F426584

General Info

Members Datasets Scaffolds Average Seq Length
374 250 748 217

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1108635|Ga0006562J51391_11086351
Length 215
Sequence VQTATATPTVRKVTRPRADALRNRERIVTAAREMFVEFGADVPLDEIARRAGVGNATVYRNFPDRDALVREVVCSVLDRMVQAGQVALAESDAFGALERFVHASAEERLSALCPMISSTFDEHHPDLEAARERVERIIGEVMDRAKAAGQLRPDVGVGDVMIAVAQLSRPPAGTGCLNADRFVHRHLQVFLDGLRAPAPSVLPGSAVTLEDLRQA

Samples

Sample ID Description Type Environment
1 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
31 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
52 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
53 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
56 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
57 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
58 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
61 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
62 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
63 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
64 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
65 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
66 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
191 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
192 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
196 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
197 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
198 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
203 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
204 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
205 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
206 2643221647 Streptomyces sp. Root369 Isolate Unclassified
207 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
208 2643221714 Streptomyces sp. Root264 Isolate Unclassified
209 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
210 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
211 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
212 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
213 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
214 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
215 2808606448 Streptomyces sp. 193411 Isolate Unclassified
216 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
217 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
218 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
219 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
220 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
221 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
222 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
223 2867428634 Streptomyces sp. RP5T Isolate Unclassified
224 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
225 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
226 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
227 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
228 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
229 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
230 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
231 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
232 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
233 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
234 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
235 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
236 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
237 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
238 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
239 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
240 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
241 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
242 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
243 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
244 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
245 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
246 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
247 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
248 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
249 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
250 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.82
