F426402

General Info

Members Datasets Scaffolds Average Seq Length
373 226 746 232

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10140555|Ga0307413_101405552
Length 249
Sequence MRDSWRHFVAEFIGTFALVFVGGAAIMIAKDTNSPAGLLGIAFAHGLILAVMVSALMRISGHFNPAVTLGFVVTRRIEIPMAGVYILAQIIGAIVGAYVLKWTFPFALFEATRGGGQAVALQVTGGQAFLLEFIATFFLVIVVFGTAVDPKAPRIGGLAIGLVVAADILAIGPLTGGSMNPARSFGPAVASGVFEAQMIYWLAPITGAIVAAVLYEYLFLRRDTEPVDHGVLRPAATTGEVPRSGDRKH

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
185 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
194 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
195 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
196 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
199 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
200 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
201 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
202 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
203 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
204 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
207 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
211 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
214 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
215 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
216 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.14
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 16.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10140555 3300031824 Bacteria 1668
2 Ga0065715_10002319 3300005293 Unclassified 4904
3 Ga0065715_10101223 3300005293 Bacteria 3227
4 Ga0070676_10031120 3300005328 Bacteria 3047
5 Ga0070683_100010300 3300005329 Bacteria 8039
6 Ga0070683_100031005 3300005329 Bacteria 4858
7 Ga0070683_100069418 3300005329 Bacteria 3286
8 Ga0070683_100227881 3300005329 Unclassified 1771
9 Ga0070683_100236318 3300005329 Unclassified 1738
10 Ga0070690_100057507 3300005330 Bacteria 2496
11 Ga0070690_100110705 3300005330 Bacteria 1832
12 Ga0070690_100445912 3300005330 Unclassified 959
13 Ga0070666_10095035 3300005335 Bacteria 2051
14 Ga0070680_100004785 3300005336 Bacteria 10189
15 Ga0070680_100050217 3300005336 Bacteria 3402
16 Ga0070680_100121998 3300005336 Bacteria 2176
17 Ga0070680_100448724 3300005336 Bacteria 1101
18 Ga0070682_100003618 3300005337 Bacteria 8570
19 Ga0070682_100006098 3300005337 Bacteria 6746
20 Ga0070682_100014968 3300005337 Bacteria 4491
21 Ga0068868_100011563 3300005338 Bacteria 6429
22 Ga0068868_100107886 3300005338 Bacteria 2260
23 Ga0068868_100130984 3300005338 Bacteria 2052
24 Ga0070689_100078138 3300005340 Bacteria 2594
25 Ga0070689_100220589 3300005340 Bacteria 1555
26 Ga0070689_100342453 3300005340 Bacteria 1252
27 Ga0070691_10023804 3300005341 Bacteria 2844
28 Ga0070687_100014170 3300005343 Bacteria 3575
29 Ga0070661_100002807 3300005344 Bacteria 11957
30 Ga0070661_100283611 3300005344 Unclassified 1285
31 Ga0070692_10003965 3300005345 Bacteria 6108
32 Ga0070669_100051958 3300005353 Bacteria 2997
33 Ga0070669_100282192 3300005353 Unclassified 1331
34 Ga0070671_100306774 3300005355 Bacteria 1352
35 Ga0070674_100055746 3300005356 Bacteria 2739
36 Ga0070673_100016164 3300005364 Bacteria 5267
37 Ga0070673_100239044 3300005364 Bacteria 1578
38 Ga0070673_100421229 3300005364 Unclassified 1197
39 Ga0070659_100196211 3300005366 Bacteria 1660
40 Ga0070659_100370841 3300005366 Bacteria 1204
41 Ga0070667_100546144 3300005367 Unclassified 1065
42 Ga0070709_10019596 3300005434 Bacteria 3913
43 Ga0070714_100321950 3300005435 Unclassified 1446
44 Ga0070710_10031711 3300005437 Bacteria 2856
45 Ga0070711_100149117 3300005439 Bacteria 1762
46 Ga0070705_100013713 3300005440 Bacteria 4150
47 Ga0070705_100209225 3300005440 Bacteria 1343
