F426514

General Info

Members Datasets Scaffolds Average Seq Length
373 223 746 111

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0755069|Ga0501083_0755069_207_581
Length 124
Sequence LPDALVFANLETPTMIKTIGLLTRKDGWTHEQFMKHWVEVHAPLAHAVPGLRRYVQNHIEGERTRADIPATDVAIDGIAELWFDDQAALEAAAKTPEMKALHADGAKFIGRIRSYVIDEKVVIG

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
221 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
222 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.57
Nodule 0
Rhizoplane 1.34
Rhizosphere 77.48
Stem 0
Stem Tuber 0
Unclassified 18.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0755069 3300049744 Bacteria 633
2 Ga0065712_10050776 3300005290 Bacteria 742
3 Ga0070658_10006965 3300005327 Bacteria 9133
4 Ga0070690_100059931 3300005330 Bacteria 2448
5 Ga0070690_100448914 3300005330 Bacteria 956
6 Ga0070690_101447326 3300005330 Unclassified 554
7 Ga0068869_100680594 3300005334 Bacteria 876
8 Ga0070666_10557412 3300005335 Bacteria 834
9 Ga0070680_100000351 3300005336 Bacteria 30952
10 Ga0070660_100266734 3300005339 Bacteria 1399
11 Ga0070689_100173064 3300005340 Bacteria 1750
12 Ga0070691_10069969 3300005341 Bacteria 1702
13 Ga0070661_100397667 3300005344 Bacteria 1089
14 Ga0070692_10011701 3300005345 Bacteria 4036
15 Ga0070669_100060630 3300005353 Bacteria 2780
16 Ga0070675_101598299 3300005354 Unclassified 601
17 Ga0070671_100024854 3300005355 Bacteria 4908
18 Ga0070674_101439404 3300005356 Bacteria 618
19 Ga0070688_100063839 3300005365 Bacteria 2336
20 Ga0070709_10048804 3300005434 Bacteria 2643
21 Ga0070709_10174366 3300005434 Unclassified 1505
22 Ga0070709_10514995 3300005434 Bacteria 911
23 Ga0070713_100377280 3300005436 Bacteria 1320
24 Ga0070701_10019764 3300005438 Bacteria 3186
25 Ga0070711_100054984 3300005439 Bacteria 2748
26 Ga0070705_100132233 3300005440 Unclassified 1629
27 Ga0070705_101452425 3300005440 Bacteria 573
28 Ga0070700_100185276 3300005441 Bacteria 1451
29 Ga0070700_101739296 3300005441 Bacteria 536
30 Ga0070694_100031344 3300005444 Bacteria 3486
31 Ga0070694_100500934 3300005444 Unclassified 966
32 Ga0070694_100918163 3300005444 Bacteria 723
33 Ga0070694_101831314 3300005444 Bacteria 517
34 Ga0070708_100096492 3300005445 Bacteria 2701
35 Ga0070708_100707581 3300005445 Bacteria 948
36 Ga0070678_100427201 3300005456 Bacteria 1156
37 Ga0070662_100859275 3300005457 Unclassified 773
38 Ga0070681_10032607 3300005458 Bacteria 5229
39 Ga0070681_10389798 3300005458 Bacteria 1304
40 Ga0068867_100923213 3300005459 Unclassified 787
41 Ga0070685_10461506 3300005466 Bacteria 892
42 Ga0070706_100097525 3300005467 Bacteria 2730
43 Ga0070706_100442689 3300005467 Bacteria 1209
44 Ga0070706_101337357 3300005467 Bacteria 656
45 Ga0070707_100001462 3300005468 Bacteria 23133
46 Ga0070707_101188018 3300005468 Bacteria 729
47 Ga0070707_101359088 3300005468 Bacteria 677
48 Ga0070698_100012921 3300005471 Bacteria 8840
49 Ga0070698_100506701 3300005471 Unclassified 1145
50 Ga0070698_100883768 3300005471 Bacteria 839
51 Ga0070699_100045987 3300005518 Bacteria 3777
52 Ga0070699_100418506 3300005518 Bacteria 1213
53 Ga0070679_100100518 3300005530 Bacteria 2878
54 Ga0070679_101078074 3300005530 Bacteria 748
55 Ga0070679_101644686 3300005530 Bacteria 590
56 Ga0070697_100326512 3300005536 Bacteria 1322
57 Ga0070697_100939419 3300005536 Bacteria 768
58 Ga0070697_101451354 3300005536 Bacteria 613
59 Ga0070686_100795013 3300005544 Bacteria 762
60 Ga0070695_100066861 3300005545 Bacteria 2343
61 Ga0070695_100751249 3300005545 Unclassified 778
62 Ga0070696_100313270 3300005546 Unclassified 1205
63 Ga0070696_100753077 3300005546 Unclassified 798
64 Ga0070665_100393419 3300005548 Bacteria 1394
65 Ga0070704_100027183 3300005549 Bacteria 3791
66 Ga0070704_100308441 3300005549 Unclassified 1321
67 Ga0070704_100372233 3300005549 Bacteria 1211
68 Ga0070704_100407498 3300005549 Unclassified 1161
69 Ga0068855_100210934 3300005563 Bacteria 2182