Metatranscriptomes 5.08
Isolates 13.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0.53
Rhizoplane 0.53
Rhizosphere 78.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1108635 3300003578 Bacteria 1829
2 Ga0006778J45830_1029169 3300003162 Bacteria 1130
3 Ga0006759J45824_1024791 3300003163 Bacteria 1107
4 Ga0006777J48905_1016782 3300003308 Bacteria 1162
5 Ga0006777J48905_1035632 3300003308 Bacteria 1773
6 rootH1_10001548 3300003316 Bacteria 4268
7 rootH1_10003215 3300003316 Bacteria 4528
8 rootH1_10018759 3300003316 Bacteria 1153
9 rootH2_10084002 3300003320 Bacteria 1482
10 rootL2_10010227 3300003322 Bacteria 2978
11 rootL2_10037608 3300003322 Bacteria 1914
12 rootH1_10001495 3300003323 Bacteria 2542
13 rootH1_10027833 3300003323 Bacteria 7473
14 rootH1_10029179 3300003323 Bacteria 2055
15 rootH1_10165255 3300003323 Bacteria 1517
16 Ga0007409J51694_1029352 3300003575 Bacteria 831
17 Ga0006562J51391_1065940 3300003578 Bacteria 6792
18 Ga0007429J51699_1011105 3300003579 Bacteria 1263
19 Ga0007429J51699_1019867 3300003579 Bacteria 1791
20 Ga0007429J51699_1095060 3300003579 Bacteria 1138
21 Ga0032354_1021201 3300003693 Bacteria 1238
22 Ga0006780_1019928 3300003735 Bacteria 1118
23 Ga0070698_100798351 3300005471 Bacteria 888
24 Ga0070665_100135165 3300005548 Bacteria 2468
25 Ga0070664_101077905 3300005564 Bacteria 756
26 Ga0081455_10043932 3300005937 Bacteria 3904
27 Ga0075363_100162348 3300006048 Bacteria 1266
28 Ga0075367_10021624 3300006178 Bacteria 3597
29 Ga0075367_10427601 3300006178 Bacteria 839
30 Ga0075370_10075305 3300006353 Bacteria 1935
31 Ga0105251_10004016 3300009011 Bacteria 10383
32 Ga0105244_10101850 3300009036 Bacteria 1404
33 Ga0105250_10037833 3300009092 Bacteria 1936
34 Ga0105245_10900370 3300009098 Bacteria 926
35 Ga0105247_10412607 3300009101 Bacteria 965
36 Ga0105248_10094884 3300009177 Bacteria 3359
37 Ga0105238_10300331 3300009551 Bacteria 1589
38 Ga0105239_10395474 3300010375 Bacteria 1564
39 Ga0105246_10004492 3300011119 Bacteria 8484
40 Ga0105246_10194667 3300011119 Bacteria 1572
41 Ga0182007_10003402 3300015262 Bacteria 7498
42 Ga0183367_1005 3300015688 Bacteria 652063
43 Ga0206350_11057734 3300020080 Bacteria 857
44 Ga0206350_11118037 3300020080 Bacteria 1873
45 Ga0206354_10901152 3300020081 Bacteria 1118
46 Ga0206353_10152874 3300020082 Bacteria 1000
47 Ga0207426_1013089 3300025302 Bacteria 3088
48 Ga0207713_1040440 3300025735 Bacteria 1957
49 Ga0207647_10003562 3300025904 Bacteria 11685
50 Ga0207646_10599435 3300025922 Bacteria 989
51 Ga0207687_10492950 3300025927 Bacteria 1022
52 Ga0268266_10874388 3300028379 Bacteria 869
53 Ga0307515_10001178 3300028794 Bacteria 59820
54 Ga0307515_10343464 3300028794 Bacteria 1143
55 Ga0268256_1009398 3300030500 Bacteria 3252
56 Ga0307511_10045235 3300030521 Bacteria 3641
57 Ga0307512_10056836 3300030522 Bacteria 3067
58 Ga0307512_10095187 3300030522 Bacteria 2050
59 Ga0307512_10121196 3300030522 Bacteria 1680
60 Ga0307513_10042732 3300031456 Bacteria 4987
61 Ga0307513_10166346 3300031456 Bacteria 2089
62 Ga0307508_10000988 3300031616 Bacteria 33039
63 Ga0307508_10045811 3300031616 Bacteria 3906
64 Ga0307508_10188089 3300031616 Bacteria 1666
65 Ga0307514_10002256 3300031649 Bacteria 20496
66 Ga0307516_10001402 3300031730 Bacteria 33337
67 Ga0307516_10019976 3300031730 Bacteria 6925
68 Ga0307516_10249983 3300031730 Bacteria 1468
69 Ga0307518_10070134 3300031838 Bacteria 2539
70 Ga0307518_10208705 3300031838 Bacteria 1288
71 Ga0307507_10036338 3300033179 Bacteria 5038
72 Ga0307507_10055407 3300033179 Bacteria 3758
73 Ga0307507_10401893 3300033179 Bacteria 778
74 Ga0307510_10000827 3300033180 Bacteria 32302
75 Ga0307510_10103768 3300033180 Bacteria 2619
76 Ga0307510_10226792 3300033180 Bacteria 1374
77 Ga0439436_0006026 3300041404 Bacteria 3714
78 Ga0439439_0077680 3300041406 Bacteria 894
79 Ga0451843_1457304 3300041509 Bacteria 1006
80 Ga0451853_0721026 3300041512 Bacteria 6288
81 Ga0451853_1325752 3300041512 Bacteria 1968
82 Ga0451853_2327277 3300041512 Bacteria 908
83 Ga0451853_2590810 3300041512 Bacteria 1227
84 Ga0439433_0003416 3300041999 Bacteria 3408
85 Ga0439442_029949 3300042002 Bacteria 1136
86 Ga0439442_046203 3300042002 Bacteria 917
87 Ga0439449_0017469 3300042007 Bacteria 2694