48 Ga0070700_100160599 3300005441 Unclassified 1546
49 Ga0070700_100312943 3300005441 Bacteria 1150
50 Ga0070694_100020962 3300005444 Bacteria 4172
51 Ga0070694_100027003 3300005444 Bacteria 3725
52 Ga0070694_100080300 3300005444 Bacteria 2266
53 Ga0070694_100081512 3300005444 Bacteria 2251
54 Ga0070708_100000089 3300005445 Bacteria 59378
55 Ga0070708_100017611 3300005445 Bacteria 5965
56 Ga0070708_100097590 3300005445 Bacteria 2686
57 Ga0070663_100027687 3300005455 Bacteria 3851
58 Ga0070663_100292134 3300005455 Bacteria 1302
59 Ga0070678_100035559 3300005456 Bacteria 3479
60 Ga0070662_100026077 3300005457 Bacteria 4044
61 Ga0070681_10000910 3300005458 Bacteria 24995
62 Ga0070681_10022804 3300005458 Bacteria 6292
63 Ga0070681_10040559 3300005458 Bacteria 4663
64 Ga0070681_10087629 3300005458 Bacteria 3066
65 Ga0068867_100012683 3300005459 Bacteria 5961
66 Ga0070706_100077551 3300005467 Bacteria 3075
67 Ga0070706_100145736 3300005467 Unclassified 2211
68 Ga0070707_100002168 3300005468 Bacteria 18792
69 Ga0070707_100064505 3300005468 Bacteria 3517
70 Ga0070707_100316722 3300005468 Bacteria 1516
71 Ga0070707_100810400 3300005468 Bacteria 900
72 Ga0070699_100062994 3300005518 Bacteria 3215
73 Ga0070699_100293953 3300005518 Bacteria 1457
74 Ga0070699_100306518 3300005518 Unclassified 1425
75 Ga0070699_100384332 3300005518 Bacteria 1268
76 Ga0070699_100706002 3300005518 Bacteria 922
77 Ga0070679_100001686 3300005530 Bacteria 19883
78 Ga0070679_100014715 3300005530 Bacteria 7521
79 Ga0070679_100027749 3300005530 Bacteria 5576
80 Ga0070679_100132586 3300005530 Bacteria 2473
81 Ga0070684_100049724 3300005535 Bacteria 3640
82 Ga0070684_100122236 3300005535 Bacteria 2342
83 Ga0070684_100347815 3300005535 Bacteria 1363
84 Ga0070697_100187735 3300005536 Bacteria 1753
85 Ga0070697_100196469 3300005536 Bacteria 1713
86 Ga0070697_100406107 3300005536 Bacteria 1182
87 Ga0068853_100023792 3300005539 Bacteria 5132
88 Ga0070672_100024292 3300005543 Bacteria 4477
89 Ga0070686_100301563 3300005544 Unclassified 1188
90 Ga0070695_100033608 3300005545 Unclassified 3209
91 Ga0070695_100118188 3300005545 Bacteria 1810
92 Ga0070696_100013049 3300005546 Bacteria 5576
93 Ga0070696_100026251 3300005546 Bacteria 3962
94 Ga0070696_100027479 3300005546 Bacteria 3877
95 Ga0070696_100038093 3300005546 Bacteria 3317
96 Ga0070696_100172687 3300005546 Bacteria 1599
97 Ga0070693_100015216 3300005547 Bacteria 3958
98 Ga0070704_100020474 3300005549 Bacteria 4267
99 Ga0070704_100029965 3300005549 Bacteria 3640
100 Ga0068855_100721118 3300005563 Unclassified 1065
101 Ga0070664_100001672 3300005564 Bacteria 17753
102 Ga0070664_100290991 3300005564 Unclassified 1475
103 Ga0068854_100156456 3300005578 Bacteria 1761
104 Ga0068856_100085802 3300005614 Bacteria 3128
105 Ga0068856_100196645 3300005614 Bacteria 2030
106 Ga0068852_100388885 3300005616 Bacteria 1370
107 Ga0068864_100007438 3300005618 Bacteria 9018
108 Ga0068866_10037628 3300005718 Bacteria 2378
109 Ga0068866_10121588 3300005718 Unclassified 1472
110 Ga0068861_100714129 3300005719 Unclassified 933
111 Ga0068863_100042851 3300005841 Bacteria 4299
112 Ga0068858_100750296 3300005842 Bacteria 951
113 Ga0068860_100307102 3300005843 Bacteria 1555
114 Ga0068862_100686141 3300005844 Unclassified 991
115 Ga0070716_100010663 3300006173 Bacteria 4614
116 Ga0070716_100067789 3300006173 Bacteria 2085
117 Ga0070716_100290238 3300006173 Unclassified 1133
118 Ga0075428_100304554 3300006844 Unclassified 1713
119 Ga0075431_100051369 3300006847 Bacteria 4251
120 Ga0075433_10168937 3300006852 Bacteria 1947
121 Ga0075434_100002929 3300006871 Bacteria 15172
122 Ga0068865_100012387 3300006881 Bacteria 5367
123 Ga0075436_100010818 3300006914 Bacteria 6260