70 Ga0070664_100300400 3300005564 Bacteria 1450
71 Ga0068857_100135219 3300005577 Bacteria 2226
72 Ga0068856_100193759 3300005614 Bacteria 2046
73 Ga0070702_100291601 3300005615 Unclassified 1125
74 Ga0070702_100705389 3300005615 Bacteria 770
75 Ga0068859_100237503 3300005617 Bacteria 1911
76 Ga0068859_101282037 3300005617 Unclassified 807
77 Ga0068859_102074492 3300005617 Bacteria 628
78 Ga0068859_102136425 3300005617 Bacteria 618
79 Ga0068870_10236541 3300005840 Unclassified 1125
80 Ga0068870_11276602 3300005840 Bacteria 534
81 Ga0068863_102024213 3300005841 Bacteria 586
82 Ga0068858_100234780 3300005842 Bacteria 1739
83 Ga0068858_101767589 3300005842 Bacteria 611
84 Ga0068862_100487244 3300005844 Unclassified 1168
85 Ga0081455_10000451 3300005937 Bacteria 54150
86 Ga0081455_10214816 3300005937 Bacteria 1430
87 Ga0081539_10006413 3300005985 Bacteria 11301
88 Ga0081539_10026691 3300005985 Bacteria 3677
89 Ga0070717_10135193 3300006028 Bacteria 2123
90 Ga0070717_10516372 3300006028 Bacteria 1080
91 Ga0070717_11328022 3300006028 Bacteria 653
92 Ga0075365_10067980 3300006038 Bacteria 2393
93 Ga0075365_10107845 3300006038 Bacteria 1912
94 Ga0075365_10135950 3300006038 Bacteria 1704
95 Ga0075365_10144498 3300006038 Bacteria 1652
96 Ga0075365_10247671 3300006038 Bacteria 1252
97 Ga0075365_10499049 3300006038 Bacteria 860
98 Ga0075365_10871294 3300006038 Bacteria 635
99 Ga0075368_10100545 3300006042 Unclassified 1187
100 Ga0075368_10128908 3300006042 Bacteria 1050
101 Ga0075363_100234274 3300006048 Bacteria 1054
102 Ga0075363_100234592 3300006048 Bacteria 1054
103 Ga0075363_100302083 3300006048 Unclassified 929
104 Ga0075364_10788978 3300006051 Bacteria 648
105 Ga0070716_100333071 3300006173 Bacteria 1068
106 Ga0070712_100026458 3300006175 Bacteria 3864
107 Ga0070712_100895620 3300006175 Bacteria 765
108 Ga0075362_10001553 3300006177 Bacteria 7411
109 Ga0075362_10008626 3300006177 Bacteria 3910
110 Ga0075362_10051949 3300006177 Bacteria 1836
111 Ga0075362_10052881 3300006177 Bacteria 1821
112 Ga0075362_10060689 3300006177 Bacteria 1710
113 Ga0075362_10071044 3300006177 Bacteria 1590
114 Ga0075362_10315667 3300006177 Bacteria 778
115 Ga0075362_10460815 3300006177 Bacteria 647
116 Ga0075367_10153237 3300006178 Bacteria 1431
117 Ga0075367_10164831 3300006178 Bacteria 1379
118 Ga0075367_10237566 3300006178 Bacteria 1141
119 Ga0075369_10001721 3300006186 Bacteria 7574
120 Ga0075369_10005135 3300006186 Bacteria 4875
121 Ga0075369_10015194 3300006186 Bacteria 3086
122 Ga0075366_10034312 3300006195 Bacteria 2987
123 Ga0075366_10188410 3300006195 Bacteria 1254
124 Ga0075370_10286493 3300006353 Bacteria 979
125 Ga0075370_10504063 3300006353 Bacteria 731
126 Ga0075428_100180186 3300006844 Bacteria 2287
127 Ga0075431_102192492 3300006847 Bacteria 507
128 Ga0075433_10110257 3300006852 Bacteria 2441
129 Ga0075434_101579065 3300006871 Bacteria 665
130 Ga0075434_102279524 3300006871 Bacteria 545
131 Ga0075429_100134726 3300006880 Bacteria 2162
132 Ga0097620_100237504 3300006931 Bacteria 1911
133 Ga0097620_101281685 3300006931 Unclassified 807
134 Ga0097620_102074348 3300006931 Bacteria 628
135 Ga0097620_102136456 3300006931 Bacteria 618
136 Ga0075435_100030269 3300007076 Bacteria 4254
137 Ga0099794_10297902 3300007265 Unclassified 835
138 Ga0099794_10379551 3300007265 Bacteria 737
139 Ga0099794_10470544 3300007265 Unclassified 660
140 Ga0099795_10044299 3300007788 Bacteria 1595
141 Ga0099795_10412158 3300007788 Bacteria 616
142 Ga0105240_10005297 3300009093 Bacteria 19254
143 Ga0111539_10133767 3300009094 Bacteria 2903
144 Ga0111539_12606458 3300009094 Bacteria 586
145 Ga0105245_10578579 3300009098 Bacteria 1147
146 Ga0114129_10200184 3300009147 Bacteria 2706
147 Ga0114129_12085300 3300009147 Unclassified 684
148 Ga0105243_10319291 3300009148 Unclassified 1414
149 Ga0105243_11149054 3300009148 Bacteria 787
150 Ga0105243_11243976 3300009148 Unclassified 759
151 Ga0105241_11327373 3300009174 Bacteria 686
