F426522

General Info

Members Datasets Scaffolds Average Seq Length
373 219 746 302

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_209464_c1|nmdc:mga0rr50_209464_c1_451_1503
Length 350
Sequence MSPTLASPSSPGTANQAFRFIDPSVLARIGNLELVARTVVEGFINGLHRAPHLGASMDFAEHRAYMPGDDIRRIDWKLFARSDRFYVKEFEADTNANFVVLLDVSKSMRYGGPGATGAAVSKLEYASYLTASLAYFSGLQRDRVGLITFDTEIRGFIPPSAKRLQEILHNLDRLSHEKGGDESFFERNGKRETGNPSTNGASHAATSAPAGERVPLREITRRLVESFRRRSIVALVSDLYEEPEEIVDALAYLRGKGNDMIVFHILDKSELDFPFTEAASFMDIETGARMPLVPDYLRKQYKELITAHTRALGQKLGEGRTDYAMFDTSKPLDHALFSYLSLRERLSRVR

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
163 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
204 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 0.27
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 9.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_209464_c1 3300050513 Bacteria 1605
2 SwRhRL2b_contig_778298 2162886007 Bacteria 4326
3 rootH2_10013381 3300003320 Bacteria 15800
4 rootH2_10152411 3300003320 Bacteria 2868
5 Ga0065704_10076030 3300005289 Bacteria 5300
6 Ga0065715_10248906 3300005293 Bacteria 1174
7 Ga0065707_10006464 3300005295 Bacteria 3284
8 Ga0070658_10367949 3300005327 Bacteria 1232
9 Ga0070683_100121414 3300005329 Unclassified 2468
10 Ga0070690_100245535 3300005330 Bacteria 1264
11 Ga0070670_100007515 3300005331 Bacteria 9251
12 Ga0070670_100062136 3300005331 Bacteria 3206
13 Ga0070677_10104654 3300005333 Unclassified 1254
14 Ga0068869_100016580 3300005334 Bacteria 4968
15 Ga0070680_100077346 3300005336 Bacteria 2741
16 Ga0070680_100175315 3300005336 Unclassified 1805
17 Ga0068868_100257525 3300005338 Bacteria 1470
18 Ga0070687_100004004 3300005343 Bacteria 5812
19 Ga0070661_100005605 3300005344 Bacteria 8649
20 Ga0070661_100072231 3300005344 Bacteria 2539
21 Ga0070661_100327496 3300005344 Bacteria 1197
22 Ga0070692_10058689 3300005345 Unclassified 2021
23 Ga0070668_100014834 3300005347 Bacteria 5824
24 Ga0070668_100115282 3300005347 Bacteria 2142
25 Ga0070669_100001789 3300005353 Bacteria 15457
26 Ga0070669_100020815 3300005353 Bacteria 4686
27 Ga0070669_100197938 3300005353 Bacteria 1580
28 Ga0070675_100003948 3300005354 Bacteria 11243
29 Ga0070675_100080016 3300005354 Bacteria 2724
30 Ga0070671_100029706 3300005355 Unclassified 4508
31 Ga0070671_100077998 3300005355 Bacteria 2768
32 Ga0070674_100095869 3300005356 Bacteria 2151
33 Ga0070674_100144435 3300005356 Unclassified 1789
34 Ga0070673_100022255 3300005364 Bacteria 4611
35 Ga0070659_100012353 3300005366 Bacteria 6329
36 Ga0070659_100199986 3300005366 Bacteria 1644
37 Ga0070667_100497244 3300005367 Bacteria 1117
38 Ga0070709_10035778 3300005434 Bacteria 3020
39 Ga0070709_10044147 3300005434 Bacteria 2759
40 Ga0070714_100002021 3300005435 Bacteria 14860
41 Ga0070714_100060846 3300005435 Bacteria 3242
42 Ga0070713_100000099 3300005436 Bacteria 55142
43 Ga0070713_100021582 3300005436 Bacteria 4957
44 Ga0070710_10100437 3300005437 Bacteria 1722
45 Ga0070711_100000753 3300005439 Bacteria 16909
46 Ga0070711_100079777 3300005439 Bacteria 2328
47 Ga0070711_100369743 3300005439 Unclassified 1157
48 Ga0070700_100145115 3300005441 Unclassified 1617
49 Ga0070694_100028596 3300005444 Bacteria 3629
50 Ga0070708_100055449 3300005445 Bacteria 3525
51 Ga0070708_100065192 3300005445 Bacteria 3266
52 Ga0070708_100192632 3300005445 Unclassified 1907
53 Ga0070663_100177989 3300005455 Unclassified 1648
54 Ga0070662_100032209 3300005457 Bacteria 3683
55 Ga0070681_10001156 3300005458 Bacteria 22806
56 Ga0070681_10002365 3300005458 Bacteria 17222
57 Ga0070681_10432437 3300005458 Bacteria 1228
58 Ga0068867_100315910 3300005459 Bacteria 1292
59 Ga0070685_10055109 3300005466 Bacteria 2309
60 Ga0070706_100136351 3300005467 Bacteria 2291
61 Ga0070707_100034660 3300005468 Bacteria 4816
62 Ga0070707_100282434 3300005468 Bacteria 1613
63 Ga0070707_100410251 3300005468 Unclassified 1315
64 Ga0070698_100146557 3300005471 Bacteria 2310
65 Ga0070698_100218058 3300005471 Bacteria 1842