124 Ga0075435_100253398 3300007076 Bacteria 1499
125 Ga0075435_100279848 3300007076 Bacteria 1424
126 Ga0099795_10204053 3300007788 Bacteria 835
127 Ga0105240_10005188 3300009093 Bacteria 19491
128 Ga0105240_10020699 3300009093 Bacteria 8765
129 Ga0105240_10043453 3300009093 Bacteria 5718
130 Ga0105240_10096074 3300009093 Bacteria 3612
131 Ga0105240_10143058 3300009093 Bacteria 2858
132 Ga0105240_10226061 3300009093 Unclassified 2177
133 Ga0105240_10406250 3300009093 Bacteria 1533
134 Ga0105245_10011741 3300009098 Bacteria 7619
135 Ga0105245_10049077 3300009098 Bacteria 3778
136 Ga0105245_10112196 3300009098 Bacteria 2537
137 Ga0114129_10272321 3300009147 Bacteria 2265
138 Ga0105241_10001261 3300009174 Bacteria 19299
139 Ga0105241_10489603 3300009174 Bacteria 1094
140 Ga0105241_10744348 3300009174 Unclassified 898
141 Ga0105242_10047103 3300009176 Bacteria 3500
142 Ga0105242_10086711 3300009176 Unclassified 2627
143 Ga0105242_10237888 3300009176 Bacteria 1636
144 Ga0105242_10819867 3300009176 Bacteria 923
145 Ga0105242_11069310 3300009176 Bacteria 819
146 Ga0105248_10276705 3300009177 Bacteria 1890
147 Ga0105238_10016672 3300009551 Bacteria 7442
148 Ga0105239_10317700 3300010375 Bacteria 1756
149 Ga0105246_10646237 3300011119 Unclassified 920
150 Ga0157373_10067916 3300013100 Bacteria 2520
151 Ga0157370_10009063 3300013104 Bacteria 10673
152 Ga0157369_10039569 3300013105 Bacteria 5152
153 Ga0157369_10600681 3300013105 Bacteria 1136
154 Ga0157374_10156512 3300013296 Bacteria 2218
155 Ga0157378_10022863 3300013297 Bacteria 5503
156 Ga0157378_10060844 3300013297 Bacteria 3369
157 Ga0157378_10110656 3300013297 Bacteria 2518
158 Ga0157378_10271994 3300013297 Bacteria 1630
159 Ga0157372_10018535 3300013307 Bacteria 7485
160 Ga0157372_10041021 3300013307 Bacteria 5116
161 Ga0157372_10123710 3300013307 Bacteria 2973
162 Ga0157372_10165110 3300013307 Bacteria 2560
163 Ga0163163_10030700 3300014325 Bacteria 5181
164 Ga0206353_11114722 3300020082 Bacteria 1183
165 Ga0207692_10017803 3300025898 Bacteria 3176
166 Ga0207642_10039268 3300025899 Bacteria 2055
167 Ga0207642_10168635 3300025899 Bacteria 1182
168 Ga0207699_10019075 3300025906 Bacteria 3649
169 Ga0207699_10430655 3300025906 Bacteria 943
170 Ga0207645_10004668 3300025907 Bacteria 10090
171 Ga0207705_10055275 3300025909 Bacteria 2862
172 Ga0207705_10416738 3300025909 Unclassified 1039
173 Ga0207684_10076837 3300025910 Bacteria 2838
174 Ga0207654_10000075 3300025911 Bacteria 65108
175 Ga0207654_10359562 3300025911 Bacteria 1004
176 Ga0207707_10026796 3300025912 Bacteria 5037
177 Ga0207707_10134237 3300025912 Bacteria 2164
178 Ga0207695_10003738 3300025913 Bacteria 21160
179 Ga0207695_10234122 3300025913 Bacteria 1740
180 Ga0207695_10269248 3300025913 Bacteria 1599
181 Ga0207695_10274163 3300025913 Unclassified 1582
182 Ga0207663_10266022 3300025916 Unclassified 1268
183 Ga0207660_10020400 3300025917 Bacteria 4446
184 Ga0207660_10033841 3300025917 Bacteria 3538
185 Ga0207660_10134427 3300025917 Bacteria 1885
186 Ga0207660_10233150 3300025917 Bacteria 1448
187 Ga0207662_10008439 3300025918 Bacteria 5639
188 Ga0207657_10016052 3300025919 Bacteria 7229
189 Ga0207657_10021288 3300025919 Bacteria 6107
190 Ga0207649_10047187 3300025920 Bacteria 2650
191 Ga0207649_10077800 3300025920 Bacteria 2139
192 Ga0207652_10006977 3300025921 Bacteria 9100
193 Ga0207652_10007404 3300025921 Bacteria 8852
194 Ga0207652_10012656 3300025921 Bacteria 6822
195 Ga0207646_10012166 3300025922 Bacteria 8279
196 Ga0207646_10162108 3300025922 Unclassified 2018
197 Ga0207646_10181685 3300025922 Bacteria 1900
198 Ga0207646_10336819 3300025922 Unclassified 1363
199 Ga0207646_10344905 3300025922 Bacteria 1346
200 Ga0207646_10403823 3300025922 Bacteria 1234