152 Ga0105241_12023371 3300009174 Unclassified 567
153 Ga0105242_10087575 3300009176 Bacteria 2615
154 Ga0105248_10120487 3300009177 Bacteria 2960
155 Ga0105248_11673307 3300009177 Unclassified 721
156 Ga0105248_13220320 3300009177 Bacteria 519
157 Ga0105237_12148990 3300009545 Unclassified 567
158 Ga0105238_10218220 3300009551 Bacteria 1883
159 Ga0105249_13240133 3300009553 Bacteria 523
160 Ga0099796_10066013 3300010159 Unclassified 1295
161 Ga0099796_10083035 3300010159 Unclassified 1178
162 Ga0099796_10273013 3300010159 Bacteria 709
163 Ga0105239_11552012 3300010375 Bacteria 765
164 Ga0105239_12081875 3300010375 Bacteria 659
165 Ga0105239_12699667 3300010375 Bacteria 579
166 Ga0105246_11205083 3300011119 Bacteria 697
167 Ga0157374_12887980 3300013296 Unclassified 508
168 Ga0157378_11091091 3300013297 Unclassified 835
169 Ga0163162_11961727 3300013306 Unclassified 670
170 Ga0163162_12469387 3300013306 Bacteria 598
171 Ga0157379_10198782 3300014968 Bacteria 1812
172 Ga0157379_10494417 3300014968 Bacteria 1133
173 Ga0182006_1103210 3300015261 Bacteria 1010
174 Ga0213872_10170465 3300021361 Bacteria 944
175 Ga0213875_10003642 3300021388 Bacteria 8710
176 Ga0213871_10084477 3300021441 Bacteria 913
177 Ga0207653_10010445 3300025885 Bacteria 2895
178 Ga0207692_10368523 3300025898 Bacteria 889
179 Ga0207688_10200239 3300025901 Bacteria 1197
180 Ga0207680_10052616 3300025903 Bacteria 2441
181 Ga0207647_10451269 3300025904 Bacteria 721
182 Ga0207699_10361255 3300025906 Bacteria 1027
183 Ga0207699_10474955 3300025906 Bacteria 900
184 Ga0207699_10796025 3300025906 Bacteria 695
185 Ga0207705_10030702 3300025909 Bacteria 3834
186 Ga0207684_10136400 3300025910 Bacteria 2107
187 Ga0207684_11217790 3300025910 Bacteria 623
188 Ga0207654_10525871 3300025911 Bacteria 838
189 Ga0207707_10048393 3300025912 Bacteria 3703
190 Ga0207707_10315420 3300025912 Bacteria 1350
191 Ga0207707_10433487 3300025912 Bacteria 1126
192 Ga0207695_10119026 3300025913 Bacteria 2612
193 Ga0207693_10075802 3300025915 Bacteria 2634
194 Ga0207693_11483604 3300025915 Unclassified 501
195 Ga0207663_10496291 3300025916 Bacteria 948
196 Ga0207660_10022106 3300025917 Bacteria 4283
197 Ga0207660_10199480 3300025917 Bacteria 1562
198 Ga0207660_10221567 3300025917 Bacteria 1485
199 Ga0207649_10780027 3300025920 Bacteria 745
200 Ga0207652_10045697 3300025921 Bacteria 3733
201 Ga0207652_10739092 3300025921 Bacteria 876
202 Ga0207652_11505904 3300025921 Bacteria 577
203 Ga0207646_10012471 3300025922 Bacteria 8169
204 Ga0207646_10129603 3300025922 Bacteria 2270
205 Ga0207694_10552580 3300025924 Bacteria 966
206 Ga0207650_10049022 3300025925 Bacteria 3117
207 Ga0207687_10081609 3300025927 Bacteria 2337
208 Ga0207687_11066466 3300025927 Bacteria 693
209 Ga0207700_10012508 3300025928 Bacteria 5478
210 Ga0207700_10249440 3300025928 Bacteria 1516
211 Ga0207664_10357267 3300025929 Bacteria 1294
212 Ga0207664_11131619 3300025929 Bacteria 699
213 Ga0207644_10055382 3300025931 Bacteria 2858
214 Ga0207644_10404873 3300025931 Bacteria 1116
215 Ga0207706_10470141 3300025933 Unclassified 1087
216 Ga0207686_10435143 3300025934 Unclassified 1006
217 Ga0207709_10066055 3300025935 Bacteria 2277
218 Ga0207709_10416204 3300025935 Unclassified 1031
219 Ga0207670_10042303 3300025936 Bacteria 3001
220 Ga0207670_10302297 3300025936 Bacteria 1253
221 Ga0207669_10352193 3300025937 Bacteria 1138
222 Ga0207665_10293729 3300025939 Bacteria 1213
223 Ga0207665_10410921 3300025939 Bacteria 1032
224 Ga0207711_10083162 3300025941 Unclassified 2800
225 Ga0207711_12087677 3300025941 Bacteria 509
226 Ga0207689_10489759 3300025942 Unclassified 1030
227 Ga0207667_10462211 3300025949 Bacteria 1289
228 Ga0207667_10493655 3300025949 Bacteria 1242
229 Ga0207651_10950480 3300025960 Bacteria 767
230 Ga0207668_11933262 3300025972 Unclassified 532
231 Ga0207703_11145810 3300026035 Bacteria 747
232 Ga0207703_12141287 3300026035 Bacteria 535