66 Ga0070698_100261469 3300005471 Unclassified 1663
67 Ga0070699_100000303 3300005518 Bacteria 47745
68 Ga0070699_100002386 3300005518 Bacteria 16848
69 Ga0070699_100167394 3300005518 Bacteria 1947
70 Ga0070699_100277512 3300005518 Bacteria 1501
71 Ga0070679_100024913 3300005530 Bacteria 5866
72 Ga0070679_100165654 3300005530 Bacteria 2184
73 Ga0070684_100003636 3300005535 Bacteria 11616
74 Ga0070684_100049293 3300005535 Bacteria 3655
75 Ga0070672_100144554 3300005543 Bacteria 1964
76 Ga0070672_100260228 3300005543 Unclassified 1463
77 Ga0070672_100305994 3300005543 Bacteria 1348
78 Ga0070695_100046431 3300005545 Bacteria 2771
79 Ga0070696_100308568 3300005546 Bacteria 1214
80 Ga0070693_100023609 3300005547 Bacteria 3289
81 Ga0070693_100055626 3300005547 Bacteria 2280
82 Ga0070665_100000340 3300005548 Bacteria 70986
83 Ga0070665_100012469 3300005548 Bacteria 8568
84 Ga0070665_100049853 3300005548 Bacteria 4201
85 Ga0068855_100029430 3300005563 Bacteria 6566
86 Ga0070664_100028749 3300005564 Bacteria 4628
87 Ga0070664_100128227 3300005564 Bacteria 2227
88 Ga0070664_100363942 3300005564 Bacteria 1317
89 Ga0068857_100007687 3300005577 Bacteria 9285
90 Ga0068857_100208683 3300005577 Bacteria 1782
91 Ga0068856_100621023 3300005614 Bacteria 1101
92 Ga0068852_100006420 3300005616 Bacteria 8496
93 Ga0068859_100007220 3300005617 Bacteria 11276
94 Ga0068864_100066728 3300005618 Bacteria 3123
95 Ga0068866_10041909 3300005718 Bacteria 2275
96 Ga0068861_100004733 3300005719 Bacteria 9150
97 Ga0068851_10097271 3300005834 Bacteria 1558
98 Ga0068870_10026000 3300005840 Bacteria 2913
99 Ga0068863_100008696 3300005841 Bacteria 9918
100 Ga0068863_100185921 3300005841 Bacteria 1996
101 Ga0068862_100001130 3300005844 Bacteria 25337
102 Ga0070717_10002818 3300006028 Bacteria 12297
103 Ga0075432_10020297 3300006058 Bacteria 2272
104 Ga0070712_100064708 3300006175 Bacteria 2594
105 Ga0075367_10086194 3300006178 Bacteria 1906
106 Ga0075370_10132800 3300006353 Bacteria 1453
107 Ga0068871_100074934 3300006358 Unclassified 2793
108 Ga0068871_100101380 3300006358 Bacteria 2413
109 Ga0075428_100225973 3300006844 Bacteria 2020
110 Ga0075430_100001971 3300006846 Bacteria 16903
111 Ga0075430_100011242 3300006846 Bacteria 7592
112 Ga0075430_100015411 3300006846 Bacteria 6507
113 Ga0075430_100062832 3300006846 Bacteria 3119
114 Ga0075430_100117629 3300006846 Bacteria 2215
115 Ga0075431_100010387 3300006847 Bacteria 9357
116 Ga0075431_100061968 3300006847 Bacteria 3860
117 Ga0075431_100117221 3300006847 Bacteria 2748
118 Ga0075431_100286968 3300006847 Unclassified 1666
119 Ga0075431_100352838 3300006847 Bacteria 1478
120 Ga0075431_100354285 3300006847 Bacteria 1475
121 Ga0075433_10033894 3300006852 Bacteria 4381
122 Ga0075433_10124044 3300006852 Bacteria 2294
123 Ga0075434_100009834 3300006871 Bacteria 8942
124 Ga0075434_100014626 3300006871 Bacteria 7506
125 Ga0075434_100049475 3300006871 Bacteria 4174
126 Ga0075434_100057489 3300006871 Bacteria 3865
127 Ga0075434_100099039 3300006871 Bacteria 2920
128 Ga0075434_100517848 3300006871 Bacteria 1213
129 Ga0075429_100005216 3300006880 Bacteria 11176
130 Ga0075429_100007686 3300006880 Bacteria 9357
131 Ga0075429_100140381 3300006880 Bacteria 2115
132 Ga0075429_100273553 3300006880 Bacteria 1479
133 Ga0075429_100515994 3300006880 Bacteria 1047
134 Ga0097620_100007220 3300006931 Bacteria 11276
135 Ga0105240_10000234 3300009093 Bacteria 110280
136 Ga0105240_10013973 3300009093 Bacteria 10990
137 Ga0105240_10023336 3300009093 Bacteria 8186
138 Ga0111539_10110445 3300009094 Bacteria 3226
139 Ga0111539_10231987 3300009094 Bacteria 2149
140 Ga0111539_10681133 3300009094 Bacteria 1197
141 Ga0105245_10063483 3300009098 Bacteria 3335
142 Ga0105247_10186480 3300009101 Bacteria 1387
143 Ga0114129_10018690 3300009147 Bacteria 9870
144 Ga0114129_10081219 3300009147 Bacteria 4506
145 Ga0114129_10105212 3300009147 Bacteria 3900
146 Ga0114129_10286291 3300009147 Bacteria 2200
147 Ga0114129_10475347 3300009147 Bacteria 1636