201 Ga0207681_10049366 3300025923 Bacteria 2844
202 Ga0207694_10003584 3300025924 Bacteria 12310
203 Ga0207687_10177940 3300025927 Bacteria 1646
204 Ga0207644_10076056 3300025931 Bacteria 2469
205 Ga0207690_10079481 3300025932 Bacteria 2285
206 Ga0207706_10006143 3300025933 Bacteria 11154
207 Ga0207686_10043821 3300025934 Bacteria 2744
208 Ga0207686_10062920 3300025934 Unclassified 2358
209 Ga0207686_10529722 3300025934 Unclassified 918
210 Ga0207670_10183953 3300025936 Bacteria 1576
211 Ga0207669_10276585 3300025937 Bacteria 1264
212 Ga0207665_10000496 3300025939 Bacteria 26621
213 Ga0207665_10014346 3300025939 Bacteria 5217
214 Ga0207691_10289657 3300025940 Bacteria 1408
215 Ga0207711_10241561 3300025941 Bacteria 1656
216 Ga0207661_10102281 3300025944 Bacteria 2408
217 Ga0207661_10194705 3300025944 Bacteria 1779
218 Ga0207661_10440147 3300025944 Unclassified 1186
219 Ga0207679_10093380 3300025945 Bacteria 2333
220 Ga0207667_10015582 3300025949 Bacteria 8625
221 Ga0207667_10034931 3300025949 Bacteria 5395
222 Ga0207667_10425801 3300025949 Bacteria 1350
223 Ga0207667_10750573 3300025949 Bacteria 975
224 Ga0207658_10232240 3300025986 Bacteria 1558
225 Ga0207677_10038102 3300026023 Bacteria 3148
226 Ga0207703_10807511 3300026035 Unclassified 896
227 Ga0207639_10765678 3300026041 Unclassified 898
228 Ga0207678_10014003 3300026067 Bacteria 7050
229 Ga0207678_10324930 3300026067 Bacteria 1324
230 Ga0207708_10019215 3300026075 Bacteria 5147
231 Ga0207708_10036489 3300026075 Bacteria 3743
232 Ga0207702_10070746 3300026078 Unclassified 3001
233 Ga0207702_10095471 3300026078 Bacteria 2613
234 Ga0207702_10642671 3300026078 Bacteria 1043
235 Ga0207648_10017580 3300026089 Bacteria 6497
236 Ga0207648_10052337 3300026089 Bacteria 3570
237 Ga0207676_10028681 3300026095 Bacteria 4160
238 Ga0207676_10098036 3300026095 Bacteria 2423
239 Ga0207683_10003908 3300026121 Bacteria 12917
240 Ga0207698_10047570 3300026142 Bacteria 3251
241 Ga0210000_1003057 3300027462 Bacteria 2397
242 Ga0209968_1010833 3300027526 Bacteria 1405
243 Ga0268265_10660182 3300028380 Unclassified 1006
244 Ga0268264_10363293 3300028381 Unclassified 1382
245 Ga0265326_10038292 3300028558 Eukaryota 1363
246 Ga0265338_10093876 3300028800 Bacteria 2470
247 Ga0265327_10006970 3300031251 Bacteria 8867
248 Ga0265327_10024947 3300031251 Bacteria 3497
249 Ga0307408_100030009 3300031548 Bacteria 3772
250 Ga0307408_100039071 3300031548 Bacteria 3352
251 Ga0307408_100773975 3300031548 Bacteria 869
252 Ga0307410_10025613 3300031852 Bacteria 3703
253 Ga0307410_10069462 3300031852 Bacteria 2437
254 Ga0307410_10085443 3300031852 Bacteria 2227
255 Ga0307410_10353795 3300031852 Bacteria 1174
256 Ga0307410_10680445 3300031852 Unclassified 865
257 Ga0307406_10018806 3300031901 Bacteria 4044
258 Ga0307406_10038318 3300031901 Bacteria 2966
259 Ga0307406_10384767 3300031901 Bacteria 1107
260 Ga0307406_10619295 3300031901 Bacteria 895
261 Ga0307407_10022651 3300031903 Bacteria 3264
262 Ga0307412_10003888 3300031911 Bacteria 8312
263 Ga0307412_10032495 3300031911 Unclassified 3308
264 Ga0307412_10418289 3300031911 Unclassified 1096
265 Ga0307409_100018773 3300031995 Bacteria 4661
266 Ga0307409_100105072 3300031995 Bacteria 2353
267 Ga0307409_100483185 3300031995 Bacteria 1202
268 Ga0307409_100803130 3300031995 Bacteria 948
269 Ga0307409_100864467 3300031995 Bacteria 916
270 Ga0307416_100018015 3300032002 Bacteria 4961
271 Ga0307416_100062549 3300032002 Bacteria 3044
272 Ga0307416_100693826 3300032002 Unclassified 1107
273 Ga0307416_101253387 3300032002 Bacteria 847
274 Ga0307416_101344132 3300032002 Bacteria 820
275 Ga0307414_10307788 3300032004 Unclassified 1343
276 Ga0307414_10403788 3300032004 Bacteria 1187
