F426465

General Info

Members Datasets Scaffolds Average Seq Length
373 244 746 298

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0015074|Ga0495618_0015074_879_1886
Length 335
Sequence MKFASLVQNRKALIGLILFGITALVGIFPGLFASKADADTIGAFSPNLGVSTAHLLGTTSYGQDIFSQLVFGARQVLVIALVAGAFATVLAVLIGITAAYMGGIVDEVLSLFTNVVLILPTFPLMIILARYAGTSNWVMIIVLVVTGWSYGANQMRAQALSLRNRDFLEAARVRGERRSYIILFEMMPTMTSLIVANFLGSALYSVLAASGLQFIGLGDKTSDSWGTMLYWADSQEALQAGNALWIIAPGLAIAVLSAAFALMNYAFDEIGNPALRPVRRKDLRKARKADAEAQRGAEHVYCLSRCLIRPSRCWTCGICGSSTTRRVARWRRVPG

Samples

Sample ID Description Type Environment
1 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.8
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 5.9
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495618_0015074 3300046514 Bacteria 4715
2 JGI24752J21851_1002148 3300001976 Bacteria 2633
3 JGI24740J21852_10013421 3300001979 Bacteria 3056
4 JGI24739J22299_10000936 3300001989 Bacteria 10868
5 JGI24751J29686_10001163 3300002459 Bacteria 5628
6 rootH2_10024901 3300003320 Bacteria 5117
7 Ga0055540_1001492 3300003792 Bacteria 13904
8 Ga0070658_10002248 3300005327 Bacteria 16196
9 Ga0070658_10037938 3300005327 Bacteria 3885
10 Ga0070658_10042503 3300005327 Bacteria 3671
11 Ga0068869_100080091 3300005334 Bacteria 2435
12 Ga0070680_100003841 3300005336 Bacteria 11228
13 Ga0068868_100009852 3300005338 Bacteria 6899
14 Ga0070660_100006399 3300005339 Bacteria 8164
15 Ga0070691_10002949 3300005341 Bacteria 7627
16 Ga0070661_100022644 3300005344 Bacteria 4499
17 Ga0070692_10001488 3300005345 Bacteria 8550
18 Ga0070668_100162654 3300005347 Bacteria 1812
19 Ga0070675_100013299 3300005354 Bacteria 6467
20 Ga0070671_100103133 3300005355 Bacteria 2393
21 Ga0070673_100008420 3300005364 Bacteria 6858
22 Ga0070659_100005968 3300005366 Bacteria 8782
23 Ga0070667_100128205 3300005367 Bacteria 2213
24 Ga0070709_10185763 3300005434 Bacteria 1463
25 Ga0070714_100007089 3300005435 Bacteria 8692
26 Ga0070713_100004044 3300005436 Bacteria 9769
27 Ga0070713_100125388 3300005436 Bacteria 2258
28 Ga0070701_10095939 3300005438 Bacteria 1634
29 Ga0070711_100029896 3300005439 Bacteria 3601
30 Ga0070663_100012554 3300005455 Bacteria 5364
31 Ga0070662_100339384 3300005457 Bacteria 1229
32 Ga0070681_10437439 3300005458 Bacteria 1220
33 Ga0070706_100000400 3300005467 Bacteria 52368
34 Ga0070706_100122025 3300005467 Bacteria 2429
35 Ga0070706_100292530 3300005467 Bacteria 1520
36 Ga0070707_100024348 3300005468 Bacteria 5733
37 Ga0070698_100103518 3300005471 Bacteria 2817
38 Ga0070699_100267580 3300005518 Bacteria 1529
39 Ga0070679_100010266 3300005530 Bacteria 8877
40 Ga0070679_100016122 3300005530 Bacteria 7199
41 Ga0070679_100091820 3300005530 Bacteria 3024
42 Ga0068853_100078072 3300005539 Bacteria 2893
43 Ga0068853_100213900 3300005539 Bacteria 1758
44 Ga0070686_100112790 3300005544 Bacteria 1855
45 Ga0070693_100002658 3300005547 Bacteria 8229
46 Ga0070665_100010846 3300005548 Bacteria 9216
47 Ga0070704_100189156 3300005549 Bacteria 1653
48 Ga0068855_100002594 3300005563 Bacteria 22270
49 Ga0068855_100005004 3300005563 Bacteria 16171
50 Ga0068855_100012152 3300005563 Bacteria 10404
51 Ga0068855_100134281 3300005563 Bacteria 2824
52 Ga0068855_100387891 3300005563 Bacteria 1533
53 Ga0068857_100248912 3300005577 Bacteria 1629
54 Ga0068854_100002542 3300005578 Bacteria 11293
55 Ga0068854_100073178 3300005578 Bacteria 2511
56 Ga0068856_100012979 3300005614 Bacteria 8067
57 Ga0068856_100013286 3300005614 Bacteria 7975
58 Ga0068852_100004937 3300005616 Bacteria 9472
59 Ga0068852_100109928 3300005616 Bacteria 2504