148 Ga0105243_10157337 3300009148 Bacteria 1955
149 Ga0105242_10059476 3300009176 Bacteria 3135
150 Ga0105248_10012503 3300009177 Bacteria 9363
151 Ga0105248_10222861 3300009177 Bacteria 2123
152 Ga0105249_10036502 3300009553 Bacteria 4458
153 Ga0105249_10187789 3300009553 Unclassified 2015
154 Ga0105239_10319258 3300010375 Bacteria 1751
155 Ga0105246_10343953 3300011119 Bacteria 1220
156 Ga0157369_10257188 3300013105 Bacteria 1821
157 Ga0157374_10525870 3300013296 Bacteria 1189
158 Ga0163162_10003639 3300013306 Bacteria 14775
159 Ga0163162_10160050 3300013306 Bacteria 2373
160 Ga0157375_10013016 3300013308 Bacteria 7392
161 Ga0163163_10026987 3300014325 Bacteria 5495
162 Ga0163163_10319012 3300014325 Bacteria 1607
163 Ga0157380_10011662 3300014326 Bacteria 6354
164 Ga0157380_10029659 3300014326 Bacteria 4183
165 Ga0157380_10295865 3300014326 Unclassified 1488
166 Ga0157377_10004211 3300014745 Bacteria 6583
167 Ga0207697_10001572 3300025315 Bacteria 12328
168 Ga0207656_10067338 3300025321 Bacteria 1585
169 Ga0207682_10065517 3300025893 Unclassified 1529
170 Ga0207682_10077101 3300025893 Bacteria 1422
171 Ga0207688_10018624 3300025901 Bacteria 3777
172 Ga0207688_10132411 3300025901 Bacteria 1462
173 Ga0207680_10026346 3300025903 Bacteria 3222
174 Ga0207647_10075268 3300025904 Bacteria 2032
175 Ga0207699_10005668 3300025906 Bacteria 5997
176 Ga0207699_10057474 3300025906 Bacteria 2323
177 Ga0207699_10325892 3300025906 Unclassified 1079
178 Ga0207645_10003798 3300025907 Bacteria 11336
179 Ga0207645_10152763 3300025907 Bacteria 1508
180 Ga0207643_10002078 3300025908 Bacteria 11026
181 Ga0207705_10329544 3300025909 Bacteria 1174
182 Ga0207684_10103958 3300025910 Bacteria 2429
183 Ga0207707_10002480 3300025912 Bacteria 16615
184 Ga0207707_10393660 3300025912 Bacteria 1190
185 Ga0207695_10000336 3300025913 Bacteria 110791
186 Ga0207695_10006763 3300025913 Bacteria 14785
187 Ga0207693_10101197 3300025915 Bacteria 2259
188 Ga0207663_10024930 3300025916 Bacteria 3450
189 Ga0207660_10084585 3300025917 Unclassified 2338
190 Ga0207662_10000522 3300025918 Bacteria 17084
191 Ga0207657_10091994 3300025919 Bacteria 2528
192 Ga0207649_10020566 3300025920 Bacteria 3786
193 Ga0207649_10348546 3300025920 Bacteria 1095
194 Ga0207652_10035607 3300025921 Bacteria 4203
195 Ga0207652_10097221 3300025921 Bacteria 2595
196 Ga0207652_10167519 3300025921 Unclassified 1970
197 Ga0207646_10044686 3300025922 Bacteria 3976
198 Ga0207646_10048776 3300025922 Bacteria 3795
199 Ga0207646_10181984 3300025922 Bacteria 1898
200 Ga0207650_10010679 3300025925 Bacteria 6308
201 Ga0207650_10183967 3300025925 Bacteria 1666
202 Ga0207659_10006584 3300025926 Bacteria 7132
203 Ga0207659_10107151 3300025926 Bacteria 2117
204 Ga0207700_10000244 3300025928 Bacteria 32477
205 Ga0207700_10032861 3300025928 Bacteria 3706
206 Ga0207664_10005155 3300025929 Bacteria 8905
207 Ga0207664_10063543 3300025929 Bacteria 2951
208 Ga0207644_10301007 3300025931 Bacteria 1292
209 Ga0207706_10000802 3300025933 Bacteria 32565
210 Ga0207669_10070756 3300025937 Bacteria 2189
211 Ga0207704_10145345 3300025938 Bacteria 1665
212 Ga0207691_10002836 3300025940 Bacteria 16881
213 Ga0207691_10004010 3300025940 Bacteria 14272
214 Ga0207691_10118196 3300025940 Bacteria 2352
215 Ga0207691_10181202 3300025940 Unclassified 1841
216 Ga0207711_10080579 3300025941 Bacteria 2844
217 Ga0207711_10340834 3300025941 Bacteria 1387
218 Ga0207711_10391315 3300025941 Bacteria 1291
219 Ga0207689_10002762 3300025942 Bacteria 16235
220 Ga0207661_10139931 3300025944 Unclassified 2082
221 Ga0207679_10002293 3300025945 Bacteria 11794
222 Ga0207679_10018338 3300025945 Bacteria 4687
223 Ga0207679_10040635 3300025945 Bacteria 3331
224 Ga0207667_10005033 3300025949 Bacteria 16156
225 Ga0207712_10053355 3300025961 Bacteria 2836
226 Ga0207668_10098115 3300025972 Bacteria 2170
227 Ga0207658_10242441 3300025986 Bacteria 1528
228 Ga0207703_10213623 3300026035 Bacteria 1721