277 Ga0307414_10405834 3300032004 Bacteria 1185
278 Ga0307411_10000515 3300032005 Bacteria 13602
279 Ga0307411_10243521 3300032005 Unclassified 1409
280 Ga0307415_100272000 3300032126 Bacteria 1388
281 Ga0373944_0037638 3300035089 Bacteria 1483
282 Ga0373941_0055021 3300035115 Bacteria 1277
283 Ga0373943_0046445 3300035170 Bacteria 2120
284 Ga0373931_0179109 3300035691 Bacteria 1254
285 Ga0373935_0050644 3300035692 Bacteria 2636
286 Ga0373937_0031150 3300036401 Unclassified 4830
287 Ga0373925_0406380 3300037068 Bacteria 1111
288 Ga0451807_2763979 3300041486 Unclassified 741
289 Ga0451853_1553639 3300041512 Bacteria 1527
290 Ga0466966_0054842 3300044684 Bacteria 2524
291 Ga0466966_0200304 3300044684 Bacteria 1208
292 Ga0466959_0048151 3300045049 Bacteria 3133
293 Ga0451576_0890228 3300045051 Bacteria 934
294 Ga0451576_0979462 3300045051 Unclassified 886
295 Ga0495592_0039306 3300046454 Unclassified 3555
296 Ga0495653_0128381 3300046463 Bacteria 1798
297 Ga0495664_0028182 3300046477 Bacteria 3279
298 Ga0495608_0065643 3300046511 Bacteria 2377
299 Ga0495618_0119308 3300046514 Bacteria 1689
300 Ga0495642_0036796 3300046528 Bacteria 1979
301 Ga0495652_0270989 3300046529 Bacteria 1248
302 Ga0495640_0073023 3300046533 Bacteria 2297
303 Ga0495586_0121103 3300046535 Unclassified 1462
304 Ga0495598_0159440 3300046537 Unclassified 793
305 Ga0495645_0007378 3300046543 Bacteria 7648
306 Ga0495667_0012963 3300046559 Bacteria 5652
307 Ga0495634_0055832 3300046642 Bacteria 2640
308 Ga0495599_0044733 3300046678 Bacteria 2776
309 Ga0495646_0170149 3300046680 Bacteria 1201
310 Ga0495613_0149896 3300046689 Unclassified 1664
311 Ga0495600_0073926 3300046809 Bacteria 2226
312 Ga0495604_0001012 3300047317 Bacteria 23396
313 Ga0495674_0091811 3300047319 Unclassified 2593
314 Ga0495680_0364855 3300047322 Unclassified 1003
315 Ga0495675_0048954 3300047444 Bacteria 2688
316 Ga0495675_0336126 3300047444 Bacteria 891
317 Ga0495684_0325070 3300047471 Bacteria 1099
318 Ga0496102_0000096 3300048905 Bacteria 124941
319 Ga0496104_0000028 3300048907 Bacteria 203377
320 Ga0496107_0015300 3300048910 Bacteria 5377
321 Ga0496110_0000666 3300048913 Bacteria 23528
322 Ga0496111_0000229 3300048914 Bacteria 26736
323 Ga0496112_0091184 3300048915 Bacteria 3016
324 Ga0496112_0155289 3300048915 Bacteria 2255
325 Ga0501299_017677 3300049522 Bacteria 1275
326 Ga0501302_001665 3300049525 Unclassified 1231
327 Ga0501036_0243570 3300049572 Unclassified 1508
328 Ga0501039_0240854 3300049575 Archaea 1422
329 Ga0501040_0080181 3300049576 Unclassified 2261
330 Ga0501041_0158550 3300049577 Unclassified 1414
331 Ga0501042_0068034 3300049578 Archaea 2547
332 Ga0501075_0344791 3300049591 Bacteria 1135
333 Ga0501076_0081256 3300049592 Archaea 2602
334 Ga0501202_001144 3300049652 Bacteria 4153
335 Ga0501209_004741 3300049656 Bacteria 2392
336 Ga0501217_000524 3300049661 Bacteria 6378
337 Ga0501222_024902 3300049662 Unclassified 810
338 Ga0501223_027676 3300049663 Bacteria 1103
339 Ga0501227_066391 3300049665 Unclassified 932
340 Ga0501233_002849 3300049668 Bacteria 3077
341 Ga0501235_002703 3300049669 Bacteria 3812
342 Ga0501243_001400 3300049675 Bacteria 3445
343 Ga0501247_003919 3300049677 Bacteria 1612
344 Ga0501249_001247 3300049679 Bacteria 5336
345 Ga0501253_012918 3300049683 Bacteria 1319
346 Ga0501257_005920 3300049686 Bacteria 2707
347 Ga0501259_001399 3300049688 Bacteria 4028
348 Ga0501261_000952 3300049690 Bacteria 3572
349 Ga0501221_003817 3300049704 Bacteria 2486
350 Ga0501225_0000987 3300049705 Bacteria 8904
351 Ga0501229_002368 3300049706 Bacteria 2225
352 Ga0501234_000232 3300049707 Bacteria 8084
353 Ga0501081_0088418 3300049743 Archaea 2176
354 Ga0501266_003644 3300049763 Bacteria 1909