60 Ga0068859_100052159 3300005617 Bacteria 4112
61 Ga0068864_100043428 3300005618 Bacteria 3849
62 Ga0068864_100128638 3300005618 Bacteria 2272
63 Ga0068861_100175835 3300005719 Bacteria 1778
64 Ga0068851_10135338 3300005834 Bacteria 1336
65 Ga0068870_10000206 3300005840 Bacteria 21149
66 Ga0068863_100170175 3300005841 Bacteria 2089
67 Ga0068863_100176671 3300005841 Bacteria 2049
68 Ga0068858_100025174 3300005842 Bacteria 5537
69 Ga0068858_100594090 3300005842 Bacteria 1073
70 Ga0081455_10011020 3300005937 Bacteria 9105
71 Ga0081455_10078961 3300005937 Bacteria 2703
72 Ga0081540_1011090 3300005983 Bacteria 6050
73 Ga0070717_10053784 3300006028 Bacteria 3319
74 Ga0097621_100007330 3300006237 Bacteria 7883
75 Ga0068871_100008339 3300006358 Bacteria 7450
76 Ga0075433_10006126 3300006852 Bacteria 9472
77 Ga0075434_100005408 3300006871 Bacteria 11620
78 Ga0075436_100000490 3300006914 Bacteria 25561
79 Ga0097620_100052159 3300006931 Bacteria 4112
80 Ga0075435_100000491 3300007076 Bacteria 24044
81 Ga0105240_10010252 3300009093 Bacteria 13190
82 Ga0105240_10018132 3300009093 Bacteria 9463
83 Ga0105240_10087504 3300009093 Bacteria 3815
84 Ga0105240_10091504 3300009093 Bacteria 3716
85 Ga0111539_10006134 3300009094 Bacteria 15519
86 Ga0105245_10010100 3300009098 Bacteria 8224
87 Ga0105247_10015340 3300009101 Bacteria 4590
88 Ga0105241_10003469 3300009174 Bacteria 11734
89 Ga0105241_10006616 3300009174 Bacteria 8539
90 Ga0105248_10119344 3300009177 Bacteria 2975
91 Ga0105237_10026178 3300009545 Bacteria 5962
92 Ga0105237_10042340 3300009545 Bacteria 4593
93 Ga0105238_10002739 3300009551 Bacteria 17556
94 Ga0105238_10031540 3300009551 Bacteria 5396
95 Ga0105249_10782320 3300009553 Bacteria 1018
96 Ga0105239_10040701 3300010375 Bacteria 5092
97 Ga0105246_10001215 3300011119 Bacteria 15095
98 Ga0157371_10062700 3300013102 Bacteria 2635
99 Ga0157370_10006967 3300013104 Bacteria 12345
100 Ga0157370_10014083 3300013104 Bacteria 8204
101 Ga0157370_10394172 3300013104 Bacteria 1275
102 Ga0157369_10010186 3300013105 Bacteria 10726
103 Ga0157369_10018418 3300013105 Bacteria 7830
104 Ga0157369_10286606 3300013105 Bacteria 1715
105 Ga0157374_10009748 3300013296 Bacteria 8246
106 Ga0157372_10011766 3300013307 Bacteria 9319
107 Ga0157372_10060447 3300013307 Bacteria 4240
108 Ga0157372_10160972 3300013307 Bacteria 2594
109 Ga0157372_10161785 3300013307 Bacteria 2587
110 Ga0157375_10576387 3300013308 Bacteria 1286
111 Ga0163163_10160768 3300014325 Bacteria 2291
112 Ga0157377_10005230 3300014745 Bacteria 6076
113 Ga0157377_10054214 3300014745 Bacteria 2269
114 Ga0157379_10049331 3300014968 Bacteria 3758
115 Ga0157376_10049939 3300014969 Bacteria 3468
116 Ga0157376_10316732 3300014969 Bacteria 1482
117 Ga0206356_11870205 3300020070 Bacteria 2489
118 Ga0206354_10109562 3300020081 Bacteria 3494
119 Ga0206353_10123281 3300020082 Bacteria 5671
120 Ga0213875_10001053 3300021388 Bacteria 19406
121 Ga0209051_1003334 3300025303 Bacteria 10614
122 Ga0207656_10006016 3300025321 Bacteria 4338
123 Ga0207710_10007632 3300025900 Bacteria 4576
124 Ga0207688_10002927 3300025901 Bacteria 9280
125 Ga0207647_10004918 3300025904 Bacteria 9854
126 Ga0207647_10108975 3300025904 Bacteria 1638
127 Ga0207647_10115699 3300025904 Bacteria 1583
128 Ga0207699_10007023 3300025906 Bacteria 5485
129 Ga0207645_10020923 3300025907 Bacteria 4274
130 Ga0207643_10000816 3300025908 Bacteria 18940
131 Ga0207705_10012126 3300025909 Bacteria 6230
132 Ga0207705_10044155 3300025909 Bacteria 3203
133 Ga0207705_10053893 3300025909 Bacteria 2898