229 Ga0207703_10221912 3300026035 Bacteria 1690
230 Ga0207678_10152225 3300026067 Bacteria 1975
231 Ga0207708_10484318 3300026075 Unclassified 1035
232 Ga0207648_10009656 3300026089 Bacteria 9227
233 Ga0207648_10120010 3300026089 Bacteria 2312
234 Ga0207676_10161165 3300026095 Bacteria 1943
235 Ga0207674_10001427 3300026116 Bacteria 30867
236 Ga0207674_10001988 3300026116 Bacteria 25906
237 Ga0207675_100002778 3300026118 Bacteria 17194
238 Ga0207675_100715939 3300026118 Bacteria 1011
239 Ga0207428_10149853 3300027907 Bacteria 1776
240 Ga0268266_10000031 3300028379 Bacteria 406292
241 Ga0268266_10026405 3300028379 Bacteria 4941
242 Ga0268266_10129124 3300028379 Bacteria 2259
243 Ga0268265_10005172 3300028380 Bacteria 8939
244 Ga0307408_100011095 3300031548 Bacteria 5951
245 Ga0307408_100019866 3300031548 Bacteria 4525
246 Ga0307408_100025558 3300031548 Bacteria 4046
247 Ga0307405_10021722 3300031731 Bacteria 3613
248 Ga0307410_10026628 3300031852 Bacteria 3643
249 Ga0307410_10452723 3300031852 Bacteria 1047
250 Ga0307406_10005032 3300031901 Bacteria 7206
251 Ga0307406_10007658 3300031901 Bacteria 5997
252 Ga0307406_10030804 3300031901 Bacteria 3261
253 Ga0307406_10049485 3300031901 Bacteria 2660
254 Ga0307406_10054076 3300031901 Bacteria 2561
255 Ga0307406_10088931 3300031901 Bacteria 2073
256 Ga0307407_10087615 3300031903 Bacteria 1900
257 Ga0307412_10316330 3300031911 Bacteria 1240
258 Ga0307409_100009744 3300031995 Bacteria 5924
259 Ga0307409_100147536 3300031995 Bacteria 2036
260 Ga0307409_100174852 3300031995 Bacteria 1894
261 Ga0307409_100218249 3300031995 Bacteria 1720
262 Ga0307416_100016951 3300032002 Bacteria 5081
263 Ga0307416_100104708 3300032002 Bacteria 2474
264 Ga0307414_10000006 3300032004 Bacteria 451918
265 Ga0307414_10023427 3300032004 Bacteria 3916
266 Ga0307414_10080184 3300032004 Bacteria 2386
267 Ga0307414_10096409 3300032004 Bacteria 2213
268 Ga0307415_100226547 3300032126 Bacteria 1502
269 Ga0373926_0035621 3300035083 Bacteria 1766
270 Ga0373944_0019280 3300035089 Bacteria 1956
271 Ga0373936_0023284 3300035113 Bacteria 2413
272 Ga0373945_0005579 3300035116 Bacteria 4034
273 Ga0373943_0000254 3300035170 Bacteria 21923
274 Ga0373946_0096625 3300035171 Bacteria 1317
275 Ga0373935_0005377 3300035692 Bacteria 7547
276 Ga0373927_0003692 3300035695 Bacteria 10893
277 Ga0373925_0000440 3300037068 Bacteria 41982
278 Ga0395905_0282568 3300037471 Bacteria 1546
279 Ga0400484_29828 3300038725 Bacteria 1706
280 Ga0439439_0001356 3300041406 Bacteria 4829
281 Ga0439453_0004657 3300041408 Bacteria 2049
282 Ga0439454_015944 3300042011 Bacteria 1057
283 Ga0439457_030941 3300042014 Unclassified 1187
284 Ga0439462_0051952 3300042015 Unclassified 1102
285 Ga0439446_0017830 3300042156 Bacteria 1986
286 Ga0439434_0018316 3300042435 Bacteria 2095
287 Ga0451577_0002965 3300042876 Bacteria 19406
288 Ga0451577_0121484 3300042876 Bacteria 2340
289 Ga0451577_0160652 3300042876 Unclassified 2023
290 Ga0451577_0444130 3300042876 Unclassified 1178
291 Ga0466963_0007755 3300044694 Bacteria 6417
292 Ga0466957_0261845 3300044842 Unclassified 1153
293 Ga0451576_0101908 3300045051 Bacteria 2986
294 Ga0466958_0071716 3300045836 Unclassified 2121
295 Ga0495603_0006074 3300046455 Bacteria 7221
296 Ga0495629_0020153 3300046459 Unclassified 4761
297 Ga0495629_0261428 3300046459 Bacteria 1190
298 Ga0495580_0021150 3300046472 Bacteria 4803
299 Ga0495639_0000310 3300046475 Bacteria 23757
300 Ga0495630_0001569 3300046517 Bacteria 15873
301 Ga0495643_0001087 3300046522 Bacteria 27075
302 Ga0495665_0000149 3300046531 Bacteria 34379
303 Ga0495587_0191092 3300046536 Bacteria 1159
304 Ga0495598_0022464 3300046537 Bacteria 1689
305 Ga0495667_0004006 3300046559 Bacteria 9893
306 Ga0495667_0173564 3300046559 Bacteria 1385
307 Ga0495588_0021963 3300046674 Bacteria 3150
308 Ga0495613_0003010 3300046689 Bacteria 12622
309 Ga0495613_0015284 3300046689 Bacteria 5705
310 Ga0495600_0021453 3300046809 Bacteria 4136
311 Ga0495675_0042918 3300047444 Bacteria 2881
