F426414

General Info

Members Datasets Scaffolds Average Seq Length
373 234 746 177

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0193591|Ga0395899_0193591_274_918
Length 201
Sequence VRRVAASLVLVVGVAAGFTYLRADPAWFDRLRYPLRYEQIVRGHARNYELDPALLAAVIYQESKFRADAKSSSGAIGLMQLKPETAQGIAIRTGGSRFQTSDLYNPEINVRYGSWYLRHLLNKYGDEKLALAAYNAGQRNVDRWRAEGTGIQFSETRAYVDRVEKLKGIYRHAYEDELAASSSLFAAYSPAASRATAAPSR

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
112 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
122 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
127 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
128 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
129 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
130 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 8.04
Rhizosphere 87.94
Stem 0
Stem Tuber 0
Unclassified 17.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0193591 3300037312 Bacteria 1422
2 Ga0070683_100009369 3300005329 Bacteria 8370
3 Ga0070683_100011867 3300005329 Bacteria 7550
4 Ga0070683_100088484 3300005329 Unclassified 2905
5 Ga0070683_100170423 3300005329 Bacteria 2066
6 Ga0070661_100124452 3300005344 Bacteria 1933
7 Ga0070661_100832280 3300005344 Bacteria 759
8 Ga0070674_100129443 3300005356 Bacteria 1880
9 Ga0070688_100672833 3300005365 Unclassified 799
10 Ga0070714_100075006 3300005435 Bacteria 2934
11 Ga0070711_100181737 3300005439 Bacteria 1610
12 Ga0070694_100629593 3300005444 Unclassified 866
13 Ga0070678_100435056 3300005456 Unclassified 1146
14 Ga0070681_10365109 3300005458 Bacteria 1354
15 Ga0068867_100706321 3300005459 Unclassified 890
16 Ga0070706_100194178 3300005467 Bacteria 1897
17 Ga0070706_100757417 3300005467 Bacteria 900
18 Ga0070707_100054704 3300005468 Unclassified 3827
19 Ga0070707_100164245 3300005468 Unclassified 2164
20 Ga0070707_100844707 3300005468 Unclassified 880
21 Ga0070698_100141238 3300005471 Unclassified 2359
22 Ga0070684_100014869 3300005535 Bacteria 6316
23 Ga0070684_100021061 3300005535 Bacteria 5417
24 Ga0070684_100056796 3300005535 Bacteria 3417
25 Ga0070684_100057518 3300005535 Bacteria 3396
26 Ga0070686_100257114 3300005544 Bacteria 1278
27 Ga0070686_100524052 3300005544 Bacteria 923
28 Ga0070696_100842540 3300005546 Bacteria 757
29 Ga0070704_100705857 3300005549 Unclassified 895
30 Ga0070704_100750175 3300005549 Bacteria 869
31 Ga0070664_100042973 3300005564 Bacteria 3813
32 Ga0070664_100197956 3300005564 Bacteria 1792
33 Ga0068857_100019508 3300005577 Bacteria 5955
34 Ga0068857_100162666 3300005577 Bacteria 2026
35 Ga0068857_101168942 3300005577 Bacteria 744
36 Ga0068854_100204813 3300005578 Bacteria 1553
37 Ga0068856_100030636 3300005614 Bacteria 5259
38 Ga0068856_100121464 3300005614 Bacteria 2614
39 Ga0070702_100462363 3300005615 Bacteria 923
40 Ga0081455_10081924 3300005937 Unclassified 2641
41 Ga0081455_10222326 3300005937 Bacteria 1398
42 Ga0081539_10051405 3300005985 Bacteria 2323
43 Ga0070717_10033017 3300006028 Bacteria 4173
44 Ga0070717_10104042 3300006028 Bacteria 2414
45 Ga0070717_10212296 3300006028 Bacteria 1699
46 Ga0075365_10465462 3300006038 Bacteria 893
47 Ga0075365_10775290 3300006038 Bacteria 677
48 Ga0075364_10196998 3300006051 Bacteria 1365
49 Ga0075364_10497974 3300006051 Bacteria 833
50 Ga0070716_100010668 3300006173 Bacteria 4613
51 Ga0070712_100025531 3300006175 Bacteria 3928
52 Ga0070712_100161337 3300006175 Bacteria 1731
53 Ga0070712_100417138 3300006175 Bacteria 1112
54 Ga0070712_101279168 3300006175 Bacteria 639
55 Ga0097621_100436029 3300006237 Bacteria 1178
56 Ga0075428_100023630 3300006844 Bacteria 6804
57 Ga0075430_100031660 3300006846 Bacteria 4488