355 Ga0501268_000122 3300049765 Bacteria 6615
356 Ga0501268_022393 3300049765 Bacteria 1090
357 Ga0501270_000256 3300049767 Bacteria 4477
358 Ga0501274_001301 3300049771 Unclassified 1894
359 Ga0501045_0070942 3300049824 Archaea 2564
360 nmdc:mga05p37_68636_c1 3300050507 Bacteria 3157
361 nmdc:mga09592_336292_c1 3300050508 Bacteria 1307
362 nmdc:mga0n895_162680_c1 3300050512 Bacteria 2263
363 nmdc:mga0n895_301010_c1 3300050512 Bacteria 1626
364 nmdc:mga0rr50_355923_c1 3300050513 Bacteria 1232
365 nmdc:mga0rr50_388109_c1 3300050513 Bacteria 1178
366 nmdc:mga0rr50_75762_c1 3300050513 Bacteria 2580
367 nmdc:mga08x19_59587_c1 3300050514 Bacteria 2472
368 nmdc:mga08x19_730746_c1 3300050514 Bacteria 703
369 nmdc:mga0a205_119008_c1 3300050515 Bacteria 2540
370 nmdc:mga0a205_667327_c1 3300050515 Unclassified 890
371 Ga0495601_0063689 3300053077 Unclassified 2343
372 Ga0495595_0013790 3300053084 Unclassified 3419
373 Ga0495619_0022687 3300053085 Bacteria 4020
374 Ga0307413_10140555
375 Ga0065715_10002319
376 Ga0065715_10101223
377 Ga0070676_10031120
378 Ga0070683_100010300
379 Ga0070683_100031005
380 Ga0070683_100069418
381 Ga0070683_100227881
382 Ga0070683_100236318
383 Ga0070690_100057507
384 Ga0070690_100110705
385 Ga0070690_100445912
386 Ga0070666_10095035
387 Ga0070680_100004785
388 Ga0070680_100050217
389 Ga0070680_100121998
390 Ga0070680_100448724
391 Ga0070682_100003618
392 Ga0070682_100006098
393 Ga0070682_100014968
394 Ga0068868_100011563
395 Ga0068868_100107886
396 Ga0068868_100130984
397 Ga0070689_100078138
398 Ga0070689_100220589
399 Ga0070689_100342453
400 Ga0070691_10023804
401 Ga0070687_100014170
402 Ga0070661_100002807
403 Ga0070661_100283611
404 Ga0070692_10003965
405 Ga0070669_100051958
406 Ga0070669_100282192
407 Ga0070671_100306774
408 Ga0070674_100055746
409 Ga0070673_100016164
410 Ga0070673_100239044
411 Ga0070673_100421229
412 Ga0070659_100196211
413 Ga0070659_100370841
414 Ga0070667_100546144
415 Ga0070709_10019596
416 Ga0070714_100321950
417 Ga0070710_10031711
418 Ga0070711_100149117
419 Ga0070705_100013713
420 Ga0070705_100209225
421 Ga0070700_100160599
422 Ga0070700_100312943
423 Ga0070694_100020962
424 Ga0070694_100027003
425 Ga0070694_100080300
426 Ga0070694_100081512
427 Ga0070708_100000089
428 Ga0070708_100017611
429 Ga0070708_100097590
430 Ga0070663_100027687
431 Ga0070663_100292134
432 Ga0070678_100035559
433 Ga0070662_100026077
434 Ga0070681_10000910
435 Ga0070681_10022804
436 Ga0070681_10040559
437 Ga0070681_10087629
438 Ga0068867_100012683
439 Ga0070706_100077551
440 Ga0070706_100145736
441 Ga0070707_100002168
442 Ga0070707_100064505
443 Ga0070707_100316722
444 Ga0070707_100810400
445 Ga0070699_100062994
446 Ga0070699_100293953
447 Ga0070699_100306518
448 Ga0070699_100384332
449 Ga0070699_100706002
450 Ga0070679_100001686
451 Ga0070679_100014715
452 Ga0070679_100027749
453 Ga0070679_100132586
454 Ga0070684_100049724
455 Ga0070684_100122236
456 Ga0070684_100347815
457 Ga0070697_100187735
458 Ga0070697_100196469
459 Ga0070697_100406107
460 Ga0068853_100023792
461 Ga0070672_100024292
462 Ga0070686_100301563
463 Ga0070695_100033608
464 Ga0070695_100118188
465 Ga0070696_100013049
466 Ga0070696_100026251
467 Ga0070696_100027479
468 Ga0070696_100038093
469 Ga0070696_100172687
470 Ga0070693_100015216
471 Ga0070704_100020474
472 Ga0070704_100029965
473 Ga0068855_100721118
474 Ga0070664_100001672
475 Ga0070664_100290991
476 Ga0068854_100156456
477 Ga0068856_100085802
478 Ga0068856_100196645
479 Ga0068852_100388885
480 Ga0068864_100007438
481 Ga0068866_10037628
482 Ga0068866_10121588
483 Ga0068861_100714129
484 Ga0068863_100042851
485 Ga0068858_100750296
486 Ga0068860_100307102
487 Ga0068862_100686141
488 Ga0070716_100010663
489 Ga0070716_100067789