312 Ga0495675_0195515 3300047444 Bacteria 1233
313 Ga0495593_0000386 3300047673 Bacteria 24477
314 Ga0495614_0005793 3300048089 Bacteria 5565
315 Ga0496115_0190832 3300048918 Bacteria 1693
316 Ga0496122_0217124 3300048925 Bacteria 1101
317 Ga0501031_0021293 3300049568 Bacteria 4227
318 Ga0501032_0011669 3300049569 Bacteria 6299
319 Ga0501040_0000016 3300049576 Bacteria 75260
320 Ga0501040_0147684 3300049576 Bacteria 1658
321 Ga0501040_0164023 3300049576 Unclassified 1571
322 Ga0501041_0021531 3300049577 Bacteria 3862
323 Ga0501042_0000046 3300049578 Bacteria 41284
324 Ga0501042_0054627 3300049578 Bacteria 2849
325 Ga0501048_0108583 3300049582 Bacteria 1959
326 Ga0501070_0270845 3300049586 Unclassified 1387
327 Ga0501070_0338252 3300049586 Bacteria 1223
328 Ga0501071_0064000 3300049587 Bacteria 2668
329 Ga0501072_0060131 3300049588 Unclassified 2997
330 Ga0501076_0157054 3300049592 Bacteria 1852
331 Ga0501076_0223690 3300049592 Bacteria 1538
332 Ga0501076_0380673 3300049592 Bacteria 1160
333 Ga0501223_011289 3300049663 Bacteria 1792
334 Ga0501227_049861 3300049665 Bacteria 1054
335 Ga0501083_0247080 3300049744 Bacteria 1162
336 Ga0501045_0005185 3300049824 Bacteria 9008
337 nmdc:mga06z11_96553_c1 3300050494 Bacteria 1614
338 nmdc:mga07m45_72218_c1 3300050496 Bacteria 1964
339 nmdc:mga05p37_118808_c1 3300050507 Bacteria 3248
340 nmdc:mga05p37_414870_c1 3300050507 Bacteria 1568
341 nmdc:mga05p37_81095_c1 3300050507 Bacteria 3996
342 nmdc:mga09592_152862_c1 3300050508 Bacteria 1991
343 nmdc:mga09592_196626_c1 3300050508 Bacteria 1746
344 nmdc:mga09592_22454_c1 3300050508 Bacteria 5207
345 nmdc:mga09592_66686_c1 3300050508 Bacteria 3051
346 nmdc:mga09592_88654_c1 3300050508 Bacteria 2642
347 nmdc:mga0qj67_13159_c1 3300050509 Bacteria 6247
348 nmdc:mga0qj67_23066_c1 3300050509 Bacteria 4783
349 nmdc:mga0qj67_37097_c1 3300050509 Bacteria 3817
350 nmdc:mga0qj67_8547_c1 3300050509 Bacteria 7600
351 nmdc:mga0qj67_9636_c1 3300050509 Bacteria 7197
352 nmdc:mga06r32_16467_c1 3300050510 Bacteria 6737
353 nmdc:mga06r32_239772_c1 3300050510 Bacteria 1801
354 nmdc:mga06r32_271016_c1 3300050510 Bacteria 1685
355 nmdc:mga06r32_328237_c1 3300050510 Bacteria 1515
356 nmdc:mga06r32_75307_c1 3300050510 Bacteria 3275
357 nmdc:mga08y16_229981_c1 3300050511 Unclassified 1918
358 nmdc:mga08y16_263915_c1 3300050511 Bacteria 1778
359 nmdc:mga08y16_271592_c1 3300050511 Bacteria 1750
360 nmdc:mga0n895_159773_c1 3300050512 Bacteria 2285
361 nmdc:mga0n895_179896_c1 3300050512 Unclassified 2146
362 nmdc:mga0n895_29124_c1 3300050512 Bacteria 5261
363 nmdc:mga0n895_508478_c1 3300050512 Bacteria 1213
364 nmdc:mga0rr50_192534_c1 3300050513 Bacteria 1672
365 nmdc:mga0a205_13613_c1 3300050515 Bacteria 7578
366 nmdc:mga0a205_40356_c1 3300050515 Bacteria 4493
367 nmdc:mga0a205_8082_c1 3300050515 Bacteria 9561
368 Ga0501084_0108951 3300054114 Bacteria 2327
369 Ga0501084_0422278 3300054114 Bacteria 1127
370 Ga0590071_026441 3300059421 Bacteria 1376
371 Ga0501082_0043019 3300060353 Bacteria 3894
372 Ga0501082_0293874 3300060353 Bacteria 1415
373 2688393164 2687453341 Bacteria 6534136
374 nmdc:mga0rr50_209464_c1
375 SwRhRL2b_contig_778298
376 rootH2_10013381
377 rootH2_10152411
378 Ga0065704_10076030
379 Ga0065715_10248906
380 Ga0065707_10006464
381 Ga0070658_10367949
382 Ga0070683_100121414
383 Ga0070690_100245535
384 Ga0070670_100007515
385 Ga0070670_100062136
386 Ga0070677_10104654
387 Ga0068869_100016580
388 Ga0070680_100077346
389 Ga0070680_100175315
390 Ga0068868_100257525
391 Ga0070687_100004004
392 Ga0070661_100005605
393 Ga0070661_100072231
394 Ga0070661_100327496
395 Ga0070692_10058689
396 Ga0070668_100014834
397 Ga0070668_100115282
398 Ga0070669_100001789
399 Ga0070669_100020815
400 Ga0070669_100197938
401 Ga0070675_100003948
402 Ga0070675_100080016
403 Ga0070671_100029706
404 Ga0070671_100077998
405 Ga0070674_100095869
406 Ga0070674_100144435
407 Ga0070673_100022255
408 Ga0070659_100012353
409 Ga0070659_100199986
