F426394

General Info

Members Datasets Scaffolds Average Seq Length
373 240 350 254

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10162348|Ga0307515_101623482
Length 272
Sequence MTTAASASAGTASTPQATGSIPLGKLYLVPAPLDFGCPTESPLQDVMPLGTLQAAARLQHWICENAKTTRAYLKRINAVVPLTHAVQQQLLVELPHAVHKKGDHAAGFDAAPLLAPALQGHDMGLVSEAGMPAVADPGSSVVRAAHTLGIAVVPLSGPTSLLLALAASGLNGQNFAFVGYLPQDAEERTQRIRSLESLALKTGQTQLFIETPYRSATLHKALVQALQHNTRLAVCGSLTLASAHIESRAIKEWRQRETAPTADMPTVFAIGR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221658 Variovorax sp. Root411 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221683 Variovorax sp. Root473 Isolate Unclassified
10 2818991446 Variovorax sp. 1180 Isolate Unclassified
11 2885198086 Variovorax sp. 679 Isolate Unclassified
12 2885211737 Variovorax sp. 553 Isolate Unclassified
13 2899924645 Variovorax sp. 369 Isolate Unclassified
14 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
15 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
16 2928037797 Variovorax sp. 1126 Isolate Unclassified
17 2928044640 Variovorax sp. 1128 Isolate Unclassified
18 2928051484 Variovorax sp. 1133 Isolate Unclassified
19 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
20 2928070936 Variovorax gossypii 1167 Isolate Unclassified
21 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
22 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
23 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
24 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
45 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
137 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
138 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
158 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
162 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
174 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
175 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
176 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
177 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
178 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
216 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
217 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
233 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
234 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
235 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
236 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
237 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.83
Metatranscriptomes 0
Isolates 6.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.53
Nodule 0
Rhizoplane 4.02
Rhizosphere 42.63
Stem 0
Stem Tuber 0
Unclassified 15.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000041 3300002704 Bacteria 88843
2 JGI25156J39149_1000031 3300002705 Bacteria 124983
3 JGI25154J39366_1000049 3300002738 Bacteria 124995
4 JGI25157J39369_1000041 3300002741 Bacteria 124982
5 JGI25152J39213_1001798 3300002773 Bacteria 8687
6 JGI25150J39212_1007756 3300002774 Bacteria 2141
7 JGI25150J39212_1010654 3300002774 Bacteria 1699