233 Ga0207708_10032026 3300026075 Bacteria 3992
234 Ga0207708_10205225 3300026075 Bacteria 1574
235 Ga0207702_10020079 3300026078 Bacteria 5535
236 Ga0207702_10097218 3300026078 Bacteria 2591
237 Ga0207641_10293098 3300026088 Unclassified 1534
238 Ga0207641_11767074 3300026088 Bacteria 620
239 Ga0207648_10036689 3300026089 Bacteria 4319
240 Ga0207648_10843378 3300026089 Bacteria 854
241 Ga0207648_10977918 3300026089 Unclassified 792
242 Ga0207648_11834448 3300026089 Bacteria 568
243 Ga0207675_100961340 3300026118 Bacteria 872
244 Ga0207683_10718216 3300026121 Bacteria 927
245 Ga0207683_11905525 3300026121 Unclassified 543
246 Ga0209813_10145798 3300027866 Unclassified 844
247 Ga0209813_10219805 3300027866 Bacteria 711
248 Ga0268266_11368425 3300028379 Bacteria 683
249 Ga0268265_11667887 3300028380 Unclassified 643
250 Ga0268264_10822184 3300028381 Bacteria 929
251 Ga0265332_10304394 3300031238 Bacteria 658
252 Ga0265325_10173948 3300031241 Bacteria 1006
253 Ga0265325_10374328 3300031241 Bacteria 626
254 Ga0265340_10366226 3300031247 Bacteria 636
255 Ga0307513_10913778 3300031456 Unclassified 585
256 Ga0307411_10850442 3300032005 Bacteria 807
257 Ga0373948_0221878 3300034817 Bacteria 500
258 Ga0373934_0205606 3300035086 Unclassified 811
259 Ga0373940_0106226 3300035088 Unclassified 857
260 Ga0373944_0345972 3300035089 Unclassified 565
261 Ga0373952_0058404 3300035092 Unclassified 937
262 Ga0373932_0055391 3300035112 Unclassified 1189
263 Ga0373936_0142327 3300035113 Unclassified 1036
264 Ga0373956_0108750 3300035119 Bacteria 1290
265 Ga0373943_0228911 3300035170 Bacteria 1038
266 Ga0373943_0355679 3300035170 Bacteria 840
267 Ga0373946_0184538 3300035171 Bacteria 992
268 Ga0373946_0678554 3300035171 Bacteria 538
269 Ga0373942_0325498 3300035207 Bacteria 538
270 Ga0373931_0000964 3300035691 Bacteria 12154
271 Ga0373931_0058385 3300035691 Bacteria 2072
272 Ga0373931_0192316 3300035691 Bacteria 1215
273 Ga0373935_0857791 3300035692 Bacteria 672
274 Ga0373927_0169876 3300035695 Bacteria 1429
275 Ga0373947_0146894 3300035725 Bacteria 1516
276 Ga0373947_0723935 3300035725 Bacteria 679
277 Ga0373937_0296045 3300036401 Bacteria 1529
278 Ga0373925_0317810 3300037068 Bacteria 1259
279 Ga0373925_0387451 3300037068 Bacteria 1139
280 Ga0373925_1788703 3300037068 Bacteria 501
281 Ga0436364_1029268 3300037853 Bacteria 26324
282 Ga0436365_0600217 3300039437 Bacteria 989
283 Ga0436360_0823128 3300039438 Bacteria 4194
284 Ga0436360_1063915 3300039438 Bacteria 665
285 Ga0436361_0685491 3300039447 Bacteria 1972
286 Ga0436363_0455970 3300039450 Bacteria 954
287 Ga0439465_0048966 3300041413 Bacteria 1380
288 Ga0439441_043910 3300042001 Bacteria 903
289 Ga0439435_0257737 3300042436 Bacteria 589
290 Ga0439459_0160868 3300042438 Unclassified 592
291 Ga0451577_0066829 3300042876 Bacteria 3206
292 Ga0439440_0139415 3300042993 Unclassified 688
293 Ga0495592_0067682 3300046454 Bacteria 2609
294 Ga0495580_0162301 3300046472 Bacteria 1546
295 Ga0495618_0255679 3300046514 Bacteria 1098
296 Ga0495630_0787705 3300046517 Bacteria 726
297 Ga0495599_0005907 3300046678 Bacteria 7357
298 Ga0495658_0163621 3300046683 Bacteria 1374
299 Ga0495600_0027819 3300046809 Bacteria 3656
300 Ga0495680_0306131 3300047322 Bacteria 1115
301 Ga0496101_1465643 3300048904 Unclassified 532
302 Ga0496102_0014514 3300048905 Bacteria 6845
303 Ga0496103_0009163 3300048906 Bacteria 5861
304 Ga0496104_1724988 3300048907 Unclassified 529
305 Ga0496107_0505644 3300048910 Bacteria 896
306 Ga0496126_0043267 3300048929 Bacteria 4155
307 Ga0501038_0124279 3300049574 Bacteria 2125
308 Ga0501039_1588273 3300049575 Unclassified 502
309 Ga0501042_0069824 3300049578 Bacteria 2513
310 Ga0501043_0573523 3300049579 Bacteria 836
311 Ga0501070_0448962 3300049586 Unclassified 1040
312 Ga0501072_0072014 3300049588 Bacteria 2731
313 Ga0501073_1069564 3300049589 Bacteria 555
314 Ga0501075_0008293 3300049591 Bacteria 7244
315 Ga0501076_0109685 3300049592 Bacteria 2230