410 Ga0070667_100497244
411 Ga0070709_10035778
412 Ga0070709_10044147
413 Ga0070714_100002021
414 Ga0070714_100060846
415 Ga0070713_100000099
416 Ga0070713_100021582
417 Ga0070710_10100437
418 Ga0070711_100000753
419 Ga0070711_100079777
420 Ga0070711_100369743
421 Ga0070700_100145115
422 Ga0070694_100028596
423 Ga0070708_100055449
424 Ga0070708_100065192
425 Ga0070708_100192632
426 Ga0070663_100177989
427 Ga0070662_100032209
428 Ga0070681_10001156
429 Ga0070681_10002365
430 Ga0070681_10432437
431 Ga0068867_100315910
432 Ga0070685_10055109
433 Ga0070706_100136351
434 Ga0070707_100034660
435 Ga0070707_100282434
436 Ga0070707_100410251
437 Ga0070698_100146557
438 Ga0070698_100218058
439 Ga0070698_100261469
440 Ga0070699_100000303
441 Ga0070699_100002386
442 Ga0070699_100167394
443 Ga0070699_100277512
444 Ga0070679_100024913
445 Ga0070679_100165654
446 Ga0070684_100003636
447 Ga0070684_100049293
448 Ga0070672_100144554
449 Ga0070672_100260228
450 Ga0070672_100305994
451 Ga0070695_100046431
452 Ga0070696_100308568
453 Ga0070693_100023609
454 Ga0070693_100055626
455 Ga0070665_100000340
456 Ga0070665_100012469
457 Ga0070665_100049853
458 Ga0068855_100029430
459 Ga0070664_100028749
460 Ga0070664_100128227
461 Ga0070664_100363942
462 Ga0068857_100007687
463 Ga0068857_100208683
464 Ga0068856_100621023
465 Ga0068852_100006420
466 Ga0068859_100007220
467 Ga0068864_100066728
468 Ga0068866_10041909
469 Ga0068861_100004733
470 Ga0068851_10097271
471 Ga0068870_10026000
472 Ga0068863_100008696
473 Ga0068863_100185921
474 Ga0068862_100001130
475 Ga0070717_10002818
476 Ga0075432_10020297
477 Ga0070712_100064708
478 Ga0075367_10086194
479 Ga0075370_10132800
480 Ga0068871_100074934
481 Ga0068871_100101380
482 Ga0075428_100225973
483 Ga0075430_100001971
484 Ga0075430_100011242
485 Ga0075430_100015411
486 Ga0075430_100062832
487 Ga0075430_100117629
488 Ga0075431_100010387
489 Ga0075431_100061968
490 Ga0075431_100117221
491 Ga0075431_100286968
492 Ga0075431_100352838
493 Ga0075431_100354285
494 Ga0075433_10033894
495 Ga0075433_10124044
496 Ga0075434_100009834
497 Ga0075434_100014626
498 Ga0075434_100049475
499 Ga0075434_100057489
500 Ga0075434_100099039
501 Ga0075434_100517848
502 Ga0075429_100005216
503 Ga0075429_100007686
504 Ga0075429_100140381
505 Ga0075429_100273553
506 Ga0075429_100515994
507 Ga0097620_100007220
508 Ga0105240_10000234
509 Ga0105240_10013973
510 Ga0105240_10023336
511 Ga0111539_10110445
512 Ga0111539_10231987
513 Ga0111539_10681133
514 Ga0105245_10063483
515 Ga0105247_10186480
516 Ga0114129_10018690
517 Ga0114129_10081219
518 Ga0114129_10105212
519 Ga0114129_10286291
520 Ga0114129_10475347
521 Ga0105243_10157337
522 Ga0105242_10059476
523 Ga0105248_10012503
524 Ga0105248_10222861
525 Ga0105249_10036502
526 Ga0105249_10187789
527 Ga0105239_10319258
528 Ga0105246_10343953
529 Ga0157369_10257188
530 Ga0157374_10525870
531 Ga0163162_10003639
532 Ga0163162_10160050
533 Ga0157375_10013016
534 Ga0163163_10026987
535 Ga0163163_10319012
536 Ga0157380_10011662
537 Ga0157380_10029659
538 Ga0157380_10295865
539 Ga0157377_10004211
540 Ga0207697_10001572
541 Ga0207656_10067338
542 Ga0207682_10065517
543 Ga0207682_10077101
544 Ga0207688_10018624
545 Ga0207688_10132411
546 Ga0207680_10026346
547 Ga0207647_10075268
548 Ga0207699_10005668
549 Ga0207699_10057474
550 Ga0207699_10325892
551 Ga0207645_10003798
552 Ga0207645_10152763
553 Ga0207643_10002078
554 Ga0207705_10329544
555 Ga0207684_10103958
556 Ga0207707_10002480
557 Ga0207707_10393660
558 Ga0207695_10000336
559 Ga0207695_10006763
560 Ga0207693_10101197
561 Ga0207663_10024930
562 Ga0207660_10084585
563 Ga0207662_10000522
564 Ga0207657_10091994
565 Ga0207649_10020566
566 Ga0207649_10348546
567 Ga0207652_10035607
568 Ga0207652_10097221
569 Ga0207652_10167519
570 Ga0207646_10044686
571 Ga0207646_10048776
572 Ga0207646_10181984
573 Ga0207650_10010679
574 Ga0207650_10183967
575 Ga0207659_10006584
576 Ga0207659_10107151
577 Ga0207700_10000244
578 Ga0207700_10032861
