ChrR 0.7953 46 112
AF-A0A2S6TT32-F1-model_v4 Anti-sigma-E factor ChrR 0.7932 46 112

Map