134 Ga0207684_10001109 3300025910 Bacteria 30110
135 Ga0207684_10080375 3300025910 Bacteria 2773
136 Ga0207684_10228198 3300025910 Bacteria 1607
137 Ga0207654_10005779 3300025911 Bacteria 6246
138 Ga0207707_10361353 3300025912 Bacteria 1250
139 Ga0207695_10001306 3300025913 Bacteria 42341
140 Ga0207695_10033487 3300025913 Bacteria 5602
141 Ga0207695_10381716 3300025913 Bacteria 1295
142 Ga0207671_10000970 3300025914 Bacteria 35528
143 Ga0207671_10070622 3300025914 Bacteria 2604
144 Ga0207693_10220136 3300025915 Bacteria 1491
145 Ga0207660_10009296 3300025917 Bacteria 6364
146 Ga0207657_10008273 3300025919 Bacteria 10588
147 Ga0207649_10008895 3300025920 Bacteria 5484
148 Ga0207652_10014129 3300025921 Bacteria 6464
149 Ga0207652_10029837 3300025921 Bacteria 4564
150 Ga0207652_10037427 3300025921 Bacteria 4107
151 Ga0207646_10012214 3300025922 Bacteria 8263
152 Ga0207694_10002442 3300025924 Bacteria 15147
153 Ga0207694_10011791 3300025924 Bacteria 6594
154 Ga0207650_10009680 3300025925 Bacteria 6588
155 Ga0207650_10102015 3300025925 Bacteria 2210
156 Ga0207659_10002300 3300025926 Bacteria 11379
157 Ga0207687_10032208 3300025927 Bacteria 3549
158 Ga0207700_10005422 3300025928 Bacteria 7630
159 Ga0207664_10001906 3300025929 Bacteria 13698
160 Ga0207691_10445591 3300025940 Bacteria 1102
161 Ga0207711_10038327 3300025941 Bacteria 4075
162 Ga0207689_10084403 3300025942 Bacteria 2611
163 Ga0207689_10165965 3300025942 Bacteria 1819
164 Ga0207661_10050437 3300025944 Bacteria 3316
165 Ga0207679_10013112 3300025945 Bacteria 5427
166 Ga0207667_10033476 3300025949 Bacteria 5524
167 Ga0207651_10029045 3300025960 Bacteria 3498
168 Ga0207712_10157360 3300025961 Bacteria 1761
169 Ga0207668_10034546 3300025972 Bacteria 3359
170 Ga0207640_10004331 3300025981 Bacteria 7688
171 Ga0207640_10014924 3300025981 Bacteria 4484
172 Ga0207658_10222712 3300025986 Bacteria 1588
173 Ga0207677_10003273 3300026023 Bacteria 8556
174 Ga0207703_10066964 3300026035 Bacteria 2955
175 Ga0207639_10162472 3300026041 Bacteria 1883
176 Ga0207639_10199795 3300026041 Bacteria 1714
177 Ga0207678_10003464 3300026067 Bacteria 14200
178 Ga0207708_10074529 3300026075 Bacteria 2601
179 Ga0207702_10002143 3300026078 Bacteria 18963
180 Ga0207702_10009643 3300026078 Bacteria 8106
181 Ga0207702_10038741 3300026078 Bacteria 3992
182 Ga0207702_10203205 3300026078 Bacteria 1838
183 Ga0207641_10015123 3300026088 Bacteria 6323
184 Ga0207641_10131180 3300026088 Bacteria 2251
185 Ga0207676_10002108 3300026095 Bacteria 14407
186 Ga0207674_10118586 3300026116 Bacteria 2616
187 Ga0207674_10239981 3300026116 Bacteria 1759
188 Ga0207675_100026066 3300026118 Bacteria 5441
189 Ga0207683_10000446 3300026121 Bacteria 38241
190 Ga0207698_10039974 3300026142 Bacteria 3479
191 Ga0207698_10060692 3300026142 Bacteria 2942
192 Ga0207428_10002274 3300027907 Bacteria 19270
193 Ga0307517_10134587 3300028786 Bacteria 1763
194 Ga0265338_10040707 3300028800 Bacteria 4359
195 Ga0265338_10069257 3300028800 Bacteria 3032
196 Ga0265338_10116454 3300028800 Bacteria 2141
197 Ga0307511_10073983 3300030521 Bacteria 2459
198 Ga0265325_10007012 3300031241 Bacteria 6791
199 Ga0265340_10015011 3300031247 Bacteria 4034
200 Ga0265339_10060075 3300031249 Bacteria 2049
201 Ga0265339_10097861 3300031249 Bacteria 1530
202 Ga0265316_10103139 3300031344 Bacteria 2166
203 Ga0307509_10014108 3300031507 Bacteria 9423
204 Ga0307509_10041583 3300031507 Bacteria 4987
205 Ga0307508_10007971 3300031616 Bacteria 9823
206 Ga0307508_10085136 3300031616 Bacteria 2744
207 Ga0265314_10030389 3300031711 Bacteria 3999