579 Ga0207664_10005155
580 Ga0207664_10063543
581 Ga0207644_10301007
582 Ga0207706_10000802
583 Ga0207669_10070756
584 Ga0207704_10145345
585 Ga0207691_10002836
586 Ga0207691_10004010
587 Ga0207691_10118196
588 Ga0207691_10181202
589 Ga0207711_10080579
590 Ga0207711_10340834
591 Ga0207711_10391315
592 Ga0207689_10002762
593 Ga0207661_10139931
594 Ga0207679_10002293
595 Ga0207679_10018338
596 Ga0207679_10040635
597 Ga0207667_10005033
598 Ga0207712_10053355
599 Ga0207668_10098115
600 Ga0207658_10242441
601 Ga0207703_10213623
602 Ga0207703_10221912
603 Ga0207678_10152225
604 Ga0207708_10484318
605 Ga0207648_10009656
606 Ga0207648_10120010
607 Ga0207676_10161165
608 Ga0207674_10001427
609 Ga0207674_10001988
610 Ga0207675_100002778
611 Ga0207675_100715939
612 Ga0207428_10149853
613 Ga0268266_10000031
614 Ga0268266_10026405
615 Ga0268266_10129124
616 Ga0268265_10005172
617 Ga0307408_100011095
618 Ga0307408_100019866
619 Ga0307408_100025558
620 Ga0307405_10021722
621 Ga0307410_10026628
622 Ga0307410_10452723
623 Ga0307406_10005032
624 Ga0307406_10007658
625 Ga0307406_10030804
626 Ga0307406_10049485
627 Ga0307406_10054076
628 Ga0307406_10088931
629 Ga0307407_10087615
630 Ga0307412_10316330
631 Ga0307409_100009744
632 Ga0307409_100147536
633 Ga0307409_100174852
634 Ga0307409_100218249
635 Ga0307416_100016951
636 Ga0307416_100104708
637 Ga0307414_10000006
638 Ga0307414_10023427
639 Ga0307414_10080184
640 Ga0307414_10096409
641 Ga0307415_100226547
642 Ga0373926_0035621
643 Ga0373944_0019280
644 Ga0373936_0023284
645 Ga0373945_0005579
646 Ga0373943_0000254
647 Ga0373946_0096625
648 Ga0373935_0005377
649 Ga0373927_0003692
650 Ga0373925_0000440
651 Ga0395905_0282568
652 Ga0400484_29828
653 Ga0439439_0001356
654 Ga0439453_0004657
655 Ga0439454_015944
656 Ga0439457_030941
657 Ga0439462_0051952
658 Ga0439446_0017830
659 Ga0439434_0018316
660 Ga0451577_0002965
661 Ga0451577_0121484
662 Ga0451577_0160652
663 Ga0451577_0444130
664 Ga0466963_0007755
665 Ga0466957_0261845
666 Ga0451576_0101908
667 Ga0466958_0071716
668 Ga0495603_0006074
669 Ga0495629_0020153
670 Ga0495629_0261428
671 Ga0495580_0021150
672 Ga0495639_0000310
673 Ga0495630_0001569
674 Ga0495643_0001087
675 Ga0495665_0000149
676 Ga0495587_0191092
677 Ga0495598_0022464
678 Ga0495667_0004006
679 Ga0495667_0173564
680 Ga0495588_0021963
681 Ga0495613_0003010
682 Ga0495613_0015284
683 Ga0495600_0021453
684 Ga0495675_0042918
685 Ga0495675_0195515
686 Ga0495593_0000386
687 Ga0495614_0005793
688 Ga0496115_0190832
689 Ga0496122_0217124
690 Ga0501031_0021293
691 Ga0501032_0011669
692 Ga0501040_0000016
693 Ga0501040_0147684
694 Ga0501040_0164023
695 Ga0501041_0021531
696 Ga0501042_0000046
697 Ga0501042_0054627
698 Ga0501048_0108583
699 Ga0501070_0270845
700 Ga0501070_0338252
701 Ga0501071_0064000
702 Ga0501072_0060131
703 Ga0501076_0157054
704 Ga0501076_0223690
705 Ga0501076_0380673
706 Ga0501223_011289
707 Ga0501227_049861
708 Ga0501083_0247080
709 Ga0501045_0005185
710 nmdc:mga06z11_96553_c1
711 nmdc:mga07m45_72218_c1
712 nmdc:mga05p37_118808_c1
713 nmdc:mga05p37_414870_c1
714 nmdc:mga05p37_81095_c1
715 nmdc:mga09592_152862_c1
716 nmdc:mga09592_196626_c1
717 nmdc:mga09592_22454_c1
718 nmdc:mga09592_66686_c1
719 nmdc:mga09592_88654_c1
720 nmdc:mga0qj67_13159_c1
721 nmdc:mga0qj67_23066_c1
722 nmdc:mga0qj67_37097_c1
723 nmdc:mga0qj67_8547_c1
724 nmdc:mga0qj67_9636_c1
725 nmdc:mga06r32_16467_c1
726 nmdc:mga06r32_239772_c1
727 nmdc:mga06r32_271016_c1
728 nmdc:mga06r32_328237_c1
729 nmdc:mga06r32_75307_c1
730 nmdc:mga08y16_229981_c1
731 nmdc:mga08y16_263915_c1
732 nmdc:mga08y16_271592_c1
733 nmdc:mga0n895_159773_c1
734 nmdc:mga0n895_179896_c1
735 nmdc:mga0n895_29124_c1
736 nmdc:mga0n895_508478_c1
737 nmdc:mga0rr50_192534_c1
738 nmdc:mga0a205_13613_c1
739 nmdc:mga0a205_40356_c1
740 nmdc:mga0a205_8082_c1
741 Ga0501084_0108951
742 Ga0501084_0422278
743 Ga0590071_026441
744 Ga0501082_0043019
745 Ga0501082_0293874
746 2688393164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01882