58 Ga0075431_100041028 3300006847 Bacteria 4772
59 Ga0075434_100002508 3300006871 Bacteria 16187
60 Ga0075434_101478742 3300006871 Bacteria 689
61 Ga0075429_100147440 3300006880 Bacteria 2060
62 Ga0068865_100078142 3300006881 Bacteria 2367
63 Ga0075436_100492650 3300006914 Bacteria 896
64 Ga0105240_10247565 3300009093 Bacteria 2063
65 Ga0111539_10168506 3300009094 Bacteria 2559
66 Ga0111539_10566598 3300009094 Bacteria 1323
67 Ga0111539_11635758 3300009094 Bacteria 747
68 Ga0105245_10221486 3300009098 Bacteria 1826
69 Ga0105245_10573086 3300009098 Bacteria 1153
70 Ga0105245_10735127 3300009098 Bacteria 1022
71 Ga0114129_10144939 3300009147 Bacteria 3254
72 Ga0105243_10020425 3300009148 Bacteria 5022
73 Ga0105243_10076528 3300009148 Bacteria 2719
74 Ga0105243_10131046 3300009148 Bacteria 2127
75 Ga0105242_10651278 3300009176 Unclassified 1024
76 Ga0105248_10369144 3300009177 Bacteria 1616
77 Ga0105248_11768107 3300009177 Bacteria 701
78 Ga0105248_11890029 3300009177 Unclassified 677
79 Ga0105249_10416989 3300009553 Bacteria 1376
80 Ga0105249_10829313 3300009553 Bacteria 990
81 Ga0105239_10061962 3300010375 Bacteria 4106
82 Ga0105239_10095237 3300010375 Bacteria 3289
83 Ga0105239_10348015 3300010375 Unclassified 1673
84 Ga0157342_1002412 3300012507 Bacteria 1515
85 Ga0157374_11060557 3300013296 Unclassified 830
86 Ga0157375_10558599 3300013308 Bacteria 1306
87 Ga0157375_10629035 3300013308 Bacteria 1231
88 Ga0157380_10919425 3300014326 Bacteria 902
89 Ga0157376_10691236 3300014969 Bacteria 1024
90 Ga0207688_10043730 3300025901 Bacteria 2495
91 Ga0207643_10119595 3300025908 Unclassified 1559
92 Ga0207684_10203384 3300025910 Unclassified 1708
93 Ga0207707_10284456 3300025912 Bacteria 1432
94 Ga0207695_10148800 3300025913 Bacteria 2282
95 Ga0207693_10005290 3300025915 Bacteria 10792
96 Ga0207693_10121026 3300025915 Bacteria 2056
97 Ga0207693_10508495 3300025915 Bacteria 940
98 Ga0207663_10038631 3300025916 Bacteria 2887
99 Ga0207649_10094825 3300025920 Bacteria 1962
100 Ga0207646_10309217 3300025922 Unclassified 1428
101 Ga0207687_10987426 3300025927 Unclassified 722
102 Ga0207664_10001970 3300025929 Bacteria 13525
103 Ga0207664_10098450 3300025929 Bacteria 2411
104 Ga0207664_11015691 3300025929 Bacteria 743
105 Ga0207690_11134792 3300025932 Unclassified 652
106 Ga0207686_10168649 3300025934 Bacteria 1542
107 Ga0207686_10303424 3300025934 Unclassified 1187
108 Ga0207709_10011700 3300025935 Bacteria 4838
109 Ga0207709_10093999 3300025935 Bacteria 1967
110 Ga0207709_10232355 3300025935 Bacteria 1336
111 Ga0207669_10224574 3300025937 Bacteria 1381
112 Ga0207704_10025247 3300025938 Bacteria 3239
113 Ga0207665_10000625 3300025939 Bacteria 23680
114 Ga0207711_10279279 3300025941 Bacteria 1538
115 Ga0207661_10011233 3300025944 Bacteria 6480
116 Ga0207661_10024142 3300025944 Bacteria 4603
117 Ga0207661_10181472 3300025944 Bacteria 1839
118 Ga0207679_10103948 3300025945 Bacteria 2227
119 Ga0207668_10624453 3300025972 Unclassified 941
120 Ga0207640_10182943 3300025981 Bacteria 1573
121 Ga0207708_10150959 3300026075 Bacteria 1829
122 Ga0207702_10082759 3300026078 Bacteria 2791
123 Ga0207702_10192648 3300026078 Bacteria 1885
124 Ga0207702_10516194 3300026078 Bacteria 1166
125 Ga0207648_10201826 3300026089 Bacteria 1764
126 Ga0207674_10000908 3300026116 Bacteria 38623
127 Ga0207674_10222344 3300026116 Bacteria 1836
128 Ga0207675_100403842 3300026118 Bacteria 1347
129 Ga0209968_1053806 3300027526 Bacteria 702
130 Ga0207428_10004853 3300027907 Bacteria 12683
131 Ga0265337_1056156 3300028556 Unclassified 1098
132 Ga0265318_10017691 3300028577 Bacteria 2922
133 Ga0265338_10003498 3300028800 Bacteria 22042