208 Ga0265314_10063301 3300031711 Bacteria 2510
209 Ga0265342_10026997 3300031712 Bacteria 3594
210 Ga0307518_10105562 3300031838 Bacteria 2012
211 Ga0373934_0044563 3300035086 Bacteria 1753
212 Ga0373923_0042348 3300035111 Bacteria 1880
213 Ga0373953_0000423 3300035117 Bacteria 11519
214 Ga0373956_0067234 3300035119 Bacteria 1631
215 Ga0373957_0002041 3300035120 Bacteria 5655
216 Ga0373955_0003724 3300035172 Bacteria 6713
217 Ga0373924_0016378 3300035410 Bacteria 2828
218 Ga0373933_0035432 3300035724 Bacteria 2914
219 Ga0373937_0114760 3300036401 Bacteria 2507
220 Ga0395899_0060226 3300037312 Bacteria 2797
221 Ga0395900_0041472 3300037418 Bacteria 4745
222 Ga0436364_0331782 3300037853 Bacteria 57289
223 Ga0436364_1548394 3300037853 Bacteria 98245
224 Ga0395901_0428298 3300038443 Bacteria 1356
225 Ga0439448_0011385 3300042005 Bacteria 2651
226 Ga0439459_0006988 3300042438 Bacteria 1895
227 Ga0466969_0013417 3300044656 Bacteria 4314
228 Ga0466969_0052240 3300044656 Bacteria 2008
229 Ga0466966_0005133 3300044684 Bacteria 8603
230 Ga0466966_0009028 3300044684 Bacteria 6606
231 Ga0466966_0025230 3300044684 Bacteria 3884
232 Ga0466961_0003109 3300044693 Bacteria 10334
233 Ga0466961_0144732 3300044693 Bacteria 1487
234 Ga0466961_0181048 3300044693 Bacteria 1308
235 Ga0466963_0043138 3300044694 Bacteria 2964
236 Ga0466963_0046944 3300044694 Bacteria 2849
237 Ga0466971_0000661 3300044719 Bacteria 13719
238 Ga0466957_0034387 3300044842 Bacteria 3041
239 Ga0466957_0282070 3300044842 Bacteria 1112
240 Ga0466959_0001596 3300045049 Bacteria 13982
241 Ga0466959_0003066 3300045049 Bacteria 10818
242 Ga0466958_0023558 3300045836 Bacteria 3615
243 Ga0466958_0026875 3300045836 Bacteria 3402
244 Ga0466958_0029794 3300045836 Bacteria 3239
245 Ga0466958_0074543 3300045836 Bacteria 2080
246 Ga0466967_0000744 3300045976 Bacteria 16732
247 Ga0466967_0000876 3300045976 Bacteria 16017
248 Ga0466967_0006476 3300045976 Bacteria 8294
249 Ga0466967_0051836 3300045976 Bacteria 3599
250 Ga0466967_0060211 3300045976 Bacteria 3364
251 Ga0466967_0192661 3300045976 Bacteria 1927
252 Ga0466967_0412019 3300045976 Bacteria 1316
253 Ga0495592_0014493 3300046454 Bacteria 5983
254 Ga0495592_0099896 3300046454 Bacteria 2069
255 Ga0495603_0011267 3300046455 Bacteria 5418
256 Ga0495629_0030302 3300046459 Bacteria 3837
257 Ga0495629_0111097 3300046459 Bacteria 1911
258 Ga0495651_0001059 3300046462 Bacteria 21248
259 Ga0495651_0004623 3300046462 Bacteria 10524
260 Ga0495651_0019145 3300046462 Bacteria 5304
261 Ga0495651_0139168 3300046462 Bacteria 1762
262 Ga0495653_0006860 3300046463 Bacteria 9355
263 Ga0495653_0014002 3300046463 Bacteria 6540
264 Ga0495653_0014006 3300046463 Bacteria 6539
265 Ga0495580_0032221 3300046472 Bacteria 3784
266 Ga0495662_0011070 3300046476 Bacteria 4409
267 Ga0495664_0005036 3300046477 Bacteria 7236
268 Ga0495664_0031484 3300046477 Bacteria 3110
269 Ga0495585_0017747 3300046492 Bacteria 4109
270 Ga0495607_0084482 3300046501 Bacteria 1736
271 Ga0495606_0073176 3300046507 Bacteria 2151
272 Ga0495608_0001470 3300046511 Bacteria 16742
273 Ga0495608_0009048 3300046511 Bacteria 6967
274 Ga0495618_0075744 3300046514 Bacteria 2143
275 Ga0495628_0003366 3300046516 Bacteria 14295
276 Ga0495628_0017230 3300046516 Bacteria 6015
277 Ga0495628_0116150 3300046516 Bacteria 2055
278 Ga0495630_0053026 3300046517 Bacteria 3036
279 Ga0495630_0104020 3300046517 Bacteria 2148
280 Ga0495666_0044036 3300046526 Bacteria 2155
281 Ga0495652_0001619 3300046529 Bacteria 24580
282 Ga0495652_0008945 3300046529 Bacteria 9113