8 JGI25159J45721_1003228 3300002987 Bacteria 5845
9 JGI25159J45721_1003296 3300002987 Bacteria 5772
10 JGI25159J45721_1003743 3300002987 Bacteria 5264
11 JGI25151J46595_10001970 3300003187 Bacteria 12925
12 JGI25151J46595_10003483 3300003187 Bacteria 8687
13 JGI25151J46595_10005666 3300003187 Bacteria 6419
14 JGI25153J46596_10006723 3300003215 Bacteria 5772
15 rootH1_10093713 3300003316 Bacteria 3145
16 rootH2_10078387 3300003320 Bacteria 1566
17 rootH1_10009766 3300003323 Bacteria 3641
18 JGI25160J50197_1000784 3300003354 Bacteria 17048
19 JGI25160J50197_1004782 3300003354 Bacteria 5782
20 JGI25161J50226_1000042 3300003374 Bacteria 123841
21 JGI25161J50226_1002467 3300003374 Bacteria 4719
22 Ga0055535_1000318 3300003761 Bacteria 48605
23 Ga0055542_1000022 3300003762 Bacteria 302315
24 Ga0055526_1006294 3300003771 Bacteria 6493
25 Ga0055526_1007436 3300003771 Bacteria 5690
26 Ga0055526_1010081 3300003771 Bacteria 4443
27 Ga0055537_1000897 3300003773 Bacteria 14118
28 Ga0055537_1002319 3300003773 Bacteria 6493
29 Ga0055537_1013081 3300003773 Bacteria 1579
30 Ga0055524_1000260 3300003775 Bacteria 53486
31 Ga0055524_1004409 3300003775 Bacteria 6493
32 Ga0055536_1002928 3300003781 Bacteria 9378
33 Ga0055536_1003508 3300003781 Bacteria 8398
34 Ga0055536_1031308 3300003781 Bacteria 1395
35 Ga0055534_1001045 3300003784 Bacteria 12098
36 Ga0055534_1002838 3300003784 Bacteria 5772
37 Ga0055528_1003019 3300003790 Bacteria 8687
38 Ga0055528_1003352 3300003790 Bacteria 8097
39 Ga0055528_1023832 3300003790 Bacteria 1853
40 Ga0055530_10003666 3300003791 Bacteria 8587
41 Ga0055530_10005618 3300003791 Bacteria 5879
42 Ga0055540_1000010 3300003792 Bacteria 290865
43 Ga0055540_1003754 3300003792 Bacteria 7172
44 Ga0055540_1007484 3300003792 Bacteria 4108
45 Ga0055531_10001065 3300003794 Bacteria 21587
46 Ga0055531_10001947 3300003794 Bacteria 14432
47 Ga0055531_10002840 3300003794 Bacteria 11339
48 Ga0055531_10008583 3300003794 Bacteria 5360
49 Ga0055543_1000279 3300004625 Bacteria 37669
50 Ga0055543_1001420 3300004625 Bacteria 9511
51 Ga0065165_1004355 3300005262 Bacteria 8865
52 Ga0070658_10153479 3300005327 Bacteria 1929
53 Ga0068869_100191555 3300005334 Bacteria 1608
54 Ga0070661_100084986 3300005344 Bacteria 2338
55 Ga0070673_100432841 3300005364 Bacteria 1181
56 Ga0070667_100136373 3300005367 Bacteria 2146
57 Ga0070678_100219059 3300005456 Bacteria 1581
58 Ga0070662_100005674 3300005457 Bacteria 7988
59 Ga0070706_100836735 3300005467 Bacteria 851
60 Ga0070699_100402997 3300005518 Bacteria 1237
61 Ga0068853_100009116 3300005539 Bacteria 7992
62 Ga0068853_100198742 3300005539 Bacteria 1824
63 Ga0070665_100116553 3300005548 Bacteria 2674
64 Ga0070664_100034414 3300005564 Bacteria 4250
65 Ga0068864_100077734 3300005618 Bacteria 2903
66 Ga0068851_10005357 3300005834 Bacteria 5819
67 Ga0068870_10363045 3300005840 Bacteria 932
68 Ga0068863_100063499 3300005841 Bacteria 3493
69 Ga0075363_100100881 3300006048 Bacteria 1597
70 Ga0075363_100279268 3300006048 Bacteria 966
71 Ga0075364_10150593 3300006051 Bacteria 1568
72 Ga0075362_10051639 3300006177 Bacteria 1841