134 Ga0265338_10043573 3300028800 Bacteria 4159
135 Ga0265338_10217449 3300028800 Unclassified 1430
136 Ga0265330_10019984 3300031235 Bacteria 3063
137 Ga0265339_10009571 3300031249 Bacteria 6074
138 Ga0265331_10120423 3300031250 Unclassified 1200
139 Ga0265327_10017091 3300031251 Bacteria 4568
140 Ga0265316_10022283 3300031344 Bacteria 5345
141 Ga0307408_100153013 3300031548 Bacteria 1823
142 Ga0307408_100185347 3300031548 Unclassified 1672
143 Ga0265313_10014136 3300031595 Bacteria 4737
144 Ga0265313_10093913 3300031595 Bacteria 1341
145 Ga0265314_10003773 3300031711 Bacteria 14480
146 Ga0307405_10041332 3300031731 Unclassified 2798
147 Ga0307413_10094655 3300031824 Bacteria 1956
148 Ga0307410_10025883 3300031852 Bacteria 3686
149 Ga0307407_10018144 3300031903 Bacteria 3551
150 Ga0307407_10566465 3300031903 Bacteria 842
151 Ga0307412_10602710 3300031911 Bacteria 930
152 Ga0307409_100066350 3300031995 Bacteria 2845
153 Ga0307416_100071614 3300032002 Bacteria 2881
154 Ga0307416_100102606 3300032002 Unclassified 2494
155 Ga0307416_102356372 3300032002 Bacteria 632
156 Ga0307414_10111222 3300032004 Unclassified 2086
157 Ga0307411_10026206 3300032005 Bacteria 3507
158 Ga0373956_0020951 3300035119 Bacteria 2787
159 Ga0373956_0261708 3300035119 Bacteria 823
160 Ga0373955_0436308 3300035172 Unclassified 798
161 Ga0373933_0094696 3300035724 Bacteria 1847
162 Ga0373937_0007558 3300036401 Bacteria 9412
163 Ga0373937_0185077 3300036401 Bacteria 1956
164 Ga0395899_0007809 3300037312 Bacteria 8251
165 Ga0395899_0342622 3300037312 Unclassified 1002
166 Ga0395900_0009468 3300037418 Bacteria 9985
167 Ga0395900_0035410 3300037418 Bacteria 5141
168 Ga0395900_0260481 3300037418 Bacteria 1732
169 Ga0395900_0265696 3300037418 Bacteria 1712
170 Ga0395900_0309228 3300037418 Bacteria 1564
171 Ga0395900_0379135 3300037418 Bacteria 1383
172 Ga0395900_0499087 3300037418 Bacteria 1167
173 Ga0395900_0628205 3300037418 Bacteria 1012
174 Ga0395898_0022030 3300037466 Bacteria 6455
175 Ga0395898_0038711 3300037466 Bacteria 4724
176 Ga0395898_0050403 3300037466 Bacteria 4074
177 Ga0395898_0100871 3300037466 Bacteria 2772
178 Ga0395898_0137201 3300037466 Bacteria 2342
179 Ga0395898_0169475 3300037466 Bacteria 2087
180 Ga0395898_0604296 3300037466 Bacteria 1039
181 Ga0395898_0669607 3300037466 Bacteria 980
182 Ga0395898_0973117 3300037466 Bacteria 785
183 Ga0395905_0006384 3300037471 Bacteria 11882
184 Ga0395905_0046486 3300037471 Bacteria 4070
185 Ga0395905_0050984 3300037471 Bacteria 3876
186 Ga0395905_0156382 3300037471 Bacteria 2144
187 Ga0395901_0004145 3300038443 Bacteria 14623
188 Ga0395901_0008098 3300038443 Bacteria 10615
189 Ga0395901_0031627 3300038443 Bacteria 5455
190 Ga0395901_0039095 3300038443 Bacteria 4909
191 Ga0395901_0040622 3300038443 Bacteria 4819
192 Ga0395901_0193943 3300038443 Bacteria 2130
193 Ga0395901_0253427 3300038443 Bacteria 1833
194 Ga0395901_0336006 3300038443 Unclassified 1561
195 Ga0395901_0343387 3300038443 Bacteria 1542
196 Ga0395901_0384166 3300038443 Bacteria 1445
197 Ga0395901_0615557 3300038443 Bacteria 1093
198 Ga0395901_0668133 3300038443 Bacteria 1040
199 Ga0439436_0046554 3300041404 Bacteria 1233
200 Ga0439438_096305 3300041405 Bacteria 719
201 Ga0439439_0007010 3300041406 Bacteria 2625
202 Ga0439447_048489 3300041407 Bacteria 1019
203 Ga0439453_0042439 3300041408 Bacteria 896
204 Ga0451793_0679939 3300041452 Bacteria 2900
205 Ga0451795_1317342 3300041456 Bacteria 1236
206 Ga0451800_0085759 3300041459 Bacteria 972
207 Ga0451802_0612327 3300041460 Bacteria 1552
208 Ga0451835_0476392 3300041492 Unclassified 1711
209 Ga0451839_0136818 3300041496 Bacteria 2062
210 Ga0451845_0103733 3300041501 Bacteria 2447