88 Ga0439449_0087580 3300042007 Bacteria 1149
89 Ga0439449_0105721 3300042007 Bacteria 1041
90 Ga0439454_029938 3300042011 Bacteria 848
91 Ga0439457_000284 3300042014 Bacteria 14024
92 Ga0439457_004995 3300042014 Bacteria 3394
93 Ga0450894_000275 3300042131 Bacteria 9228
94 Ga0450895_005728 3300042132 Bacteria 1006
95 Ga0450896_032541 3300042133 Bacteria 793
96 Ga0450898_001966 3300042134 Bacteria 2807
97 Ga0450902_009671 3300042137 Bacteria 1521
98 Ga0450903_000175 3300042138 Bacteria 14130
99 Ga0450903_006313 3300042138 Bacteria 1973
100 Ga0450906_006649 3300042145 Bacteria 2318
101 Ga0439458_0002198 3300042157 Bacteria 4823
102 Ga0439458_0012354 3300042157 Bacteria 1916
103 Ga0439458_0070343 3300042157 Bacteria 883
104 Ga0466972_0011349 3300044658 Bacteria 4470
105 Ga0466972_0017781 3300044658 Bacteria 3558
106 Ga0466972_0030393 3300044658 Bacteria 2659
107 Ga0466965_0000433 3300044683 Bacteria 14524
108 Ga0466966_0000541 3300044684 Bacteria 24070
109 Ga0466966_0325396 3300044684 Bacteria 924
110 Ga0466961_0006317 3300044693 Bacteria 7523
111 Ga0466961_0088750 3300044693 Bacteria 1953
112 Ga0466963_0000453 3300044694 Bacteria 19007
113 Ga0466964_0008217 3300044706 Bacteria 3915
114 Ga0466971_0001302 3300044719 Bacteria 10423
115 Ga0466970_0002584 3300044765 Bacteria 8724
116 Ga0466970_0002585 3300044765 Bacteria 8721
117 Ga0466957_0007477 3300044842 Bacteria 6171
118 Ga0466960_0005146 3300044901 Bacteria 5170
119 Ga0466959_0001339 3300045049 Bacteria 15000
120 Ga0466958_0004428 3300045836 Bacteria 7417
121 Ga0466967_0132437 3300045976 Bacteria 2316
122 Ga0466967_0552356 3300045976 Bacteria 1133
123 Ga0466967_0918218 3300045976 Bacteria 871
124 Ga0495617_026192 3300046452 Bacteria 1963
125 Ga0495627_066349 3300046453 Bacteria 1059
126 Ga0495592_0004949 3300046454 Bacteria 9803
127 Ga0495592_0079448 3300046454 Bacteria 2374
128 Ga0495603_0028089 3300046455 Bacteria 3393
129 Ga0495603_0099776 3300046455 Bacteria 1695
130 Ga0495590_0118442 3300046457 Bacteria 948
131 Ga0495629_0019038 3300046459 Bacteria 4909
132 Ga0495629_0381153 3300046459 Bacteria 959
133 Ga0495638_0028709 3300046460 Bacteria 3590
134 Ga0495651_0005458 3300046462 Bacteria 9700
135 Ga0495651_0026186 3300046462 Bacteria 4542
136 Ga0495653_0369198 3300046463 Bacteria 919
137 Ga0495580_0255652 3300046472 Bacteria 1198
138 Ga0495582_0012728 3300046473 Bacteria 4637
139 Ga0495582_0137541 3300046473 Bacteria 1383
140 Ga0495605_0153893 3300046474 Bacteria 1024
141 Ga0495605_0174049 3300046474 Bacteria 949
142 Ga0495662_0000147 3300046476 Bacteria 27603
143 Ga0495662_0159121 3300046476 Bacteria 1112
144 Ga0495664_0001287 3300046477 Bacteria 13152
145 Ga0495664_0036650 3300046477 Bacteria 2891
146 Ga0495594_0005713 3300046499 Bacteria 6393
147 Ga0495594_0044513 3300046499 Bacteria 2435
148 Ga0495594_0223959 3300046499 Bacteria 1072
149 Ga0495596_0066591 3300046500 Bacteria 1400
150 Ga0495607_0009181 3300046501 Bacteria 6720
151 Ga0495583_0036890 3300046506 Bacteria 2321
152 Ga0495606_0019512 3300046507 Bacteria 5040
153 Ga0495608_0128475 3300046511 Bacteria 1623
154 Ga0495610_0024412 3300046512 Bacteria 3263
155 Ga0495616_0047190 3300046513 Bacteria 2170
156 Ga0495618_0007487 3300046514 Bacteria 6606
157 Ga0495620_0042508 3300046515 Bacteria 1984
158 Ga0495620_0077644 3300046515 Bacteria 1347
159 Ga0495628_0045801 3300046516 Bacteria 3476
160 Ga0495628_0154801 3300046516 Bacteria 1744
161 Ga0495630_0042593 3300046517 Bacteria 3391
162 Ga0495630_0335661 3300046517 Bacteria 1156
163 Ga0495631_0046068 3300046518 Bacteria 1918
164 Ga0495631_0067853 3300046518 Bacteria 1543
165 Ga0495632_0104159 3300046519 Bacteria 1336
166 Ga0495632_0202429 3300046519 Bacteria 903
167 Ga0495637_0160479 3300046520 Bacteria 843
168 Ga0495643_0003031 3300046522 Bacteria 12631
169 Ga0495644_0073169 3300046523 Bacteria 1289
170 Ga0495648_0016567 3300046524 Bacteria 5308
171 Ga0495648_0174510 3300046524 Bacteria 1098
172 Ga0495666_0015284 3300046526 Bacteria 3823
173 Ga0495642_0040578 3300046528 Bacteria 1891
174 Ga0495652_0102001 3300046529 Bacteria 2325
175 Ga0495652_0178802 3300046529 Bacteria 1630
176 Ga0495654_0016810 3300046530 Bacteria 3855
177 Ga0495640_0013664 3300046533 Bacteria 6170
178 Ga0495640_0016997 3300046533 Bacteria 5430