73 Ga0075362_10165392 3300006177 Bacteria 1067
74 Ga0075367_10025653 3300006178 Bacteria 3335
75 Ga0075369_10117415 3300006186 Bacteria 1203
76 Ga0075366_10000297 3300006195 Bacteria 22376
77 Ga0075366_10016800 3300006195 Bacteria 4206
78 Ga0097621_100087617 3300006237 Bacteria 2600
79 Ga0075370_10000267 3300006353 Bacteria 18755
80 Ga0075370_10006067 3300006353 Bacteria 6056
81 Ga0105244_10008459 3300009036 Bacteria 6423
82 Ga0105244_10154368 3300009036 Bacteria 1099
83 Ga0105240_10064612 3300009093 Bacteria 4546
84 Ga0105243_10003383 3300009148 Bacteria 12940
85 Ga0105243_10004252 3300009148 Bacteria 11346
86 Ga0105242_10557684 3300009176 Bacteria 1100
87 Ga0105237_10001228 3300009545 Bacteria 34145
88 Ga0105237_10071047 3300009545 Bacteria 3476
89 Ga0105238_10089206 3300009551 Bacteria 3070
90 Ga0105238_10429720 3300009551 Bacteria 1316
91 Ga0105239_10001198 3300010375 Bacteria 35468
92 Ga0105239_10050383 3300010375 Bacteria 4567
93 Ga0157326_1001298 3300012513 Bacteria 2767
94 Ga0157373_10083804 3300013100 Bacteria 2247
95 Ga0157371_10107402 3300013102 Bacteria 1981
96 Ga0157369_10015870 3300013105 Bacteria 8481
97 Ga0182008_10010434 3300014497 Bacteria 4971
98 Ga0182008_10032213 3300014497 Bacteria 2634
99 Ga0182006_1003408 3300015261 Bacteria 8135
100 Ga0182006_1020976 3300015261 Bacteria 2730
101 Ga0182007_10001502 3300015262 Bacteria 12469
102 Ga0182007_10007465 3300015262 Bacteria 4580
103 Ga0183362_10001 3300015683 Bacteria 2046624
104 Ga0163161_10002694 3300017792 Bacteria 12628
105 Ga0163161_10078378 3300017792 Bacteria 2428
106 Ga0163161_10102857 3300017792 Bacteria 2128
107 Ga0213872_10002408 3300021361 Bacteria 11037
108 Ga0209435_100014 3300025206 Bacteria 322129
109 Ga0209436_105494 3300025208 Bacteria 2908
110 Ga0209436_106933 3300025208 Bacteria 2421
111 Ga0209672_100273 3300025228 Bacteria 37687
112 Ga0209258_100009 3300025242 Bacteria 996276
113 Ga0207425_1000634 3300025245 Bacteria 19867
114 Ga0207425_1000913 3300025245 Bacteria 14131
115 Ga0207425_1002429 3300025245 Bacteria 6559
116 Ga0209646_1000001 3300025246 Bacteria 3092932
117 Ga0209026_1000073 3300025250 Bacteria 205399
118 Ga0209148_1000007 3300025254 Bacteria 1592273
119 Ga0209759_1000013 3300025256 Bacteria 399300
120 Ga0209129_1000024 3300025258 Bacteria 417268
121 Ga0209129_1000085 3300025258 Bacteria 181765
122 Ga0209129_1000712 3300025258 Bacteria 21452
123 Ga0209129_1013304 3300025258 Bacteria 1821
124 Ga0209565_1000462 3300025263 Bacteria 30996
125 Ga0209565_1000726 3300025263 Bacteria 19869
126 Ga0209565_1000981 3300025263 Bacteria 14683
127 Ga0209673_1000008 3300025273 Bacteria 626013
128 Ga0209673_1001121 3300025273 Bacteria 29844
129 Ga0209673_1012218 3300025273 Bacteria 3478
130 Ga0209130_1000216 3300025284 Bacteria 75536
131 Ga0209130_1000283 3300025284 Bacteria 62554
132 Ga0209130_1004700 3300025284 Bacteria 5056
133 Ga0209675_1000400 3300025291 Bacteria 35775
134 Ga0209675_1000451 3300025291 Bacteria 31851
135 Ga0209675_1004272 3300025291 Bacteria 6428
136 Ga0209675_1043022 3300025291 Bacteria 975