211 Ga0451849_0040297 3300041505 Bacteria 3255
212 Ga0451853_1018450 3300041512 Bacteria 4521
213 Ga0451853_1175719 3300041512 Bacteria 876
214 Ga0451853_2723302 3300041512 Bacteria 1155
215 Ga0439448_0011866 3300042005 Bacteria 2599
216 Ga0439449_0102907 3300042007 Bacteria 1056
217 Ga0439451_011666 3300042009 Bacteria 1773
218 Ga0439454_010595 3300042011 Bacteria 1218
219 Ga0439455_0149520 3300042012 Unclassified 664
220 Ga0439462_0024802 3300042015 Bacteria 1577
221 Ga0439463_020095 3300042016 Unclassified 1665
222 Ga0439446_0000714 3300042156 Bacteria 6944
223 Ga0439458_0026019 3300042157 Bacteria 1375
224 Ga0439458_0054943 3300042157 Viruses 987
225 Ga0439434_0011576 3300042435 Bacteria 2610
226 Ga0439434_0118905 3300042435 Bacteria 860
227 Ga0466967_0242396 3300045976 Unclassified 1720
228 Ga0495592_0074199 3300046454 Bacteria 2471
229 Ga0495603_0438712 3300046455 Bacteria 748
230 Ga0495641_0206666 3300046461 Bacteria 880
231 Ga0495641_0301388 3300046461 Bacteria 722
232 Ga0495641_0462845 3300046461 Unclassified 577
233 Ga0495651_0017827 3300046462 Bacteria 5497
234 Ga0495653_0057206 3300046463 Bacteria 2969
235 Ga0495582_0068869 3300046473 Bacteria 1956
236 Ga0495582_0133938 3300046473 Unclassified 1401
237 Ga0495605_0243832 3300046474 Unclassified 771
238 Ga0495639_0127231 3300046475 Bacteria 1218
239 Ga0495662_0124585 3300046476 Bacteria 1266
240 Ga0495594_0079577 3300046499 Bacteria 1830
241 Ga0495596_0136321 3300046500 Bacteria 953
242 Ga0495596_0160843 3300046500 Unclassified 873
243 Ga0495608_0020921 3300046511 Bacteria 4494
244 Ga0495608_0203434 3300046511 Unclassified 1246
245 Ga0495618_0193044 3300046514 Bacteria 1291
246 Ga0495628_0100617 3300046516 Bacteria 2231
247 Ga0495630_0171330 3300046517 Bacteria 1654
248 Ga0495631_0099516 3300046518 Unclassified 1252
249 Ga0495652_0117627 3300046529 Bacteria 2126
250 Ga0495665_0036739 3300046531 Bacteria 2615
251 Ga0495640_0281750 3300046533 Bacteria 1035
252 Ga0495586_0343286 3300046535 Bacteria 857
253 Ga0495609_0046706 3300046538 Unclassified 1939
254 Ga0495667_0024142 3300046559 Bacteria 4095
255 Ga0495667_0118749 3300046559 Bacteria 1708
256 Ga0495656_0026950 3300046615 Bacteria 2292
257 Ga0495656_0199299 3300046615 Bacteria 992
258 Ga0495656_0285145 3300046615 Bacteria 843
259 Ga0495634_0029059 3300046642 Bacteria 3831
260 Ga0495634_0172592 3300046642 Bacteria 1358
261 Ga0495659_0183824 3300046664 Unclassified 852
262 Ga0495588_0505478 3300046674 Bacteria 633
263 Ga0495657_0032056 3300046675 Bacteria 3671
264 Ga0495599_0273695 3300046678 Bacteria 1024
265 Ga0495623_0434075 3300046679 Bacteria 702
266 Ga0495669_0133919 3300046684 Bacteria 1168
267 Ga0495613_0067803 3300046689 Bacteria 2604
268 Ga0495624_0127957 3300046690 Bacteria 1558
269 Ga0495670_0086688 3300046691 Bacteria 1599
270 Ga0495600_0040646 3300046809 Bacteria 3030
271 Ga0495581_0001387 3300047315 Bacteria 13402
272 Ga0495581_0057283 3300047315 Bacteria 2249
273 Ga0495636_0413196 3300047318 Bacteria 644
274 Ga0495674_0131636 3300047319 Bacteria 2107
275 Ga0495674_0248323 3300047319 Bacteria 1465
276 Ga0495676_0387863 3300047321 Bacteria 928
277 Ga0495680_0014647 3300047322 Bacteria 6782
278 Ga0495680_0050892 3300047322 Bacteria 3237
279 Ga0495685_191602 3300047447 Bacteria 657
280 Ga0495684_0049706 3300047471 Bacteria 3203
281 Ga0495684_0393704 3300047471 Bacteria 974
282 Ga0495684_0437912 3300047471 Bacteria 911
283 Ga0495602_0615862 3300048088 Unclassified 745
284 Ga0495614_0311539 3300048089 Bacteria 729
285 Ga0495626_0165417 3300048091 Unclassified 925
286 Ga0496100_0220298 3300048903 Unclassified 1392
287 Ga0496102_0110104 3300048905 Bacteria 2567