283 Ga0495652_0019661 3300046529 Bacteria 6012
284 Ga0495665_0046631 3300046531 Bacteria 2300
285 Ga0495640_0016404 3300046533 Bacteria 5541
286 Ga0495640_0037028 3300046533 Bacteria 3444
287 Ga0495587_0012800 3300046536 Bacteria 5277
288 Ga0495645_0000732 3300046543 Bacteria 22436
289 Ga0495645_0012475 3300046543 Bacteria 5988
290 Ga0495645_0053534 3300046543 Bacteria 2933
291 Ga0495667_0010525 3300046559 Bacteria 6258
292 Ga0495667_0081740 3300046559 Bacteria 2099
293 Ga0495634_0024330 3300046642 Bacteria 4249
294 Ga0495634_0130089 3300046642 Bacteria 1605
295 Ga0495625_0120572 3300046660 Bacteria 1785
296 Ga0495635_0001464 3300046663 Bacteria 15788
297 Ga0495635_0001507 3300046663 Bacteria 15611
298 Ga0495657_0009048 3300046675 Bacteria 7572
299 Ga0495657_0012817 3300046675 Bacteria 6214
300 Ga0495657_0063380 3300046675 Bacteria 2439
301 Ga0495599_0009154 3300046678 Bacteria 6040
302 Ga0495599_0055513 3300046678 Bacteria 2480
303 Ga0495623_0108829 3300046679 Bacteria 1681
304 Ga0495646_0010666 3300046680 Bacteria 5837
305 Ga0495646_0029750 3300046680 Bacteria 3412
306 Ga0495613_0047893 3300046689 Bacteria 3157
307 Ga0495670_0091856 3300046691 Bacteria 1554
308 Ga0495589_0017900 3300046794 Bacteria 3634
309 Ga0495600_0008011 3300046809 Bacteria 6476
310 Ga0495600_0017105 3300046809 Bacteria 4610
311 Ga0495600_0034124 3300046809 Bacteria 3303
312 Ga0495600_0111677 3300046809 Bacteria 1779
313 Ga0495581_0020225 3300047315 Bacteria 3864
314 Ga0495604_0001000 3300047317 Bacteria 23520
315 Ga0495604_0034631 3300047317 Bacteria 3994
316 Ga0495604_0061992 3300047317 Bacteria 2859
317 Ga0495674_0016193 3300047319 Bacteria 6955
318 Ga0495674_0158246 3300047319 Bacteria 1896
319 Ga0495680_0125340 3300047322 Bacteria 1892
320 Ga0495683_0041916 3300047323 Bacteria 2309
321 Ga0495675_0071796 3300047444 Bacteria 2184
322 Ga0495684_0010544 3300047471 Bacteria 7143
323 Ga0495684_0130901 3300047471 Bacteria 1884
324 Ga0495686_0024203 3300047472 Bacteria 3993
325 Ga0495602_0076764 3300048088 Bacteria 2829
326 Ga0496100_0006848 3300048903 Bacteria 6244
327 Ga0496102_0000319 3300048905 Bacteria 60314
328 Ga0496102_0015079 3300048905 Bacteria 6728
329 Ga0496103_0038447 3300048906 Bacteria 2936
330 Ga0496104_0007131 3300048907 Bacteria 9853
331 Ga0496105_0002982 3300048908 Bacteria 12442
332 Ga0496105_0035268 3300048908 Bacteria 4117
333 Ga0496106_0013020 3300048909 Bacteria 6137
334 Ga0496108_0004925 3300048911 Bacteria 10785
335 Ga0496108_0013116 3300048911 Bacteria 6756
336 Ga0496108_0039190 3300048911 Bacteria 3950
337 Ga0496109_0010642 3300048912 Bacteria 7867
338 Ga0496109_0016368 3300048912 Bacteria 6482
339 Ga0496109_0092376 3300048912 Bacteria 2799
340 Ga0496110_0003418 3300048913 Bacteria 12144
341 Ga0496111_0000654 3300048914 Bacteria 18257
342 Ga0496112_0111419 3300048915 Bacteria 2706
343 Ga0496112_0153944 3300048915 Bacteria 2266
344 Ga0496112_0304659 3300048915 Bacteria 1538
345 Ga0496113_0002535 3300048916 Bacteria 10647
346 Ga0496113_0004740 3300048916 Bacteria 8395
347 Ga0496113_0085305 3300048916 Bacteria 2426
348 Ga0496119_0050878 3300048922 Bacteria 2550
349 Ga0501042_0048789 3300049578 Bacteria 3019
350 Ga0501069_0006545 3300049585 Bacteria 6093
351 Ga0501070_0003626 3300049586 Bacteria 13335
352 Ga0501073_0315223 3300049589 Bacteria 1079
353 Ga0501080_0046707 3300049742 Bacteria 4031
354 Ga0501044_0068861 3300049823 Bacteria 3604
355 nmdc:mga08y16_65083_c1 3300050511 Bacteria 3806
356 nmdc:mga0n895_12207_c1 3300050512 Bacteria 7697
357 nmdc:mga0rr50_1297_c1 3300050513 Bacteria 13631