316 Ga0501077_0065467 3300049593 Bacteria 2304
317 Ga0501079_0049334 3300049741 Bacteria 3248
318 Ga0501079_0583329 3300049741 Unclassified 880
319 Ga0501079_1402171 3300049741 Bacteria 550
320 Ga0501080_0055557 3300049742 Bacteria 3688
321 Ga0501081_0001022 3300049743 Bacteria 16715
322 Ga0501045_0165459 3300049824 Bacteria 1647
323 nmdc:mga03683_10947_c1 3300050489 Unclassified 1975
324 nmdc:mga03683_134559_c1 3300050489 Bacteria 1108
325 nmdc:mga03683_1427_c1 3300050489 Bacteria 7127
326 nmdc:mga03683_33219_c1 3300050489 Bacteria 2080
327 nmdc:mga03683_454566_c1 3300050489 Unclassified 616
328 nmdc:mga03683_63358_c1 3300050489 Bacteria 1567
329 nmdc:mga03683_656746_c1 3300050489 Bacteria 516
330 nmdc:mga03683_85111_c1 3300050489 Bacteria 1371
331 nmdc:mga03n38_309591_c1 3300050490 Unclassified 850
332 nmdc:mga03n38_746600_c1 3300050490 Unclassified 567
333 nmdc:mga00v17_405176_c1 3300050491 Bacteria 886
334 nmdc:mga00v17_422036_c1 3300050491 Bacteria 866
335 nmdc:mga00v17_426050_c1 3300050491 Unclassified 862
336 nmdc:mga0yw44_1072330_c1 3300050492 Bacteria 545
337 nmdc:mga0yw44_208821_c1 3300050492 Bacteria 1291
338 nmdc:mga0yw44_427586_c1 3300050492 Unclassified 897
339 nmdc:mga0yw44_57980_c1 3300050492 Bacteria 2364
340 nmdc:mga0yw44_65651_c1 3300050492 Bacteria 2237
341 nmdc:mga0yw44_7483_c1 3300050492 Bacteria 5377
342 nmdc:mga0k408_13218_c1 3300050493 Bacteria 4524
343 nmdc:mga0k408_81268_c1 3300050493 Bacteria 1897
344 nmdc:mga0k408_95013_c1 3300050493 Bacteria 1753
345 nmdc:mga06z11_104702_c1 3300050494 Bacteria 1558
346 nmdc:mga06z11_200944_c1 3300050494 Bacteria 1158
347 nmdc:mga06z11_613239_c1 3300050494 Bacteria 662
348 nmdc:mga06z11_852842_c1 3300050494 Bacteria 555
349 nmdc:mga04h51_167893_c1 3300050495 Unclassified 848
350 nmdc:mga04h51_397860_c1 3300050495 Unclassified 576
351 nmdc:mga04h51_507806_c1 3300050495 Bacteria 516
352 nmdc:mga07m45_250472_c1 3300050496 Bacteria 1030
353 nmdc:mga07m45_72135_c3 3300050496 Bacteria 1162
354 nmdc:mga05p37_1523428_c1 3300050507 Unclassified 664
355 nmdc:mga05p37_322697_c1 3300050507 Bacteria 1827
356 nmdc:mga05p37_59637_c1 3300050507 Bacteria 4699
357 nmdc:mga06r32_1761595_c1 3300050510 Bacteria 555
358 nmdc:mga06r32_686899_c1 3300050510 Bacteria 990
359 nmdc:mga0n895_1434825_c1 3300050512 Bacteria 658
360 nmdc:mga0sz30_210_c1 3300050516 Bacteria 21966
361 nmdc:mga0sz30_230252_c1 3300050516 Unclassified 824
362 nmdc:mga0sz30_4251_c1 3300050516 Bacteria 5164
363 nmdc:mga0sz30_70500_c1 3300050516 Bacteria 1504
364 Ga0495601_0077391 3300053077 Bacteria 2130
365 Ga0495595_0065443 3300053084 Bacteria 1710
366 Ga0495619_0006829 3300053085 Bacteria 7214
367 Ga0500651_0473496 3300053093 Bacteria 694
368 Ga0500641_0002062 3300053096 Bacteria 7132
369 Ga0500618_075348 3300053125 Archaea 757
370 Ga0500619_119883 3300053154 Bacteria 896
371 Ga0500661_098830 3300055283 Unclassified 552
372 Ga0501082_0035693 3300060353 Bacteria 4285
373 Ga0501082_0593505 3300060353 Bacteria 969
374 Ga0501083_0755069
375 Ga0065712_10050776
376 Ga0070658_10006965
377 Ga0070690_100059931
378 Ga0070690_100448914
379 Ga0070690_101447326
380 Ga0068869_100680594
381 Ga0070666_10557412
382 Ga0070680_100000351
383 Ga0070660_100266734
384 Ga0070689_100173064
385 Ga0070691_10069969
386 Ga0070661_100397667
387 Ga0070692_10011701
388 Ga0070669_100060630
389 Ga0070675_101598299
390 Ga0070671_100024854
391 Ga0070674_101439404
392 Ga0070688_100063839
393 Ga0070709_10048804
394 Ga0070709_10174366
395 Ga0070709_10514995
396 Ga0070713_100377280
397 Ga0070701_10019764
398 Ga0070711_100054984
399 Ga0070705_100132233
400 Ga0070705_101452425
401 Ga0070700_100185276
402 Ga0070700_101739296
403 Ga0070694_100031344
404 Ga0070694_100500934
405 Ga0070694_100918163
406 Ga0070694_101831314
407 Ga0070708_100096492
408 Ga0070708_100707581
409 Ga0070678_100427201
410 Ga0070662_100859275
411 Ga0070681_10032607
412 Ga0070681_10389798
413 Ga0068867_100923213