137 Ga0209676_1000007 3300025292 Bacteria 1029371
138 Ga0209676_1001037 3300025292 Bacteria 32207
139 Ga0209676_1002496 3300025292 Bacteria 12896
140 Ga0209676_1004230 3300025292 Bacteria 8120
141 Ga0209676_1007185 3300025292 Bacteria 5309
142 Ga0209025_1000122 3300025294 Bacteria 206064
143 Ga0209025_1004892 3300025294 Bacteria 11282
144 Ga0209025_1009796 3300025294 Bacteria 6612
145 Ga0209025_1028923 3300025294 Bacteria 2698
146 Ga0209564_1000481 3300025295 Bacteria 66411
147 Ga0209564_1002817 3300025295 Bacteria 12908
148 Ga0209564_1004210 3300025295 Bacteria 8969
149 Ga0209564_1007422 3300025295 Bacteria 5668
150 Ga0209758_1000049 3300025297 Bacteria 345104
151 Ga0209758_1015297 3300025297 Bacteria 3988
152 Ga0209050_1000003 3300025298 Bacteria 1609245
153 Ga0209050_1003073 3300025298 Bacteria 12832
154 Ga0209050_1006209 3300025298 Bacteria 7168
155 Ga0209050_1017680 3300025298 Bacteria 2822
156 Ga0209256_1000001 3300025299 Bacteria 2166974
157 Ga0209256_1000464 3300025299 Bacteria 61298
158 Ga0207426_1000053 3300025302 Bacteria 384818
159 Ga0207426_1000117 3300025302 Bacteria 224652
160 Ga0207426_1001659 3300025302 Bacteria 17304
161 Ga0207426_1042319 3300025302 Bacteria 1406
162 Ga0209051_1000003 3300025303 Bacteria 1609245
163 Ga0209051_1000244 3300025303 Bacteria 91505
164 Ga0209051_1000590 3300025303 Bacteria 42835
165 Ga0209051_1001261 3300025303 Bacteria 22610
166 Ga0209051_1015163 3300025303 Bacteria 3557
167 Ga0209051_1048089 3300025303 Bacteria 1450
168 Ga0209257_1000020 3300025304 Bacteria 773356
169 Ga0209257_1000144 3300025304 Bacteria 197078
170 Ga0209257_1001281 3300025304 Bacteria 30768
171 Ga0209257_1005583 3300025304 Bacteria 8739
172 Ga0209257_1006011 3300025304 Bacteria 8114
173 Ga0207656_10016717 3300025321 Bacteria 2860
174 Ga0207655_1009405 3300025728 Bacteria 6072
175 Ga0207684_10385869 3300025910 Bacteria 1204
176 Ga0207695_10022030 3300025913 Bacteria 7250
177 Ga0207671_10006366 3300025914 Bacteria 10529
178 Ga0207671_10043992 3300025914 Bacteria 3302
179 Ga0207649_10228391 3300025920 Bacteria 1330
180 Ga0207694_10129964 3300025924 Bacteria 2018
181 Ga0207650_10120506 3300025925 Bacteria 2042
182 Ga0207659_10352870 3300025926 Bacteria 1221
183 Ga0207706_10024633 3300025933 Bacteria 5393
184 Ga0207709_10001402 3300025935 Bacteria 16855
185 Ga0207709_10001990 3300025935 Bacteria 13285
186 Ga0207689_10120963 3300025942 Bacteria 2154
187 Ga0207679_10271143 3300025945 Bacteria 1451
188 Ga0207658_10259195 3300025986 Bacteria 1481
189 Ga0207677_10270562 3300026023 Bacteria 1390
190 Ga0207639_10012850 3300026041 Bacteria 5841
191 Ga0207639_10069038 3300026041 Bacteria 2756
192 Ga0207639_10475532 3300026041 Bacteria 1138
193 Ga0207641_10052621 3300026088 Bacteria 3449
194 Ga0207676_10084834 3300026095 Bacteria 2583
195 Ga0207674_10110478 3300026116 Bacteria 2724
196 Ga0207674_10224338 3300026116 Bacteria 1828
197 Ga0207683_10054574 3300026121 Bacteria 3503
198 Ga0207683_10059893 3300026121 Bacteria 3345
199 Ga0307515_10000084 3300028794 Bacteria 221434