358 nmdc:mga08x19_3218_c1 3300050514 Bacteria 9792
359 nmdc:mga0a205_15078_c1 3300050515 Bacteria 7217
360 Ga0495601_0001254 3300053077 Bacteria 13909
361 Ga0495601_0010450 3300053077 Bacteria 5524
362 Ga0495601_0034254 3300053077 Bacteria 3167
363 Ga0495612_0001755 3300053078 Bacteria 8884
364 Ga0495612_0003851 3300053078 Bacteria 6228
365 Ga0495595_0064554 3300053084 Bacteria 1721
366 Ga0495619_0165333 3300053085 Bacteria 1529
367 Ga0500559_0025346 3300053136 Bacteria 2523
368 Ga0466962_0001104 3300061719 Bacteria 12420
369 Ga0466962_0039043 3300061719 Bacteria 2274
370 Ga0466962_0065500 3300061719 Bacteria 1735
371 Ga0466962_0106427 3300061719 Bacteria 1349
372 Ga0466962_0156854 3300061719 Bacteria 1106
373 2902797587 2902792274 Bacteria 7270173
374 Ga0495618_0015074
375 JGI24752J21851_1002148
376 JGI24740J21852_10013421
377 JGI24739J22299_10000936
378 JGI24751J29686_10001163
379 rootH2_10024901
380 Ga0055540_1001492
381 Ga0070658_10002248
382 Ga0070658_10037938
383 Ga0070658_10042503
384 Ga0068869_100080091
385 Ga0070680_100003841
386 Ga0068868_100009852
387 Ga0070660_100006399
388 Ga0070691_10002949
389 Ga0070661_100022644
390 Ga0070692_10001488
391 Ga0070668_100162654
392 Ga0070675_100013299
393 Ga0070671_100103133
394 Ga0070673_100008420
395 Ga0070659_100005968
396 Ga0070667_100128205
397 Ga0070709_10185763
398 Ga0070714_100007089
399 Ga0070713_100004044
400 Ga0070713_100125388
401 Ga0070701_10095939
402 Ga0070711_100029896
403 Ga0070663_100012554
404 Ga0070662_100339384
405 Ga0070681_10437439
406 Ga0070706_100000400
407 Ga0070706_100122025
408 Ga0070706_100292530
409 Ga0070707_100024348
410 Ga0070698_100103518
411 Ga0070699_100267580
412 Ga0070679_100010266
413 Ga0070679_100016122
414 Ga0070679_100091820
415 Ga0068853_100078072
416 Ga0068853_100213900
417 Ga0070686_100112790
418 Ga0070693_100002658
419 Ga0070665_100010846
420 Ga0070704_100189156
421 Ga0068855_100002594
422 Ga0068855_100005004
423 Ga0068855_100012152
424 Ga0068855_100134281
425 Ga0068855_100387891
426 Ga0068857_100248912
427 Ga0068854_100002542
428 Ga0068854_100073178
429 Ga0068856_100012979
430 Ga0068856_100013286
431 Ga0068852_100004937
432 Ga0068852_100109928
433 Ga0068859_100052159
434 Ga0068864_100043428
435 Ga0068864_100128638
436 Ga0068861_100175835
437 Ga0068851_10135338
438 Ga0068870_10000206
439 Ga0068863_100170175
440 Ga0068863_100176671
441 Ga0068858_100025174
442 Ga0068858_100594090
443 Ga0081455_10011020
444 Ga0081455_10078961
445 Ga0081540_1011090
446 Ga0070717_10053784
447 Ga0097621_100007330
448 Ga0068871_100008339
449 Ga0075433_10006126
450 Ga0075434_100005408
451 Ga0075436_100000490
452 Ga0097620_100052159
453 Ga0075435_100000491
454 Ga0105240_10010252
455 Ga0105240_10018132
456 Ga0105240_10087504
457 Ga0105240_10091504
458 Ga0111539_10006134
459 Ga0105245_10010100
460 Ga0105247_10015340
461 Ga0105241_10003469
462 Ga0105241_10006616
463 Ga0105248_10119344
464 Ga0105237_10026178
465 Ga0105237_10042340
466 Ga0105238_10002739
467 Ga0105238_10031540
468 Ga0105249_10782320
469 Ga0105239_10040701
470 Ga0105246_10001215
471 Ga0157371_10062700
472 Ga0157370_10006967
473 Ga0157370_10014083
474 Ga0157370_10394172
475 Ga0157369_10010186
476 Ga0157369_10018418
477 Ga0157369_10286606
478 Ga0157374_10009748
479 Ga0157372_10011766
480 Ga0157372_10060447
481 Ga0157372_10160972
482 Ga0157372_10161785
483 Ga0157375_10576387
484 Ga0163163_10160768
485 Ga0157377_10005230
486 Ga0157377_10054214
487 Ga0157379_10049331
488 Ga0157376_10049939
489 Ga0157376_10316732
490 Ga0206356_11870205
491 Ga0206354_10109562
492 Ga0206353_10123281