490 Ga0070716_100290238
491 Ga0075428_100304554
492 Ga0075431_100051369
493 Ga0075433_10168937
494 Ga0075434_100002929
495 Ga0068865_100012387
496 Ga0075436_100010818
497 Ga0075435_100253398
498 Ga0075435_100279848
499 Ga0099795_10204053
500 Ga0105240_10005188
501 Ga0105240_10020699
502 Ga0105240_10043453
503 Ga0105240_10096074
504 Ga0105240_10143058
505 Ga0105240_10226061
506 Ga0105240_10406250
507 Ga0105245_10011741
508 Ga0105245_10049077
509 Ga0105245_10112196
510 Ga0114129_10272321
511 Ga0105241_10001261
512 Ga0105241_10489603
513 Ga0105241_10744348
514 Ga0105242_10047103
515 Ga0105242_10086711
516 Ga0105242_10237888
517 Ga0105242_10819867
518 Ga0105242_11069310
519 Ga0105248_10276705
520 Ga0105238_10016672
521 Ga0105239_10317700
522 Ga0105246_10646237
523 Ga0157373_10067916
524 Ga0157370_10009063
525 Ga0157369_10039569
526 Ga0157369_10600681
527 Ga0157374_10156512
528 Ga0157378_10022863
529 Ga0157378_10060844
530 Ga0157378_10110656
531 Ga0157378_10271994
532 Ga0157372_10018535
533 Ga0157372_10041021
534 Ga0157372_10123710
535 Ga0157372_10165110
536 Ga0163163_10030700
537 Ga0206353_11114722
538 Ga0207692_10017803
539 Ga0207642_10039268
540 Ga0207642_10168635
541 Ga0207699_10019075
542 Ga0207699_10430655
543 Ga0207645_10004668
544 Ga0207705_10055275
545 Ga0207705_10416738
546 Ga0207684_10076837
547 Ga0207654_10000075
548 Ga0207654_10359562
549 Ga0207707_10026796
550 Ga0207707_10134237
551 Ga0207695_10003738
552 Ga0207695_10234122
553 Ga0207695_10269248
554 Ga0207695_10274163
555 Ga0207663_10266022
556 Ga0207660_10020400
557 Ga0207660_10033841
558 Ga0207660_10134427
559 Ga0207660_10233150
560 Ga0207662_10008439
561 Ga0207657_10016052
562 Ga0207657_10021288
563 Ga0207649_10047187
564 Ga0207649_10077800
565 Ga0207652_10006977
566 Ga0207652_10007404
567 Ga0207652_10012656
568 Ga0207646_10012166
569 Ga0207646_10162108
570 Ga0207646_10181685
571 Ga0207646_10336819
572 Ga0207646_10344905
573 Ga0207646_10403823
574 Ga0207681_10049366
575 Ga0207694_10003584
576 Ga0207687_10177940
577 Ga0207644_10076056
578 Ga0207690_10079481
579 Ga0207706_10006143
580 Ga0207686_10043821
581 Ga0207686_10062920
582 Ga0207686_10529722
583 Ga0207670_10183953
584 Ga0207669_10276585
585 Ga0207665_10000496
586 Ga0207665_10014346
587 Ga0207691_10289657
588 Ga0207711_10241561
589 Ga0207661_10102281
590 Ga0207661_10194705
591 Ga0207661_10440147
592 Ga0207679_10093380
593 Ga0207667_10015582
594 Ga0207667_10034931
595 Ga0207667_10425801
596 Ga0207667_10750573
597 Ga0207658_10232240
598 Ga0207677_10038102
599 Ga0207703_10807511
600 Ga0207639_10765678
601 Ga0207678_10014003
602 Ga0207678_10324930
603 Ga0207708_10019215
604 Ga0207708_10036489
605 Ga0207702_10070746
606 Ga0207702_10095471
607 Ga0207702_10642671
608 Ga0207648_10017580
609 Ga0207648_10052337
610 Ga0207676_10028681
611 Ga0207676_10098036
612 Ga0207683_10003908
613 Ga0207698_10047570
614 Ga0210000_1003057
615 Ga0209968_1010833
616 Ga0268265_10660182
617 Ga0268264_10363293
618 Ga0265326_10038292
619 Ga0265338_10093876
620 Ga0265327_10006970
621 Ga0265327_10024947
622 Ga0307408_100030009
623 Ga0307408_100039071
624 Ga0307408_100773975
625 Ga0307410_10025613
626 Ga0307410_10069462
627 Ga0307410_10085443
628 Ga0307410_10353795
629 Ga0307410_10680445
630 Ga0307406_10018806
631 Ga0307406_10038318
632 Ga0307406_10384767
633 Ga0307406_10619295
634 Ga0307407_10022651
635 Ga0307412_10003888
636 Ga0307412_10032495
637 Ga0307412_10418289
638 Ga0307409_100018773
639 Ga0307409_100105072
640 Ga0307409_100483185
641 Ga0307409_100803130
642 Ga0307409_100864467
643 Ga0307416_100018015
644 Ga0307416_100062549
645 Ga0307416_100693826
646 Ga0307416_101253387
647 Ga0307416_101344132
648 Ga0307414_10307788
649 Ga0307414_10403788
650 Ga0307414_10405834