200 Ga0307515_10000265 3300028794 Bacteria 129554
201 Ga0307515_10162348 3300028794 Bacteria 2271
202 Ga0307515_10166590 3300028794 Bacteria 2218
203 Ga0316176_1153216 3300030732 Bacteria 3508
204 Ga0314311_1138037 3300030733 Bacteria 6598
205 Ga0316181_1029402 3300030744 Bacteria 4428
206 Ga0316181_1124666 3300030744 Bacteria 1260
207 Ga0265332_10000009 3300031238 Bacteria 295760
208 Ga0307513_10000008 3300031456 Bacteria 442128
209 Ga0307513_10000020 3300031456 Bacteria 228745
210 Ga0307513_10011348 3300031456 Bacteria 11079
211 Ga0307513_10067372 3300031456 Bacteria 3756
212 Ga0307513_10247911 3300031456 Bacteria 1580
213 Ga0307408_100214839 3300031548 Bacteria 1565
214 Ga0307514_10000319 3300031649 Bacteria 115327
215 Ga0307516_10038615 3300031730 Bacteria 4763
216 Ga0307516_10087109 3300031730 Bacteria 2958
217 Ga0307405_10032514 3300031731 Bacteria 3084
218 Ga0307405_10051983 3300031731 Bacteria 2545
219 Ga0307405_10656399 3300031731 Bacteria 863
220 Ga0307410_10087248 3300031852 Bacteria 2206
221 Ga0307407_10026293 3300031903 Bacteria 3079
222 Ga0307412_10019027 3300031911 Bacteria 4147
223 Ga0307412_10044107 3300031911 Bacteria 2908
224 Ga0307412_10047042 3300031911 Bacteria 2831
225 Ga0307412_10089364 3300031911 Unclassified 2151
226 Ga0307412_10108976 3300031911 Bacteria 1973
227 Ga0307416_100032204 3300032002 Bacteria 3958
228 Ga0307416_100683915 3300032002 Bacteria 1114
229 Ga0307416_100791338 3300032002 Bacteria 1043
230 Ga0307414_10074346 3300032004 Bacteria 2462
231 Ga0307411_10176502 3300032005 Bacteria 1617
232 Ga0395900_0377318 3300037418 Bacteria 1387
233 Ga0395905_0000407 3300037471 Bacteria 60417
234 Ga0395905_0025835 3300037471 Bacteria 5536
235 Ga0395905_0232776 3300037471 Bacteria 1722
236 Ga0395901_0053128 3300038443 Bacteria 4210
237 Ga0436365_1259853 3300039437 Bacteria 864
238 Ga0436361_0508128 3300039447 Bacteria 12467
239 Ga0439436_0000627 3300041404 Bacteria 9380
240 Ga0439436_0050116 3300041404 Bacteria 1182
241 Ga0439439_0002282 3300041406 Bacteria 4042
242 Ga0439461_0030302 3300041410 Bacteria 1124
243 Ga0439466_0020103 3300041411 Bacteria 2384
244 Ga0439465_0000048 3300041413 Bacteria 25346
245 Ga0451797_0830558 3300041453 Bacteria 1319
246 Ga0451841_0258959 3300041498 Bacteria 1135
247 Ga0439431_0042150 3300041997 Bacteria 1165
248 Ga0439433_0000329 3300041999 Bacteria 8358
249 Ga0439433_0006960 3300041999 Bacteria 2440
250 Ga0439442_028121 3300042002 Bacteria 1172
251 Ga0439445_0000168 3300042004 Bacteria 11631
252 Ga0439445_0005208 3300042004 Bacteria 2958
253 Ga0439432_000367 3300042006 Bacteria 16615
254 Ga0439432_003793 3300042006 Bacteria 5577
255 Ga0439449_0001686 3300042007 Bacteria 8697
256 Ga0439449_0004433 3300042007 Bacteria 5415
257 Ga0439452_002658 3300042010 Bacteria 6500
258 Ga0439454_006066 3300042011 Bacteria 1471
259 Ga0439457_003657 3300042014 Bacteria 4158
260 Ga0439462_0002246 3300042015 Bacteria 4461
261 Ga0450911_002997 3300042115 Bacteria 3109
262 Ga0450923_019813 3300042125 Bacteria 1299
263 Ga0450897_000341 3300042128 Bacteria 2497
264 Ga0450898_000725 3300042134 Bacteria 4009