179 Ga0495586_0010117 3300046535 Bacteria 5020
180 Ga0495587_0001305 3300046536 Bacteria 16567
181 Ga0495609_0005351 3300046538 Bacteria 6776
182 Ga0495597_0049330 3300046542 Bacteria 1860
183 Ga0495597_0069070 3300046542 Bacteria 1525
184 Ga0495645_0011680 3300046543 Bacteria 6182
185 Ga0495622_0022934 3300046557 Bacteria 2909
186 Ga0495622_0049087 3300046557 Bacteria 1959
187 Ga0495633_0153922 3300046558 Bacteria 1061
188 Ga0495656_0217952 3300046615 Bacteria 953
189 Ga0495668_0108443 3300046616 Bacteria 1518
190 Ga0495634_0000435 3300046642 Bacteria 41620
191 Ga0495634_0130239 3300046642 Bacteria 1604
192 Ga0495625_0149050 3300046660 Bacteria 1573
193 Ga0495625_0299033 3300046660 Bacteria 1030
194 Ga0495635_0008792 3300046663 Bacteria 7051
195 Ga0495635_0077399 3300046663 Bacteria 2278
196 Ga0495661_0132621 3300046665 Bacteria 1363
197 Ga0495588_0001468 3300046674 Bacteria 10118
198 Ga0495588_0017247 3300046674 Bacteria 3501
199 Ga0495588_0187820 3300046674 Bacteria 1091
200 Ga0495657_0005025 3300046675 Bacteria 10509
201 Ga0495623_0086254 3300046679 Bacteria 1935
202 Ga0495646_0000981 3300046680 Bacteria 16376
203 Ga0495646_0050773 3300046680 Bacteria 2512
204 Ga0495613_0005104 3300046689 Bacteria 9843
205 Ga0495624_0042806 3300046690 Bacteria 2893
206 Ga0495624_0088193 3300046690 Bacteria 1915
207 Ga0495671_0001872 3300046692 Bacteria 13525
208 Ga0495671_0135356 3300046692 Bacteria 1201
209 Ga0495649_0085423 3300046694 Bacteria 1684
210 Ga0495649_0123162 3300046694 Bacteria 1370
211 Ga0495649_0180737 3300046694 Bacteria 1100
212 Ga0495589_0028371 3300046794 Bacteria 2825
213 Ga0495589_0039450 3300046794 Bacteria 2359
214 Ga0495600_0006794 3300046809 Bacteria 6975
215 Ga0495660_0165178 3300046810 Bacteria 1082
216 Ga0495581_0005142 3300047315 Bacteria 7570
217 Ga0495581_0028895 3300047315 Bacteria 3215
218 Ga0495581_0290073 3300047315 Bacteria 956
219 Ga0495604_0003588 3300047317 Bacteria 12368
220 Ga0495604_0028521 3300047317 Bacteria 4441
221 Ga0495636_0002162 3300047318 Bacteria 7539
222 Ga0495636_0007059 3300047318 Bacteria 4418
223 Ga0495636_0058483 3300047318 Bacteria 1625
224 Ga0495636_0320596 3300047318 Bacteria 727
225 Ga0495676_0011743 3300047321 Bacteria 7900
226 Ga0495676_0027118 3300047321 Bacteria 4917
227 Ga0495676_0314472 3300047321 Bacteria 1053
228 Ga0495680_0462540 3300047322 Bacteria 866
229 Ga0495683_0060035 3300047323 Bacteria 1885
230 Ga0495687_006754 3300047443 Bacteria 6939
231 Ga0495687_115061 3300047443 Bacteria 981
232 Ga0495675_0104634 3300047444 Bacteria 1769
233 Ga0495675_0195987 3300047444 Bacteria 1231
234 Ga0495677_0029449 3300047445 Bacteria 1996
235 Ga0495685_001394 3300047447 Bacteria 7402
236 Ga0495685_012026 3300047447 Bacteria 2927
237 Ga0495685_021701 3300047447 Bacteria 2210
238 Ga0495685_091423 3300047447 Bacteria 1008
239 Ga0495685_102479 3300047447 Bacteria 944
240 Ga0495681_0001221 3300047470 Bacteria 19566
241 Ga0495681_0097784 3300047470 Bacteria 1287
242 Ga0495681_0188019 3300047470 Bacteria 844
243 Ga0495684_0075207 3300047471 Bacteria 2566
244 Ga0495686_0015871 3300047472 Bacteria 5123
245 Ga0495686_0029291 3300047472 Bacteria 3582
246 Ga0495686_0067906 3300047472 Bacteria 2200
247 Ga0495593_0002876 3300047673 Bacteria 10381
248 Ga0495602_0028832 3300048088 Bacteria 5304
249 Ga0495614_0001819 3300048089 Bacteria 9340
250 Ga0495614_0055161 3300048089 Bacteria 1704
251 Ga0495626_0093279 3300048091 Bacteria 1321
252 Ga0496108_0245026 3300048911 Bacteria 1559
253 Ga0496109_0010363 3300048912 Bacteria 7962
254 Ga0501309_012891 3300049129 Bacteria 1107
255 Ga0501307_006879 3300049162 Bacteria 1241
256 Ga0495678_013508 3300049459 Bacteria 3832
257 Ga0501316_005492 3300049532 Bacteria 1316
258 Ga0501031_0230915 3300049568 Bacteria 1204
259 Ga0501032_0093646 3300049569 Bacteria 1992
260 Ga0501033_0006034 3300049570 Bacteria 9500
261 Ga0501033_0059532 3300049570 Bacteria 2820
262 Ga0501033_0078566 3300049570 Bacteria 2421
263 Ga0501034_0013587 3300049571 Bacteria 8379
264 Ga0501034_0031020 3300049571 Bacteria 5432
265 Ga0501034_0047519 3300049571 Bacteria 4333
266 Ga0501034_0182023 3300049571 Bacteria 2066
267 Ga0501036_0000345 3300049572 Bacteria 32636
268 Ga0501036_0018259 3300049572 Bacteria 5874
269 Ga0501036_0044334 3300049572 Bacteria 3767