493 Ga0213875_10001053
494 Ga0209051_1003334
495 Ga0207656_10006016
496 Ga0207710_10007632
497 Ga0207688_10002927
498 Ga0207647_10004918
499 Ga0207647_10108975
500 Ga0207647_10115699
501 Ga0207699_10007023
502 Ga0207645_10020923
503 Ga0207643_10000816
504 Ga0207705_10012126
505 Ga0207705_10044155
506 Ga0207705_10053893
507 Ga0207684_10001109
508 Ga0207684_10080375
509 Ga0207684_10228198
510 Ga0207654_10005779
511 Ga0207707_10361353
512 Ga0207695_10001306
513 Ga0207695_10033487
514 Ga0207695_10381716
515 Ga0207671_10000970
516 Ga0207671_10070622
517 Ga0207693_10220136
518 Ga0207660_10009296
519 Ga0207657_10008273
520 Ga0207649_10008895
521 Ga0207652_10014129
522 Ga0207652_10029837
523 Ga0207652_10037427
524 Ga0207646_10012214
525 Ga0207694_10002442
526 Ga0207694_10011791
527 Ga0207650_10009680
528 Ga0207650_10102015
529 Ga0207659_10002300
530 Ga0207687_10032208
531 Ga0207700_10005422
532 Ga0207664_10001906
533 Ga0207691_10445591
534 Ga0207711_10038327
535 Ga0207689_10084403
536 Ga0207689_10165965
537 Ga0207661_10050437
538 Ga0207679_10013112
539 Ga0207667_10033476
540 Ga0207651_10029045
541 Ga0207712_10157360
542 Ga0207668_10034546
543 Ga0207640_10004331
544 Ga0207640_10014924
545 Ga0207658_10222712
546 Ga0207677_10003273
547 Ga0207703_10066964
548 Ga0207639_10162472
549 Ga0207639_10199795
550 Ga0207678_10003464
551 Ga0207708_10074529
552 Ga0207702_10002143
553 Ga0207702_10009643
554 Ga0207702_10038741
555 Ga0207702_10203205
556 Ga0207641_10015123
557 Ga0207641_10131180
558 Ga0207676_10002108
559 Ga0207674_10118586
560 Ga0207674_10239981
561 Ga0207675_100026066
562 Ga0207683_10000446
563 Ga0207698_10039974
564 Ga0207698_10060692
565 Ga0207428_10002274
566 Ga0307517_10134587
567 Ga0265338_10040707
568 Ga0265338_10069257
569 Ga0265338_10116454
570 Ga0307511_10073983
571 Ga0265325_10007012
572 Ga0265340_10015011
573 Ga0265339_10060075
574 Ga0265339_10097861
575 Ga0265316_10103139
576 Ga0307509_10014108
577 Ga0307509_10041583
578 Ga0307508_10007971
579 Ga0307508_10085136
580 Ga0265314_10030389
581 Ga0265314_10063301
582 Ga0265342_10026997
583 Ga0307518_10105562
584 Ga0373934_0044563
585 Ga0373923_0042348
586 Ga0373953_0000423
587 Ga0373956_0067234
588 Ga0373957_0002041
589 Ga0373955_0003724
590 Ga0373924_0016378
591 Ga0373933_0035432
592 Ga0373937_0114760
593 Ga0395899_0060226
594 Ga0395900_0041472
595 Ga0436364_0331782
596 Ga0436364_1548394
597 Ga0395901_0428298
598 Ga0439448_0011385
599 Ga0439459_0006988
600 Ga0466969_0013417
601 Ga0466969_0052240
602 Ga0466966_0005133
603 Ga0466966_0009028
604 Ga0466966_0025230
605 Ga0466961_0003109
606 Ga0466961_0144732
607 Ga0466961_0181048
608 Ga0466963_0043138
609 Ga0466963_0046944
610 Ga0466971_0000661
611 Ga0466957_0034387
612 Ga0466957_0282070
613 Ga0466959_0001596
614 Ga0466959_0003066
615 Ga0466958_0023558
616 Ga0466958_0026875
617 Ga0466958_0029794
618 Ga0466958_0074543
619 Ga0466967_0000744
620 Ga0466967_0000876
621 Ga0466967_0006476
622 Ga0466967_0051836
623 Ga0466967_0060211
624 Ga0466967_0192661
625 Ga0466967_0412019
626 Ga0495592_0014493
627 Ga0495592_0099896
628 Ga0495603_0011267
629 Ga0495629_0030302
630 Ga0495629_0111097
631 Ga0495651_0001059
632 Ga0495651_0004623
633 Ga0495651_0019145
634 Ga0495651_0139168
635 Ga0495653_0006860
636 Ga0495653_0014002
637 Ga0495653_0014006
638 Ga0495580_0032221
639 Ga0495662_0011070
640 Ga0495664_0005036
641 Ga0495664_0031484
642 Ga0495585_0017747
643 Ga0495607_0084482
644 Ga0495606_0073176
645 Ga0495608_0001470
646 Ga0495608_0009048
647 Ga0495618_0075744
648 Ga0495628_0003366
649 Ga0495628_0017230
650 Ga0495628_0116150