265 Ga0450898_002278 3300042134 Bacteria 2671
266 Ga0450899_002166 3300042135 Bacteria 2141
267 Ga0450909_002317 3300042185 Bacteria 2697
268 Ga0439434_0001056 3300042435 Bacteria 7992
269 Ga0451577_0001712 3300042876 Bacteria 28299
270 Ga0451577_0008035 3300042876 Bacteria 10299
271 Ga0453683_0003564 3300044673 Bacteria 11430
272 Ga0453683_0012675 3300044673 Bacteria 5523
273 Ga0451576_0016175 3300045051 Bacteria 8242
274 Ga0451576_0359505 3300045051 Bacteria 1525
275 Ga0451576_0438065 3300045051 Bacteria 1371
276 Ga0495639_0001431 3300046475 Bacteria 10666
277 Ga0495637_0022626 3300046520 Bacteria 2865
278 Ga0495663_0092121 3300046525 Bacteria 989
279 Ga0495621_0116915 3300046539 Bacteria 1027
280 Ga0495633_0001452 3300046558 Bacteria 18400
281 Ga0495625_0000870 3300046660 Bacteria 41078
282 Ga0495588_0022426 3300046674 Bacteria 3121
283 Ga0495588_0121551 3300046674 Bacteria 1376
284 Ga0495676_0001289 3300047321 Bacteria 21493
285 Ga0495593_0011016 3300047673 Bacteria 5205
286 Ga0496101_0000603 3300048904 Bacteria 21918
287 Ga0496102_0185200 3300048905 Bacteria 1962
288 Ga0496103_0034608 3300048906 Bacteria 3090
289 Ga0496104_0001576 3300048907 Bacteria 19615
290 Ga0496105_0019069 3300048908 Bacteria 5529
291 Ga0496107_0100564 3300048910 Bacteria 2120
292 Ga0496109_0341698 3300048912 Bacteria 1414
293 Ga0496110_0041333 3300048913 Bacteria 4022
294 Ga0496111_0074325 3300048914 Bacteria 2475
295 Ga0496113_0124918 3300048916 Bacteria 2014
296 Ga0496114_0140011 3300048917 Bacteria 2094
297 Ga0496116_0076751 3300048919 Bacteria 2091
298 Ga0496118_0003992 3300048921 Bacteria 17979
299 Ga0496121_0016475 3300048924 Bacteria 7630
300 Ga0496122_0000998 3300048925 Bacteria 50283
301 Ga0496122_0046931 3300048925 Bacteria 3340
302 Ga0496122_0047920 3300048925 Bacteria 3292
303 Ga0496122_0088810 3300048925 Bacteria 2116
304 Ga0496122_0177335 3300048925 Bacteria 1276
305 Ga0496123_0000045 3300048926 Bacteria 249294
306 Ga0496123_0033063 3300048926 Bacteria 3729
307 Ga0496123_0155672 3300048926 Bacteria 1226
308 Ga0496124_0025144 3300048927 Bacteria 5398
309 Ga0496124_0050300 3300048927 Bacteria 3552
310 Ga0496124_0063559 3300048927 Bacteria 3083
311 Ga0496124_0225754 3300048927 Bacteria 1404
312 Ga0496125_0003109 3300048928 Bacteria 20660
313 Ga0496125_0004135 3300048928 Bacteria 16946
314 Ga0496125_0020259 3300048928 Bacteria 6245
315 Ga0496125_0023409 3300048928 Bacteria 5701
316 Ga0496125_0056621 3300048928 Bacteria 3182
317 Ga0496126_0026944 3300048929 Bacteria 5501
318 Ga0501031_0001847 3300049568 Bacteria 13324
319 Ga0501033_0085527 3300049570 Bacteria 2310
320 Ga0501037_0150161 3300049573 Bacteria 1666
321 Ga0501043_0396173 3300049579 Bacteria 1044
322 Ga0501198_000001 3300049649 Bacteria 234552
323 Ga0501222_000004 3300049662 Bacteria 136139
324 Ga0501262_006399 3300049759 Bacteria 1408
325 Ga0501035_0159065 3300049822 Bacteria 1956
326 Ga0501044_0235351 3300049823 Bacteria 1777
327 nmdc:mga03683_22103_c1 3300050489 Bacteria 2462
328 nmdc:mga03n38_6316_c1 3300050490 Bacteria 4108