270 Ga0501037_0019858 3300049573 Bacteria 4958
271 Ga0501037_0124634 3300049573 Bacteria 1850
272 Ga0501038_0000447 3300049574 Bacteria 35997
273 Ga0501038_0103303 3300049574 Bacteria 2370
274 Ga0501038_0131219 3300049574 Bacteria 2057
275 Ga0501039_0172358 3300049575 Bacteria 1701
276 Ga0501039_0344238 3300049575 Bacteria 1171
277 Ga0501042_0017650 3300049578 Bacteria 4926
278 Ga0501043_0004892 3300049579 Bacteria 10822
279 Ga0501043_0021635 3300049579 Bacteria 5042
280 Ga0501043_0098167 3300049579 Bacteria 2302
281 Ga0501046_0007107 3300049580 Bacteria 9849
282 Ga0501046_0393009 3300049580 Bacteria 1002
283 Ga0501047_0058266 3300049581 Bacteria 3731
284 Ga0501047_0150952 3300049581 Bacteria 2199
285 Ga0501047_0242508 3300049581 Bacteria 1652
286 Ga0501047_0689277 3300049581 Bacteria 839
287 Ga0501048_0033235 3300049582 Bacteria 3727
288 Ga0501048_0192723 3300049582 Bacteria 1444
289 Ga0501068_0094755 3300049584 Bacteria 1845
290 Ga0501069_0242530 3300049585 Bacteria 1050
291 Ga0501070_0000263 3300049586 Bacteria 49655
292 Ga0501070_0153729 3300049586 Bacteria 1898
293 Ga0501070_0170525 3300049586 Bacteria 1792
294 Ga0501070_0229495 3300049586 Bacteria 1521
295 Ga0501074_0010341 3300049590 Bacteria 6770
296 Ga0501224_024289 3300049664 Bacteria 906
297 Ga0501080_0065354 3300049742 Bacteria 3384
298 Ga0501035_0003454 3300049822 Bacteria 15119
299 Ga0501035_0016638 3300049822 Bacteria 6782
300 Ga0501035_0049426 3300049822 Bacteria 3768
301 Ga0501035_0083357 3300049822 Bacteria 2821
302 Ga0501035_0683162 3300049822 Bacteria 829
303 Ga0501044_0036572 3300049823 Bacteria 5137
304 Ga0501044_0047454 3300049823 Bacteria 4441
305 Ga0501044_0059767 3300049823 Bacteria 3904
306 Ga0501044_0098147 3300049823 Bacteria 2949
307 Ga0501044_0209810 3300049823 Bacteria 1902
308 Ga0501044_0243324 3300049823 Bacteria 1742
309 Ga0501045_0035263 3300049824 Bacteria 3632
310 nmdc:mga03n38_163005_c1 3300050490 Bacteria 1130
311 nmdc:mga06z11_2058_c1 3300050494 Bacteria 7634
312 nmdc:mga07m45_150032_c1 3300050496 Bacteria 1352
313 Ga0500610_0056627 3300053079 Bacteria 2046
314 Ga0495655_0016292 3300053083 Bacteria 1598
315 Ga0495655_0016548 3300053083 Bacteria 1590
316 Ga0500640_001587 3300053095 Bacteria 7000
317 Ga0500641_0030934 3300053096 Bacteria 2108
318 Ga0500650_0187350 3300053098 Bacteria 946
319 Ga0500553_029226 3300053101 Bacteria 2762
320 Ga0500560_005824 3300053107 Bacteria 2762
321 Ga0500572_004351 3300053111 Bacteria 3217
322 Ga0500608_219161 3300053122 Bacteria 770
323 Ga0500652_204587 3300053131 Bacteria 800
324 Ga0500573_0044589 3300053140 Bacteria 2558
325 Ga0466962_0000491 3300061719 Bacteria 17164
326 2547408043 2547132111 Bacteria 8013147
327 2585308601 2582581313 Bacteria 10042643
328 2585318706 2582581314 Bacteria 11452267
329 2616695250 2616644814 Bacteria 11555299
330 2644264146 2643221647 Bacteria 10741251
331 2644437035 2643221678 Bacteria 9540101
332 2644628781 2643221714 Bacteria 9015452
333 2784588496 2784132148 Bacteria 8627943
334 2785343466 2784746763 Bacteria 9783172
335 2785369334 2784746768 Bacteria 10036182
336 2786670467 2786546132 Bacteria 10419719
337 2808841934 2808606359 Bacteria 9866990
338 2808920477 2808606375 Bacteria 9466072
339 2809232092 2808606448 Bacteria 8656184
340 2812358323 2811994879 Bacteria 9313447
341 2812480679 2811994917 Bacteria 7761064
342 2852636818 2852635781 Bacteria 8251373
343 2862285536 2862281513 Bacteria 9621493
344 2862386114 2862382967 Bacteria 10317375
345 2862515271 2862507626 Bacteria 9425308
346 2863404819 2863404153 Bacteria 9672205
347 2867434224 2867428634 Bacteria 9590268
348 2877681217 2877676314 Bacteria 9512378
349 2912720165 2912715099 Bacteria 9460473
350 2912724442 2912723979 Bacteria 8557534
351 2919469623 2919468124 Bacteria 9133025
352 2946067554 2946064051 Bacteria 8957905
353 2946075804 2946072368 Bacteria 8999607
354 2947229448 2947224130 Bacteria 9938529
355 2954007610 2954002825 Bacteria 9173742
356 2954386366 2954380949 Bacteria 10050426
357 2954676813 2954673503 Bacteria 9685905
358 2954687353 2954682443 Bacteria 9862841
359 2954697037 2954691527 Bacteria 10720516
360 2954705096 2954701450 Bacteria 10834262
361 2954716350 2954711539 Bacteria 10867210
362 2954726294 2954721474 Bacteria 10456478