DUF58

Protein of unknown function DUF58

56

146

0.97

PF13519

VWA_2

von Willebrand factor type A domain

98

238

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ft6-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, ala-ala linker variant, sumo tag-free preparation. 0.8185 79 218
8fz4-assembly2.cif.gz_B the von willebrand factor a domain of anthrax toxin receptor 2 0.8163 82 218
8ft8-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, thr-val linker variant, sumo tag-free preparation 0.816 82 218
8fzu-assembly2.cif.gz_B the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, thr-val linker variant, expressed with sumo tag 0.814 77 218
1sht-assembly1.cif.gz_X crystal structure of the von willebrand factor a domain of human capillary morphogenesis protein 2: an anthrax toxin receptor 0.8092 82 215
ID Description Score Start End Superfamily
af_P9WLX5_142_317_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8571 143 295 3.40.50.410
af_Q66H58_3_138_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8425 83 194 3.40.50.410
af_A0A0R4IB09_23_186_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7978 82 279 3.40.50.410
af_A0A0P0WT04_289_392_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7884 82 179 3.40.50.410
af_Q54ES2_261_409_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7754 82 279 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A7X7U463-F1-model_v4 DUF58 domain-containing protein 0.9594 119 295
AF-A0A382F9Q3-F1-model_v4 DUF58 domain-containing protein 0.9582 129 296
AF-A0A660VQZ4-F1-model_v4 DUF58 domain-containing protein 0.9566 105 295
AF-A0A660WI03-F1-model_v4 DUF58 domain-containing protein 0.9542 190 295
AF-A0A3C8C989-F1-model_v4 UspA domain-containing protein 0.9528 184 295

Map