288 Ga0496103_0042605 3300048906 Bacteria 2794
289 Ga0496104_0016727 3300048907 Bacteria 6667
290 Ga0496104_0537006 3300048907 Bacteria 1080
291 Ga0496105_0064894 3300048908 Bacteria 3013
292 Ga0496105_1036878 3300048908 Bacteria 612
293 Ga0496106_0004379 3300048909 Bacteria 10489
294 Ga0496108_0001624 3300048911 Bacteria 17828
295 Ga0496108_0119782 3300048911 Bacteria 2257
296 Ga0496109_0000828 3300048912 Bacteria 25828
297 Ga0496109_0092902 3300048912 Bacteria 2791
298 Ga0496110_0013707 3300048913 Bacteria 6715
299 Ga0496110_0199182 3300048913 Bacteria 1819
300 Ga0496110_0323115 3300048913 Unclassified 1406
301 Ga0496110_0368753 3300048913 Bacteria 1308
302 Ga0496111_0001799 3300048914 Bacteria 12582
303 Ga0496111_0003962 3300048914 Bacteria 9288
304 Ga0496111_0012672 3300048914 Bacteria 5714
305 Ga0496111_0020682 3300048914 Bacteria 4586
306 Ga0496111_0098525 3300048914 Bacteria 2147
307 Ga0496111_0203805 3300048914 Unclassified 1470
308 Ga0496112_0122218 3300048915 Bacteria 2574
309 Ga0496112_1470430 3300048915 Bacteria 595
310 Ga0496114_0053407 3300048917 Bacteria 3368
311 Ga0496114_0724378 3300048917 Bacteria 871
312 Ga0501032_0004462 3300049569 Bacteria 10550
313 Ga0501033_0006809 3300049570 Bacteria 8922
314 Ga0501036_0020996 3300049572 Bacteria 5483
315 Ga0501037_0107560 3300049573 Bacteria 2009
316 Ga0501038_0090380 3300049574 Bacteria 2566
317 Ga0501039_0058788 3300049575 Bacteria 2978
318 Ga0501039_0403100 3300049575 Unclassified 1074
319 Ga0501040_0076552 3300049576 Bacteria 2313
320 Ga0501041_0032775 3300049577 Bacteria 3140
321 Ga0501043_0006002 3300049579 Bacteria 9765
322 Ga0501046_0007692 3300049580 Bacteria 9448
323 Ga0501047_0215535 3300049581 Bacteria 1777
324 Ga0501048_0054427 3300049582 Bacteria 2842
325 Ga0501067_0028336 3300049583 Bacteria 3102
326 Ga0501067_0202376 3300049583 Bacteria 1106
327 Ga0501067_0487584 3300049583 Unclassified 689
328 Ga0501068_0004275 3300049584 Bacteria 7755
329 Ga0501069_0193858 3300049585 Bacteria 1176
330 Ga0501069_0334184 3300049585 Unclassified 891
331 Ga0501072_0008683 3300049588 Bacteria 7713
332 Ga0501072_0071912 3300049588 Unclassified 2733
333 Ga0501073_0011110 3300049589 Bacteria 6587
334 Ga0501074_0009266 3300049590 Bacteria 7150
335 Ga0501075_0050013 3300049591 Bacteria 3141
336 Ga0501076_0102160 3300049592 Bacteria 2311
337 Ga0501077_0037504 3300049593 Bacteria 3086
338 Ga0501077_0073891 3300049593 Unclassified 2160
339 Ga0501080_0025320 3300049742 Bacteria 5505
340 Ga0501081_0146849 3300049743 Bacteria 1692
341 Ga0501083_0066735 3300049744 Bacteria 2395
342 Ga0501035_0020893 3300049822 Bacteria 6016
343 Ga0501035_0778877 3300049822 Unclassified 766
344 Ga0501044_0227044 3300049823 Bacteria 1816
345 Ga0501045_0057476 3300049824 Bacteria 2846
346 nmdc:mga00v17_200345_c1 3300050491 Bacteria 1290
347 nmdc:mga00v17_87853_c1 3300050491 Bacteria 1202
348 nmdc:mga0yw44_336264_c1 3300050492 Bacteria 1015
349 nmdc:mga0yw44_487284_c1 3300050492 Unclassified 836
350 nmdc:mga05p37_181708_c1 3300050507 Bacteria 2558
351 nmdc:mga05p37_93400_c1 3300050507 Bacteria 3707
352 nmdc:mga09592_179299_c1 3300050508 Bacteria 1832
353 nmdc:mga09592_56769_c1 3300050508 Bacteria 3308
354 nmdc:mga0qj67_29431_c1 3300050509 Bacteria 4266
355 nmdc:mga06r32_658410_c1 3300050510 Bacteria 1015
356 nmdc:mga08y16_52077_c1 3300050511 Bacteria 4284
357 nmdc:mga0n895_366488_c1 3300050512 Bacteria 1459
358 nmdc:mga0rr50_141529_c1 3300050513 Bacteria 1936
359 nmdc:mga0rr50_45245_c1 3300050513 Unclassified 3233
360 nmdc:mga0rr50_616128_c1 3300050513 Unclassified 926
361 nmdc:mga0rr50_619481_c1 3300050513 Unclassified 923
362 nmdc:mga08x19_117222_c1 3300050514 Bacteria 1781