363 2954735517 2954731030 Bacteria 10243860
364 2954745218 2954740390 Bacteria 10229294
365 2954754372 2954749733 Bacteria 10366972
366 2954764193 2954759201 Bacteria 9358192
367 2990062099 2990059506 Bacteria 9321252
368 3006398500 3006393351 Bacteria 6615579
369 3006496177 3006493962 Bacteria 8825450
370 8008567452 8008558824 Bacteria 10610750
371 8008578952 8008574985 Bacteria 7815457
372 8023631266 8023623736 Bacteria 8593882
373 8048410171 8048406513 Bacteria 8936924
374 8056831847 8056829672 Bacteria 9045328
375 Ga0006562J51391_1108635
376 Ga0006778J45830_1029169
377 Ga0006759J45824_1024791
378 Ga0006777J48905_1016782
379 Ga0006777J48905_1035632
380 rootH1_10001548
381 rootH1_10003215
382 rootH1_10018759
383 rootH2_10084002
384 rootL2_10010227
385 rootL2_10037608
386 rootH1_10001495
387 rootH1_10027833
388 rootH1_10029179
389 rootH1_10165255
390 Ga0007409J51694_1029352
391 Ga0006562J51391_1065940
392 Ga0007429J51699_1011105
393 Ga0007429J51699_1019867
394 Ga0007429J51699_1095060
395 Ga0032354_1021201
396 Ga0006780_1019928
397 Ga0070698_100798351
398 Ga0070665_100135165
399 Ga0070664_101077905
400 Ga0081455_10043932
401 Ga0075363_100162348
402 Ga0075367_10021624
403 Ga0075367_10427601
404 Ga0075370_10075305
405 Ga0105251_10004016
406 Ga0105244_10101850
407 Ga0105250_10037833
408 Ga0105245_10900370
409 Ga0105247_10412607
410 Ga0105248_10094884
411 Ga0105238_10300331
412 Ga0105239_10395474
413 Ga0105246_10004492
414 Ga0105246_10194667
415 Ga0182007_10003402
416 Ga0183367_1005
417 Ga0206350_11057734
418 Ga0206350_11118037
419 Ga0206354_10901152
420 Ga0206353_10152874
421 Ga0207426_1013089
422 Ga0207713_1040440
423 Ga0207647_10003562
424 Ga0207646_10599435
425 Ga0207687_10492950
426 Ga0268266_10874388
427 Ga0307515_10001178
428 Ga0307515_10343464
429 Ga0268256_1009398
430 Ga0307511_10045235
431 Ga0307512_10056836
432 Ga0307512_10095187
433 Ga0307512_10121196
434 Ga0307513_10042732
435 Ga0307513_10166346
436 Ga0307508_10000988
437 Ga0307508_10045811
438 Ga0307508_10188089
439 Ga0307514_10002256
440 Ga0307516_10001402
441 Ga0307516_10019976
442 Ga0307516_10249983
443 Ga0307518_10070134
444 Ga0307518_10208705
445 Ga0307507_10036338
446 Ga0307507_10055407
447 Ga0307507_10401893
448 Ga0307510_10000827
449 Ga0307510_10103768
450 Ga0307510_10226792
451 Ga0439436_0006026
452 Ga0439439_0077680
453 Ga0451843_1457304
454 Ga0451853_0721026
455 Ga0451853_1325752
456 Ga0451853_2327277
457 Ga0451853_2590810
458 Ga0439433_0003416
459 Ga0439442_029949
460 Ga0439442_046203
461 Ga0439449_0017469
462 Ga0439449_0087580
463 Ga0439449_0105721
464 Ga0439454_029938
465 Ga0439457_000284
466 Ga0439457_004995
467 Ga0450894_000275
468 Ga0450895_005728
469 Ga0450896_032541
470 Ga0450898_001966
471 Ga0450902_009671
472 Ga0450903_000175
473 Ga0450903_006313
474 Ga0450906_006649
475 Ga0439458_0002198
476 Ga0439458_0012354
477 Ga0439458_0070343
478 Ga0466972_0011349
479 Ga0466972_0017781
480 Ga0466972_0030393
481 Ga0466965_0000433
482 Ga0466966_0000541
483 Ga0466966_0325396
484 Ga0466961_0006317
485 Ga0466961_0088750
486 Ga0466963_0000453
487 Ga0466964_0008217
488 Ga0466971_0001302
489 Ga0466970_0002584
490 Ga0466970_0002585
491 Ga0466957_0007477
492 Ga0466960_0005146
493 Ga0466959_0001339
494 Ga0466958_0004428
495 Ga0466967_0132437
496 Ga0466967_0552356
497 Ga0466967_0918218
498 Ga0495617_026192
499 Ga0495627_066349
500 Ga0495592_0004949
501 Ga0495592_0079448
502 Ga0495603_0028089
503 Ga0495603_0099776
504 Ga0495590_0118442
505 Ga0495629_0019038
506 Ga0495629_0381153
507 Ga0495638_0028709
508 Ga0495651_0005458
509 Ga0495651_0026186
510 Ga0495653_0369198
511 Ga0495580_0255652
512 Ga0495582_0012728
513 Ga0495582_0137541
514 Ga0495605_0153893
515 Ga0495605_0174049
516 Ga0495662_0000147
517 Ga0495662_0159121
518 Ga0495664_0001287
519 Ga0495664_0036650
520 Ga0495594_0005713
521 Ga0495594_0044513
522 Ga0495594_0223959
523 Ga0495596_0066591
524 Ga0495607_0009181
525 Ga0495583_0036890
526 Ga0495606_0019512
527 Ga0495608_0128475
528 Ga0495610_0024412
529 Ga0495616_0047190
530 Ga0495618_0007487
531 Ga0495620_0042508
532 Ga0495620_0077644
533 Ga0495628_0045801
534 Ga0495628_0154801
535 Ga0495630_0042593
536 Ga0495630_0335661
537 Ga0495631_0046068
538 Ga0495631_0067853
539 Ga0495632_0104159
540 Ga0495632_0202429
541 Ga0495637_0160479