414 Ga0070685_10461506
415 Ga0070706_100097525
416 Ga0070706_100442689
417 Ga0070706_101337357
418 Ga0070707_100001462
419 Ga0070707_101188018
420 Ga0070707_101359088
421 Ga0070698_100012921
422 Ga0070698_100506701
423 Ga0070698_100883768
424 Ga0070699_100045987
425 Ga0070699_100418506
426 Ga0070679_100100518
427 Ga0070679_101078074
428 Ga0070679_101644686
429 Ga0070697_100326512
430 Ga0070697_100939419
431 Ga0070697_101451354
432 Ga0070686_100795013
433 Ga0070695_100066861
434 Ga0070695_100751249
435 Ga0070696_100313270
436 Ga0070696_100753077
437 Ga0070665_100393419
438 Ga0070704_100027183
439 Ga0070704_100308441
440 Ga0070704_100372233
441 Ga0070704_100407498
442 Ga0068855_100210934
443 Ga0070664_100300400
444 Ga0068857_100135219
445 Ga0068856_100193759
446 Ga0070702_100291601
447 Ga0070702_100705389
448 Ga0068859_100237503
449 Ga0068859_101282037
450 Ga0068859_102074492
451 Ga0068859_102136425
452 Ga0068870_10236541
453 Ga0068870_11276602
454 Ga0068863_102024213
455 Ga0068858_100234780
456 Ga0068858_101767589
457 Ga0068862_100487244
458 Ga0081455_10000451
459 Ga0081455_10214816
460 Ga0081539_10006413
461 Ga0081539_10026691
462 Ga0070717_10135193
463 Ga0070717_10516372
464 Ga0070717_11328022
465 Ga0075365_10067980
466 Ga0075365_10107845
467 Ga0075365_10135950
468 Ga0075365_10144498
469 Ga0075365_10247671
470 Ga0075365_10499049
471 Ga0075365_10871294
472 Ga0075368_10100545
473 Ga0075368_10128908
474 Ga0075363_100234274
475 Ga0075363_100234592
476 Ga0075363_100302083
477 Ga0075364_10788978
478 Ga0070716_100333071
479 Ga0070712_100026458
480 Ga0070712_100895620
481 Ga0075362_10001553
482 Ga0075362_10008626
483 Ga0075362_10051949
484 Ga0075362_10052881
485 Ga0075362_10060689
486 Ga0075362_10071044
487 Ga0075362_10315667
488 Ga0075362_10460815
489 Ga0075367_10153237
490 Ga0075367_10164831
491 Ga0075367_10237566
492 Ga0075369_10001721
493 Ga0075369_10005135
494 Ga0075369_10015194
495 Ga0075366_10034312
496 Ga0075366_10188410
497 Ga0075370_10286493
498 Ga0075370_10504063
499 Ga0075428_100180186
500 Ga0075431_102192492
501 Ga0075433_10110257
502 Ga0075434_101579065
503 Ga0075434_102279524
504 Ga0075429_100134726
505 Ga0097620_100237504
506 Ga0097620_101281685
507 Ga0097620_102074348
508 Ga0097620_102136456
509 Ga0075435_100030269
510 Ga0099794_10297902
511 Ga0099794_10379551
512 Ga0099794_10470544
513 Ga0099795_10044299
514 Ga0099795_10412158
515 Ga0105240_10005297
516 Ga0111539_10133767
517 Ga0111539_12606458
518 Ga0105245_10578579
519 Ga0114129_10200184
520 Ga0114129_12085300
521 Ga0105243_10319291
522 Ga0105243_11149054
523 Ga0105243_11243976
524 Ga0105241_11327373
525 Ga0105241_12023371
526 Ga0105242_10087575
527 Ga0105248_10120487
528 Ga0105248_11673307
529 Ga0105248_13220320
530 Ga0105237_12148990
531 Ga0105238_10218220
532 Ga0105249_13240133
533 Ga0099796_10066013
534 Ga0099796_10083035
535 Ga0099796_10273013
536 Ga0105239_11552012
537 Ga0105239_12081875
538 Ga0105239_12699667
539 Ga0105246_11205083
540 Ga0157374_12887980
541 Ga0157378_11091091
542 Ga0163162_11961727
543 Ga0163162_12469387
544 Ga0157379_10198782
545 Ga0157379_10494417
546 Ga0182006_1103210
547 Ga0213872_10170465
548 Ga0213875_10003642
549 Ga0213871_10084477
550 Ga0207653_10010445
551 Ga0207692_10368523
552 Ga0207688_10200239
553 Ga0207680_10052616
554 Ga0207647_10451269
555 Ga0207699_10361255
556 Ga0207699_10474955
557 Ga0207699_10796025
558 Ga0207705_10030702
559 Ga0207684_10136400
560 Ga0207684_11217790
561 Ga0207654_10525871
562 Ga0207707_10048393
563 Ga0207707_10315420
564 Ga0207707_10433487
565 Ga0207695_10119026
566 Ga0207693_10075802
567 Ga0207693_11483604
568 Ga0207663_10496291
569 Ga0207660_10022106
570 Ga0207660_10199480
571 Ga0207660_10221567
572 Ga0207649_10780027
573 Ga0207652_10045697
574 Ga0207652_10739092
575 Ga0207652_11505904
576 Ga0207646_10012471
577 Ga0207646_10129603
578 Ga0207694_10552580
579 Ga0207650_10049022
580 Ga0207687_10081609
581 Ga0207687_11066466
582 Ga0207700_10012508