363 nmdc:mga08x19_21132_c1 3300050514 Bacteria 4014
364 nmdc:mga0a205_267868_c1 3300050515 Bacteria 1585
365 Ga0495601_0023066 3300053077 Bacteria 3823
366 Ga0495655_0070929 3300053083 Unclassified 974
367 Ga0495595_0070745 3300053084 Unclassified 1649
368 Ga0501084_0073775 3300054114 Bacteria 2857
369 Ga0501082_0033952 3300060353 Bacteria 4400
370 Ga0501082_0381850 3300060353 Unclassified 1229
371 Ga0530510_0178792 3300061734 Unclassified 1573
372 Ga0530510_0352942 3300061734 Unclassified 1105
373 Ga0530510_0633852 3300061734 Bacteria 814
374 Ga0395899_0193591
375 Ga0070683_100009369
376 Ga0070683_100011867
377 Ga0070683_100088484
378 Ga0070683_100170423
379 Ga0070661_100124452
380 Ga0070661_100832280
381 Ga0070674_100129443
382 Ga0070688_100672833
383 Ga0070714_100075006
384 Ga0070711_100181737
385 Ga0070694_100629593
386 Ga0070678_100435056
387 Ga0070681_10365109
388 Ga0068867_100706321
389 Ga0070706_100194178
390 Ga0070706_100757417
391 Ga0070707_100054704
392 Ga0070707_100164245
393 Ga0070707_100844707
394 Ga0070698_100141238
395 Ga0070684_100014869
396 Ga0070684_100021061
397 Ga0070684_100056796
398 Ga0070684_100057518
399 Ga0070686_100257114
400 Ga0070686_100524052
401 Ga0070696_100842540
402 Ga0070704_100705857
403 Ga0070704_100750175
404 Ga0070664_100042973
405 Ga0070664_100197956
406 Ga0068857_100019508
407 Ga0068857_100162666
408 Ga0068857_101168942
409 Ga0068854_100204813
410 Ga0068856_100030636
411 Ga0068856_100121464
412 Ga0070702_100462363
413 Ga0081455_10081924
414 Ga0081455_10222326
415 Ga0081539_10051405
416 Ga0070717_10033017
417 Ga0070717_10104042
418 Ga0070717_10212296
419 Ga0075365_10465462
420 Ga0075365_10775290
421 Ga0075364_10196998
422 Ga0075364_10497974
423 Ga0070716_100010668
424 Ga0070712_100025531
425 Ga0070712_100161337
426 Ga0070712_100417138
427 Ga0070712_101279168
428 Ga0097621_100436029
429 Ga0075428_100023630
430 Ga0075430_100031660
431 Ga0075431_100041028
432 Ga0075434_100002508
433 Ga0075434_101478742
434 Ga0075429_100147440
435 Ga0068865_100078142
436 Ga0075436_100492650
437 Ga0105240_10247565
438 Ga0111539_10168506
439 Ga0111539_10566598
440 Ga0111539_11635758
441 Ga0105245_10221486
442 Ga0105245_10573086
443 Ga0105245_10735127
444 Ga0114129_10144939
445 Ga0105243_10020425
446 Ga0105243_10076528
447 Ga0105243_10131046
448 Ga0105242_10651278
449 Ga0105248_10369144
450 Ga0105248_11768107
451 Ga0105248_11890029
452 Ga0105249_10416989
453 Ga0105249_10829313
454 Ga0105239_10061962
455 Ga0105239_10095237
456 Ga0105239_10348015
457 Ga0157342_1002412
458 Ga0157374_11060557
459 Ga0157375_10558599
460 Ga0157375_10629035
461 Ga0157380_10919425
462 Ga0157376_10691236
463 Ga0207688_10043730
464 Ga0207643_10119595
465 Ga0207684_10203384
466 Ga0207707_10284456
467 Ga0207695_10148800
468 Ga0207693_10005290
469 Ga0207693_10121026
470 Ga0207693_10508495
471 Ga0207663_10038631
472 Ga0207649_10094825
473 Ga0207646_10309217
474 Ga0207687_10987426
475 Ga0207664_10001970
476 Ga0207664_10098450
477 Ga0207664_11015691
478 Ga0207690_11134792
479 Ga0207686_10168649
480 Ga0207686_10303424
481 Ga0207709_10011700
482 Ga0207709_10093999
483 Ga0207709_10232355
484 Ga0207669_10224574
485 Ga0207704_10025247
486 Ga0207665_10000625
487 Ga0207711_10279279
488 Ga0207661_10011233
489 Ga0207661_10024142
490 Ga0207661_10181472
491 Ga0207679_10103948
492 Ga0207668_10624453
493 Ga0207640_10182943
494 Ga0207708_10150959
495 Ga0207702_10082759
496 Ga0207702_10192648
497 Ga0207702_10516194
498 Ga0207648_10201826
499 Ga0207674_10000908
500 Ga0207674_10222344
501 Ga0207675_100403842
502 Ga0209968_1053806
503 Ga0207428_10004853
504 Ga0265337_1056156
505 Ga0265318_10017691
506 Ga0265338_10003498