542 Ga0495643_0003031
543 Ga0495644_0073169
544 Ga0495648_0016567
545 Ga0495648_0174510
546 Ga0495666_0015284
547 Ga0495642_0040578
548 Ga0495652_0102001
549 Ga0495652_0178802
550 Ga0495654_0016810
551 Ga0495640_0013664
552 Ga0495640_0016997
553 Ga0495586_0010117
554 Ga0495587_0001305
555 Ga0495609_0005351
556 Ga0495597_0049330
557 Ga0495597_0069070
558 Ga0495645_0011680
559 Ga0495622_0022934
560 Ga0495622_0049087
561 Ga0495633_0153922
562 Ga0495656_0217952
563 Ga0495668_0108443
564 Ga0495634_0000435
565 Ga0495634_0130239
566 Ga0495625_0149050
567 Ga0495625_0299033
568 Ga0495635_0008792
569 Ga0495635_0077399
570 Ga0495661_0132621
571 Ga0495588_0001468
572 Ga0495588_0017247
573 Ga0495588_0187820
574 Ga0495657_0005025
575 Ga0495623_0086254
576 Ga0495646_0000981
577 Ga0495646_0050773
578 Ga0495613_0005104
579 Ga0495624_0042806
580 Ga0495624_0088193
581 Ga0495671_0001872
582 Ga0495671_0135356
583 Ga0495649_0085423
584 Ga0495649_0123162
585 Ga0495649_0180737
586 Ga0495589_0028371
587 Ga0495589_0039450
588 Ga0495600_0006794
589 Ga0495660_0165178
590 Ga0495581_0005142
591 Ga0495581_0028895
592 Ga0495581_0290073
593 Ga0495604_0003588
594 Ga0495604_0028521
595 Ga0495636_0002162
596 Ga0495636_0007059
597 Ga0495636_0058483
598 Ga0495636_0320596
599 Ga0495676_0011743
600 Ga0495676_0027118
601 Ga0495676_0314472
602 Ga0495680_0462540
603 Ga0495683_0060035
604 Ga0495687_006754
605 Ga0495687_115061
606 Ga0495675_0104634
607 Ga0495675_0195987
608 Ga0495677_0029449
609 Ga0495685_001394
610 Ga0495685_012026
611 Ga0495685_021701
612 Ga0495685_091423
613 Ga0495685_102479
614 Ga0495681_0001221
615 Ga0495681_0097784
616 Ga0495681_0188019
617 Ga0495684_0075207
618 Ga0495686_0015871
619 Ga0495686_0029291
620 Ga0495686_0067906
621 Ga0495593_0002876
622 Ga0495602_0028832
623 Ga0495614_0001819
624 Ga0495614_0055161
625 Ga0495626_0093279
626 Ga0496108_0245026
627 Ga0496109_0010363
628 Ga0501309_012891
629 Ga0501307_006879
630 Ga0495678_013508
631 Ga0501316_005492
632 Ga0501031_0230915
633 Ga0501032_0093646
634 Ga0501033_0006034
635 Ga0501033_0059532
636 Ga0501033_0078566
637 Ga0501034_0013587
638 Ga0501034_0031020
639 Ga0501034_0047519
640 Ga0501034_0182023
641 Ga0501036_0000345
642 Ga0501036_0018259
643 Ga0501036_0044334
644 Ga0501037_0019858
645 Ga0501037_0124634
646 Ga0501038_0000447
647 Ga0501038_0103303
648 Ga0501038_0131219
649 Ga0501039_0172358
650 Ga0501039_0344238
651 Ga0501042_0017650
652 Ga0501043_0004892
653 Ga0501043_0021635
654 Ga0501043_0098167
655 Ga0501046_0007107
656 Ga0501046_0393009
657 Ga0501047_0058266
658 Ga0501047_0150952
659 Ga0501047_0242508
660 Ga0501047_0689277
661 Ga0501048_0033235
662 Ga0501048_0192723
663 Ga0501068_0094755
664 Ga0501069_0242530
665 Ga0501070_0000263
666 Ga0501070_0153729
667 Ga0501070_0170525
668 Ga0501070_0229495
669 Ga0501074_0010341
670 Ga0501224_024289
671 Ga0501080_0065354
672 Ga0501035_0003454
673 Ga0501035_0016638
674 Ga0501035_0049426
675 Ga0501035_0083357
676 Ga0501035_0683162
677 Ga0501044_0036572
678 Ga0501044_0047454
679 Ga0501044_0059767
680 Ga0501044_0098147
681 Ga0501044_0209810
682 Ga0501044_0243324
683 Ga0501045_0035263
684 nmdc:mga03n38_163005_c1
685 nmdc:mga06z11_2058_c1
686 nmdc:mga07m45_150032_c1
687 Ga0500610_0056627
688 Ga0495655_0016292
689 Ga0495655_0016548
690 Ga0500640_001587
691 Ga0500641_0030934
692 Ga0500650_0187350
693 Ga0500553_029226
694 Ga0500560_005824
695 Ga0500572_004351
696 Ga0500608_219161
697 Ga0500652_204587
698 Ga0500573_0044589
699 Ga0466962_0000491
700 2547408043
701 2585308601
702 2585318706
703 2616695250
704 2644264146
705 2644437035
706 2644628781
707 2784588496
708 2785343466
709 2785369334
710 2786670467
711 2808841934
712 2808920477
713 2809232092
714 2812358323
715 2812480679
716 2852636818
717 2862285536
718 2862386114
719 2862515271
720 2863404819
721 2867434224
722 2877681217
723 2912720165
724 2912724442
725 2919469623
726 2946067554
727 2946075804
728 2947229448
729 2954007610
730 2954386366
731 2954676813
732 2954687353
733 2954697037
734 2954705096
735 2954716350
736 2954726294
737 2954735517
738 2954745218
739 2954754372
740 2954764193
741 2990062099
742 3006398500
743 3006496177
744 8008567452
745 8008578952
746 8023631266
747 8048410171
748 8056831847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