583 Ga0207700_10249440
584 Ga0207664_10357267
585 Ga0207664_11131619
586 Ga0207644_10055382
587 Ga0207644_10404873
588 Ga0207706_10470141
589 Ga0207686_10435143
590 Ga0207709_10066055
591 Ga0207709_10416204
592 Ga0207670_10042303
593 Ga0207670_10302297
594 Ga0207669_10352193
595 Ga0207665_10293729
596 Ga0207665_10410921
597 Ga0207711_10083162
598 Ga0207711_12087677
599 Ga0207689_10489759
600 Ga0207667_10462211
601 Ga0207667_10493655
602 Ga0207651_10950480
603 Ga0207668_11933262
604 Ga0207703_11145810
605 Ga0207703_12141287
606 Ga0207708_10032026
607 Ga0207708_10205225
608 Ga0207702_10020079
609 Ga0207702_10097218
610 Ga0207641_10293098
611 Ga0207641_11767074
612 Ga0207648_10036689
613 Ga0207648_10843378
614 Ga0207648_10977918
615 Ga0207648_11834448
616 Ga0207675_100961340
617 Ga0207683_10718216
618 Ga0207683_11905525
619 Ga0209813_10145798
620 Ga0209813_10219805
621 Ga0268266_11368425
622 Ga0268265_11667887
623 Ga0268264_10822184
624 Ga0265332_10304394
625 Ga0265325_10173948
626 Ga0265325_10374328
627 Ga0265340_10366226
628 Ga0307513_10913778
629 Ga0307411_10850442
630 Ga0373948_0221878
631 Ga0373934_0205606
632 Ga0373940_0106226
633 Ga0373944_0345972
634 Ga0373952_0058404
635 Ga0373932_0055391
636 Ga0373936_0142327
637 Ga0373956_0108750
638 Ga0373943_0228911
639 Ga0373943_0355679
640 Ga0373946_0184538
641 Ga0373946_0678554
642 Ga0373942_0325498
643 Ga0373931_0000964
644 Ga0373931_0058385
645 Ga0373931_0192316
646 Ga0373935_0857791
647 Ga0373927_0169876
648 Ga0373947_0146894
649 Ga0373947_0723935
650 Ga0373937_0296045
651 Ga0373925_0317810
652 Ga0373925_0387451
653 Ga0373925_1788703
654 Ga0436364_1029268
655 Ga0436365_0600217
656 Ga0436360_0823128
657 Ga0436360_1063915
658 Ga0436361_0685491
659 Ga0436363_0455970
660 Ga0439465_0048966
661 Ga0439441_043910
662 Ga0439435_0257737
663 Ga0439459_0160868
664 Ga0451577_0066829
665 Ga0439440_0139415
666 Ga0495592_0067682
667 Ga0495580_0162301
668 Ga0495618_0255679
669 Ga0495630_0787705
670 Ga0495599_0005907
671 Ga0495658_0163621
672 Ga0495600_0027819
673 Ga0495680_0306131
674 Ga0496101_1465643
675 Ga0496102_0014514
676 Ga0496103_0009163
677 Ga0496104_1724988
678 Ga0496107_0505644
679 Ga0496126_0043267
680 Ga0501038_0124279
681 Ga0501039_1588273
682 Ga0501042_0069824
683 Ga0501043_0573523
684 Ga0501070_0448962
685 Ga0501072_0072014
686 Ga0501073_1069564
687 Ga0501075_0008293
688 Ga0501076_0109685
689 Ga0501077_0065467
690 Ga0501079_0049334
691 Ga0501079_0583329
692 Ga0501079_1402171
693 Ga0501080_0055557
694 Ga0501081_0001022
695 Ga0501045_0165459
696 nmdc:mga03683_10947_c1
697 nmdc:mga03683_134559_c1
698 nmdc:mga03683_1427_c1
699 nmdc:mga03683_33219_c1
700 nmdc:mga03683_454566_c1
701 nmdc:mga03683_63358_c1
702 nmdc:mga03683_656746_c1
703 nmdc:mga03683_85111_c1
704 nmdc:mga03n38_309591_c1
705 nmdc:mga03n38_746600_c1
706 nmdc:mga00v17_405176_c1
707 nmdc:mga00v17_422036_c1
708 nmdc:mga00v17_426050_c1
709 nmdc:mga0yw44_1072330_c1
710 nmdc:mga0yw44_208821_c1
711 nmdc:mga0yw44_427586_c1
712 nmdc:mga0yw44_57980_c1
713 nmdc:mga0yw44_65651_c1
714 nmdc:mga0yw44_7483_c1
715 nmdc:mga0k408_13218_c1
716 nmdc:mga0k408_81268_c1
717 nmdc:mga0k408_95013_c1
718 nmdc:mga06z11_104702_c1
719 nmdc:mga06z11_200944_c1
720 nmdc:mga06z11_613239_c1
721 nmdc:mga06z11_852842_c1
722 nmdc:mga04h51_167893_c1
723 nmdc:mga04h51_397860_c1
724 nmdc:mga04h51_507806_c1
725 nmdc:mga07m45_250472_c1
726 nmdc:mga07m45_72135_c3
727 nmdc:mga05p37_1523428_c1
728 nmdc:mga05p37_322697_c1
729 nmdc:mga05p37_59637_c1
730 nmdc:mga06r32_1761595_c1
731 nmdc:mga06r32_686899_c1
732 nmdc:mga0n895_1434825_c1
733 nmdc:mga0sz30_210_c1
734 nmdc:mga0sz30_230252_c1
735 nmdc:mga0sz30_4251_c1
736 nmdc:mga0sz30_70500_c1
737 Ga0495601_0077391
738 Ga0495595_0065443
739 Ga0495619_0006829
740 Ga0500651_0473496
741 Ga0500641_0002062
742 Ga0500618_075348
743 Ga0500619_119883
744 Ga0500661_098830
745 Ga0501082_0035693
746 Ga0501082_0593505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09448