507 Ga0265338_10043573
508 Ga0265338_10217449
509 Ga0265330_10019984
510 Ga0265339_10009571
511 Ga0265331_10120423
512 Ga0265327_10017091
513 Ga0265316_10022283
514 Ga0307408_100153013
515 Ga0307408_100185347
516 Ga0265313_10014136
517 Ga0265313_10093913
518 Ga0265314_10003773
519 Ga0307405_10041332
520 Ga0307413_10094655
521 Ga0307410_10025883
522 Ga0307407_10018144
523 Ga0307407_10566465
524 Ga0307412_10602710
525 Ga0307409_100066350
526 Ga0307416_100071614
527 Ga0307416_100102606
528 Ga0307416_102356372
529 Ga0307414_10111222
530 Ga0307411_10026206
531 Ga0373956_0020951
532 Ga0373956_0261708
533 Ga0373955_0436308
534 Ga0373933_0094696
535 Ga0373937_0007558
536 Ga0373937_0185077
537 Ga0395899_0007809
538 Ga0395899_0342622
539 Ga0395900_0009468
540 Ga0395900_0035410
541 Ga0395900_0260481
542 Ga0395900_0265696
543 Ga0395900_0309228
544 Ga0395900_0379135
545 Ga0395900_0499087
546 Ga0395900_0628205
547 Ga0395898_0022030
548 Ga0395898_0038711
549 Ga0395898_0050403
550 Ga0395898_0100871
551 Ga0395898_0137201
552 Ga0395898_0169475
553 Ga0395898_0604296
554 Ga0395898_0669607
555 Ga0395898_0973117
556 Ga0395905_0006384
557 Ga0395905_0046486
558 Ga0395905_0050984
559 Ga0395905_0156382
560 Ga0395901_0004145
561 Ga0395901_0008098
562 Ga0395901_0031627
563 Ga0395901_0039095
564 Ga0395901_0040622
565 Ga0395901_0193943
566 Ga0395901_0253427
567 Ga0395901_0336006
568 Ga0395901_0343387
569 Ga0395901_0384166
570 Ga0395901_0615557
571 Ga0395901_0668133
572 Ga0439436_0046554
573 Ga0439438_096305
574 Ga0439439_0007010
575 Ga0439447_048489
576 Ga0439453_0042439
577 Ga0451793_0679939
578 Ga0451795_1317342
579 Ga0451800_0085759
580 Ga0451802_0612327
581 Ga0451835_0476392
582 Ga0451839_0136818
583 Ga0451845_0103733
584 Ga0451849_0040297
585 Ga0451853_1018450
586 Ga0451853_1175719
587 Ga0451853_2723302
588 Ga0439448_0011866
589 Ga0439449_0102907
590 Ga0439451_011666
591 Ga0439454_010595
592 Ga0439455_0149520
593 Ga0439462_0024802
594 Ga0439463_020095
595 Ga0439446_0000714
596 Ga0439458_0026019
597 Ga0439458_0054943
598 Ga0439434_0011576
599 Ga0439434_0118905
600 Ga0466967_0242396
601 Ga0495592_0074199
602 Ga0495603_0438712
603 Ga0495641_0206666
604 Ga0495641_0301388
605 Ga0495641_0462845
606 Ga0495651_0017827
607 Ga0495653_0057206
608 Ga0495582_0068869
609 Ga0495582_0133938
610 Ga0495605_0243832
611 Ga0495639_0127231
612 Ga0495662_0124585
613 Ga0495594_0079577
614 Ga0495596_0136321
615 Ga0495596_0160843
616 Ga0495608_0020921
617 Ga0495608_0203434
618 Ga0495618_0193044
619 Ga0495628_0100617
620 Ga0495630_0171330
621 Ga0495631_0099516
622 Ga0495652_0117627
623 Ga0495665_0036739
624 Ga0495640_0281750
625 Ga0495586_0343286
626 Ga0495609_0046706
627 Ga0495667_0024142
628 Ga0495667_0118749
629 Ga0495656_0026950
630 Ga0495656_0199299
631 Ga0495656_0285145
632 Ga0495634_0029059
633 Ga0495634_0172592
634 Ga0495659_0183824
635 Ga0495588_0505478
636 Ga0495657_0032056
637 Ga0495599_0273695
638 Ga0495623_0434075
639 Ga0495669_0133919
640 Ga0495613_0067803
641 Ga0495624_0127957
642 Ga0495670_0086688
643 Ga0495600_0040646
644 Ga0495581_0001387
645 Ga0495581_0057283
646 Ga0495636_0413196
647 Ga0495674_0131636
648 Ga0495674_0248323
649 Ga0495676_0387863
650 Ga0495680_0014647
651 Ga0495680_0050892
652 Ga0495685_191602
653 Ga0495684_0049706
654 Ga0495684_0393704
655 Ga0495684_0437912
656 Ga0495602_0615862
657 Ga0495614_0311539
658 Ga0495626_0165417
659 Ga0496100_0220298
660 Ga0496102_0110104
661 Ga0496103_0042605
662 Ga0496104_0016727
663 Ga0496104_0537006
664 Ga0496105_0064894
665 Ga0496105_1036878
666 Ga0496106_0004379
667 Ga0496108_0001624
668 Ga0496108_0119782
669 Ga0496109_0000828
670 Ga0496109_0092902
671 Ga0496110_0013707
672 Ga0496110_0199182