651 Ga0495630_0053026
652 Ga0495630_0104020
653 Ga0495666_0044036
654 Ga0495652_0001619
655 Ga0495652_0008945
656 Ga0495652_0019661
657 Ga0495665_0046631
658 Ga0495640_0016404
659 Ga0495640_0037028
660 Ga0495587_0012800
661 Ga0495645_0000732
662 Ga0495645_0012475
663 Ga0495645_0053534
664 Ga0495667_0010525
665 Ga0495667_0081740
666 Ga0495634_0024330
667 Ga0495634_0130089
668 Ga0495625_0120572
669 Ga0495635_0001464
670 Ga0495635_0001507
671 Ga0495657_0009048
672 Ga0495657_0012817
673 Ga0495657_0063380
674 Ga0495599_0009154
675 Ga0495599_0055513
676 Ga0495623_0108829
677 Ga0495646_0010666
678 Ga0495646_0029750
679 Ga0495613_0047893
680 Ga0495670_0091856
681 Ga0495589_0017900
682 Ga0495600_0008011
683 Ga0495600_0017105
684 Ga0495600_0034124
685 Ga0495600_0111677
686 Ga0495581_0020225
687 Ga0495604_0001000
688 Ga0495604_0034631
689 Ga0495604_0061992
690 Ga0495674_0016193
691 Ga0495674_0158246
692 Ga0495680_0125340
693 Ga0495683_0041916
694 Ga0495675_0071796
695 Ga0495684_0010544
696 Ga0495684_0130901
697 Ga0495686_0024203
698 Ga0495602_0076764
699 Ga0496100_0006848
700 Ga0496102_0000319
701 Ga0496102_0015079
702 Ga0496103_0038447
703 Ga0496104_0007131
704 Ga0496105_0002982
705 Ga0496105_0035268
706 Ga0496106_0013020
707 Ga0496108_0004925
708 Ga0496108_0013116
709 Ga0496108_0039190
710 Ga0496109_0010642
711 Ga0496109_0016368
712 Ga0496109_0092376
713 Ga0496110_0003418
714 Ga0496111_0000654
715 Ga0496112_0111419
716 Ga0496112_0153944
717 Ga0496112_0304659
718 Ga0496113_0002535
719 Ga0496113_0004740
720 Ga0496113_0085305
721 Ga0496119_0050878
722 Ga0501042_0048789
723 Ga0501069_0006545
724 Ga0501070_0003626
725 Ga0501073_0315223
726 Ga0501080_0046707
727 Ga0501044_0068861
728 nmdc:mga08y16_65083_c1
729 nmdc:mga0n895_12207_c1
730 nmdc:mga0rr50_1297_c1
731 nmdc:mga08x19_3218_c1
732 nmdc:mga0a205_15078_c1
733 Ga0495601_0001254
734 Ga0495601_0010450
735 Ga0495601_0034254
736 Ga0495612_0001755
737 Ga0495612_0003851
738 Ga0495595_0064554
739 Ga0495619_0165333
740 Ga0500559_0025346
741 Ga0466962_0001104
742 Ga0466962_0039043
743 Ga0466962_0065500
744 Ga0466962_0106427
745 Ga0466962_0156854
746 2902797587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

91

276

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7766 71 274
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7706 68 274
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7351 68 274
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7322 71 274
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7061 71 260
ID Description Score Start End Superfamily
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9474 67 276 1.10.3720.10
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.943 67 276 1.10.3720.10
af_P77463_85_288_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9429 69 273 1.10.3720.10
af_L0TEV4_50_262_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9424 66 280 1.10.3720.10
af_L0TEV4_50_262_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9382 66 280 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5E4J4E8-F1-model_v4 Binding-protein-dependent transport system inner membrane component 0.9767 13 275 GO:0005886
GO:0055085
AF-A0A6B2CAS1-F1-model_v4 ABC transporter permease subunit 0.9755 10 280 GO:0005886
GO:0055085
AF-A0A7C5TZL0-F1-model_v4 ABC transporter permease 0.9753 10 280 GO:0005886
GO:0055085
AF-F7YW59-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.975 13 280 GO:0005886
GO:0071916
AF-A0A0D8HHW1-F1-model_v4 Dipeptide transport system permease protein DppC 0.9742 2 280 GO:0005886
GO:0055085

Map