MmlI

Methylmuconolactone methyl-isomerase

15

123

0.93

PF07110

EthD

EthD domain

25

112

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ifx-assembly1.cif.gz_B crystal structure of a putative 4-methylmuconolactone methylisomerase (yp_295714.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.9285 2 105
3hfk-assembly1.cif.gz_A crystal structure of 4-methylmuconolactone methylisomerase (h52a) in complex with 4-methylmuconolactone 0.9097 1 107
3hf5-assembly2.cif.gz_C crystal structure of 4-methylmuconolactone methylisomerase in complex with 3-methylmuconolactone 0.9057 1 107
3hfk-assembly1.cif.gz_D crystal structure of 4-methylmuconolactone methylisomerase (h52a) in complex with 4-methylmuconolactone 0.901 2 107
2ifx-assembly1.cif.gz_A crystal structure of a putative 4-methylmuconolactone methylisomerase (yp_295714.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8859 2 105
ID Description Score Start End Superfamily
3hdsA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9122 1 104 3.30.70.100
2ifxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8841 1 104 3.30.70.100
2ifxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8743 1 104 3.30.70.100
3hdsA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8581 1 104 3.30.70.100
2ftrB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8324 3 106 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A521MBM1-F1-model_v4 EthD family reductase 0.9839 1 110 GO:0016491
AF-A0A537S313-F1-model_v4 EthD family reductase 0.9828 24 110 GO:0016491
AF-A0A2V6PDC1-F1-model_v4 EthD family reductase 0.9775 1 109 GO:0016491
AF-A0A521MBM1-F1-model_v4 EthD family reductase 0.9751 1 110 GO:0016491
AF-A0A2V6PDC1-F1-model_v4 EthD family reductase 0.9688 1 109 GO:0016491

Map