673 Ga0496110_0323115
674 Ga0496110_0368753
675 Ga0496111_0001799
676 Ga0496111_0003962
677 Ga0496111_0012672
678 Ga0496111_0020682
679 Ga0496111_0098525
680 Ga0496111_0203805
681 Ga0496112_0122218
682 Ga0496112_1470430
683 Ga0496114_0053407
684 Ga0496114_0724378
685 Ga0501032_0004462
686 Ga0501033_0006809
687 Ga0501036_0020996
688 Ga0501037_0107560
689 Ga0501038_0090380
690 Ga0501039_0058788
691 Ga0501039_0403100
692 Ga0501040_0076552
693 Ga0501041_0032775
694 Ga0501043_0006002
695 Ga0501046_0007692
696 Ga0501047_0215535
697 Ga0501048_0054427
698 Ga0501067_0028336
699 Ga0501067_0202376
700 Ga0501067_0487584
701 Ga0501068_0004275
702 Ga0501069_0193858
703 Ga0501069_0334184
704 Ga0501072_0008683
705 Ga0501072_0071912
706 Ga0501073_0011110
707 Ga0501074_0009266
708 Ga0501075_0050013
709 Ga0501076_0102160
710 Ga0501077_0037504
711 Ga0501077_0073891
712 Ga0501080_0025320
713 Ga0501081_0146849
714 Ga0501083_0066735
715 Ga0501035_0020893
716 Ga0501035_0778877
717 Ga0501044_0227044
718 Ga0501045_0057476
719 nmdc:mga00v17_200345_c1
720 nmdc:mga00v17_87853_c1
721 nmdc:mga0yw44_336264_c1
722 nmdc:mga0yw44_487284_c1
723 nmdc:mga05p37_181708_c1
724 nmdc:mga05p37_93400_c1
725 nmdc:mga09592_179299_c1
726 nmdc:mga09592_56769_c1
727 nmdc:mga0qj67_29431_c1
728 nmdc:mga06r32_658410_c1
729 nmdc:mga08y16_52077_c1
730 nmdc:mga0n895_366488_c1
731 nmdc:mga0rr50_141529_c1
732 nmdc:mga0rr50_45245_c1
733 nmdc:mga0rr50_616128_c1
734 nmdc:mga0rr50_619481_c1
735 nmdc:mga08x19_117222_c1
736 nmdc:mga08x19_21132_c1
737 nmdc:mga0a205_267868_c1
738 Ga0495601_0023066
739 Ga0495655_0070929
740 Ga0495595_0070745
741 Ga0501084_0073775
742 Ga0501082_0033952
743 Ga0501082_0381850
744 Ga0530510_0178792
745 Ga0530510_0352942
746 Ga0530510_0633852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01464

SLT

Transglycosylase SLT domain

39

155

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qte-assembly1.cif.gz_A crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6-anhydromurotripeptide 0.9287 30 172
6fbt-assembly1.cif.gz_A the x-ray structure of lytic transglycosylase slt from pseudomonas aeruginosa in complex with the reaction product nag-anhnampentapeptide 0.919 31 176
6fc4-assembly1.cif.gz_A the x-ray structure of lytic transglycosylase slt inactive mutant e503q from pseudomonas aeruginosa 0.9093 31 176
1sly-assembly1.cif.gz_A complex of the 70-kda soluble lytic transglycosylase with bulgecin a 0.9092 30 171
6cf8-assembly1.cif.gz_A crystal structure of cj0843 lytic transglycosylase of campylobacter jejuni at 1.87a resolution 0.9057 53 176
ID Description Score Start End Superfamily
1slyA03 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.915 33 171 1.10.530.10
4cfoB02 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8585 38 173 1.10.530.10
af_K7L752_78_237_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7966 39 177 1.10.530.10
af_A0A1D6QSC1_388_533_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7946 41 171 1.10.530.10
af_P0AEZ7_97_250_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.794 38 177 1.10.530.10
ID Description Score Start End GO Terms
AF-A0A7V9EHN8-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9957 26 176 GO:0000270
GO:0008933
GO:0016020
AF-A0A538AMA2-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9931 36 177 GO:0000270
GO:0008933
GO:0016020
AF-A0A538AMA2-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9861 36 177 GO:0000270
GO:0008933
GO:0016020
AF-A0A7X8VEX8-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9726 31 177 GO:0000270
GO:0008933
GO:0016020
AF-A0A1C0ABX2-F1-model_v4 Lytic transglycosylase 0.9709 27 175 GO:0000270
GO:0008933
GO:0016020

Map