27

72

0.97

PF21597

TetR_C_43

Transcriptional regulator SbtR-like, C-terminal domain

92

196

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o7t-assembly1.cif.gz_A-2 crystal structure of a tetr family transcriptional regulator (ncgl1578, cgl1640) from corynebacterium glutamicum at 2.10 a resolution 0.864 16 194
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8573 21 97
2o7t-assembly1.cif.gz_A-2 crystal structure of a tetr family transcriptional regulator (ncgl1578, cgl1640) from corynebacterium glutamicum at 2.10 a resolution 0.8221 16 194
2v57-assembly2.cif.gz_D crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis in complex with proflavine 0.8001 17 192
2v57-assembly2.cif.gz_D crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis in complex with proflavine 0.7593 17 192
ID Description Score Start End Superfamily
3cdlA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9476 22 66 1.10.10.60
3locA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9472 17 66 1.10.10.60
3cdlB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.929 21 66 1.10.10.60
1t33B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9286 16 66 1.10.10.60
6g87C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9261 22 69 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2P8Q0Z2-F1-model_v4 TetR family transcriptional regulator 0.9195 15 195 GO:0000976
GO:0003700
AF-A0A562PBQ0-F1-model_v4 TetR family transcriptional regulator 0.9 15 195 GO:0000976
GO:0003700
AF-A0A229SYL1-F1-model_v4 HTH tetR-type domain-containing protein 0.8934 15 195 GO:0000976
GO:0003700
AF-A0A6L3W5A1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8883 11 199 GO:0000976
GO:0003700
AF-A0A5B0B0X1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8875 15 203 GO:0000976
GO:0003700

Map