651 Ga0307411_10000515
652 Ga0307411_10243521
653 Ga0307415_100272000
654 Ga0373944_0037638
655 Ga0373941_0055021
656 Ga0373943_0046445
657 Ga0373931_0179109
658 Ga0373935_0050644
659 Ga0373937_0031150
660 Ga0373925_0406380
661 Ga0451807_2763979
662 Ga0451853_1553639
663 Ga0466966_0054842
664 Ga0466966_0200304
665 Ga0466959_0048151
666 Ga0451576_0890228
667 Ga0451576_0979462
668 Ga0495592_0039306
669 Ga0495653_0128381
670 Ga0495664_0028182
671 Ga0495608_0065643
672 Ga0495618_0119308
673 Ga0495642_0036796
674 Ga0495652_0270989
675 Ga0495640_0073023
676 Ga0495586_0121103
677 Ga0495598_0159440
678 Ga0495645_0007378
679 Ga0495667_0012963
680 Ga0495634_0055832
681 Ga0495599_0044733
682 Ga0495646_0170149
683 Ga0495613_0149896
684 Ga0495600_0073926
685 Ga0495604_0001012
686 Ga0495674_0091811
687 Ga0495680_0364855
688 Ga0495675_0048954
689 Ga0495675_0336126
690 Ga0495684_0325070
691 Ga0496102_0000096
692 Ga0496104_0000028
693 Ga0496107_0015300
694 Ga0496110_0000666
695 Ga0496111_0000229
696 Ga0496112_0091184
697 Ga0496112_0155289
698 Ga0501299_017677
699 Ga0501302_001665
700 Ga0501036_0243570
701 Ga0501039_0240854
702 Ga0501040_0080181
703 Ga0501041_0158550
704 Ga0501042_0068034
705 Ga0501075_0344791
706 Ga0501076_0081256
707 Ga0501202_001144
708 Ga0501209_004741
709 Ga0501217_000524
710 Ga0501222_024902
711 Ga0501223_027676
712 Ga0501227_066391
713 Ga0501233_002849
714 Ga0501235_002703
715 Ga0501243_001400
716 Ga0501247_003919
717 Ga0501249_001247
718 Ga0501253_012918
719 Ga0501257_005920
720 Ga0501259_001399
721 Ga0501261_000952
722 Ga0501221_003817
723 Ga0501225_0000987
724 Ga0501229_002368
725 Ga0501234_000232
726 Ga0501081_0088418
727 Ga0501266_003644
728 Ga0501268_000122
729 Ga0501268_022393
730 Ga0501270_000256
731 Ga0501274_001301
732 Ga0501045_0070942
733 nmdc:mga05p37_68636_c1
734 nmdc:mga09592_336292_c1
735 nmdc:mga0n895_162680_c1
736 nmdc:mga0n895_301010_c1
737 nmdc:mga0rr50_355923_c1
738 nmdc:mga0rr50_388109_c1
739 nmdc:mga0rr50_75762_c1
740 nmdc:mga08x19_59587_c1
741 nmdc:mga08x19_730746_c1
742 nmdc:mga0a205_119008_c1
743 nmdc:mga0a205_667327_c1
744 Ga0495601_0063689
745 Ga0495595_0013790
746 Ga0495619_0022687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

1

215

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ne2-assembly1.cif.gz_D archaeoglobus fulgidus aquaporin 0.9554 7 219
7cjs-assembly2.cif.gz_E structure of aquaporin 0.9531 4 218
2evu-assembly1.cif.gz_A crystal structure of aquaporin aqpm at 2.3a resolution 0.9515 4 218
3m9i-assembly1.cif.gz_A electron crystallographic structure of lens aquaporin-0 (aqp0) (lens mip) in e. coli polar lipids 0.9443 3 222
3d9s-assembly1.cif.gz_D human aquaporin 5 (aqp5) - high resolution x-ray structure 0.9361 1 219
ID Description Score Start End Superfamily
3ne2C00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.96 7 219 1.20.1080.10
af_Q54V53_9_255_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9589 2 219 1.20.1080.10
af_Q9U8P7_29_262_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9527 3 222 1.20.1080.10
af_Q84S07_26_278_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9491 4 215 1.20.1080.10
af_Q9ATN2_41_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9435 4 218 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A1Q7QHD5-F1-model_v4 Aquaporin 0.9977 1 208 GO:0005737
GO:0005886
GO:0012505
GO:0015250
GO:0043231
AF-A0A2V7UQ94-F1-model_v4 Aquaporin 0.9888 6 222 GO:0005737
GO:0012505
GO:0015250
GO:0016020
GO:0043231
AF-A0A1Q7QHD5-F1-model_v4 Aquaporin 0.9882 1 208 GO:0005737
GO:0005886
GO:0012505
GO:0015250
GO:0043231
AF-A0A7W0YJM3-F1-model_v4 Aquaporin 0.9866 4 218 GO:0005886
GO:0015250
AF-A0A355B4R0-F1-model_v4 Aquaporin 0.9862 1 222 GO:0005886
GO:0015250

Map