329 nmdc:mga03n38_65252_c1 3300050490 Bacteria 1669
330 nmdc:mga0yw44_321304_c1 3300050492 Bacteria 1039
331 nmdc:mga0k408_2216_c1 3300050493 Bacteria 10412
332 nmdc:mga04h51_64654_c1 3300050495 Bacteria 1262
333 nmdc:mga07m45_2457_c1 3300050496 Bacteria 8697
334 nmdc:mga0qj67_438903_c1 3300050509 Bacteria 1052
335 Ga0500651_0000069 3300053093 Bacteria 67505
336 Ga0500651_0041847 3300053093 Bacteria 2888
337 Ga0500566_0048515 3300053094 Bacteria 2434
338 Ga0500562_039607 3300053108 Bacteria 1252
339 Ga0500571_000059 3300053110 Bacteria 33280
340 Ga0500593_000342 3300053117 Bacteria 18749
341 Ga0500597_082596 3300053120 Bacteria 1394
342 Ga0500628_002321 3300053129 Bacteria 3156
343 Ga0500655_002237 3300053133 Bacteria 3557
344 Ga0500658_0029580 3300053134 Bacteria 2131
345 Ga0500564_014932 3300053138 Bacteria 3500
346 Ga0500577_0050573 3300053142 Bacteria 1559
347 Ga0500616_0165044 3300053153 Bacteria 1011
348 Ga0500636_0092444 3300053177 Bacteria 1731
349 Ga0500645_002479 3300053730 Bacteria 8193
350 Ga0500645_003847 3300053730 Bacteria 5948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042125 Ga0450923_019813 Ga0450923_019813_25_693 220
2 3300041406 Ga0439439_0002282 Ga0439439_0002282_59_742 224
3 3300050490 nmdc:mga03n38_6316_c1 nmdc:mga03n38_6316_c1_30_713 224
4 3300053153 Ga0500616_0165044 Ga0500616_0165044_268_948 225
5 3300050495 nmdc:mga04h51_64654_c1 nmdc:mga04h51_64654_c1_93_779 226
6 3300041410 Ga0439461_0030302 Ga0439461_0030302_14_715 231
7 3300041413 Ga0439465_0000048 Ga0439465_0000048_10829_11587 237
8 3300041997 Ga0439431_0042150 Ga0439431_0042150_174_932 237
9 3300041999 Ga0439433_0000329 Ga0439433_0000329_851_1609 237
10 3300042004 Ga0439445_0000168 Ga0439445_0000168_5273_6031 237
11 3300042006 Ga0439432_000367 Ga0439432_000367_5906_6664 237
12 3300042010 Ga0439452_002658 Ga0439452_002658_696_1454 237
13 3300042014 Ga0439457_003657 Ga0439457_003657_2582_3340 237
14 3300042015 Ga0439462_0002246 Ga0439462_0002246_2072_2830 237
15 3300042435 Ga0439434_0001056 Ga0439434_0001056_2799_3557 237
16 3300046525 Ga0495663_0092121 Ga0495663_0092121_72_854 241
17 3300046558 Ga0495633_0001452 Ga0495633_0001452_11981_12763 241
18 3300045051 Ga0451576_0359505 Ga0451576_0359505_165_932 244
19 3300053108 Ga0500562_039607 Ga0500562_039607_386_1153 244
20 3300031911 Ga0307412_10089364 Ga0307412_100893642 245
21 iso_pu_bacteria 2643221628 2644162380 247
22 iso_pu_bacteria 2945909444 2945913676 247
23 iso_pu_bacteria 2945984333 2945990926 247
24 3300048925 Ga0496122_0177335 Ga0496122_0177335_417_1199 248
25 3300049649 Ga0501198_000001 Ga0501198_000001_132168_132932 248
26 3300049662 Ga0501222_000004 Ga0501222_000004_121144_121908 248
27 iso_pu_bacteria 2919462493 2919462926 248
28 iso_pu_bacteria 2919704043 2919707234 248
29 3300042876 Ga0451577_0001712 Ga0451577_0001712_20663_21427 249
30 iso_pu_bacteria 2643221683 2644464569 249
31 3300005456 Ga0070678_100219059 Ga0070678_1002190592 250
32 3300005548 Ga0070665_100116553 Ga0070665_1001165532 250
33 3300006178 Ga0075367_10025653 Ga0075367_100256535 250
34 3300006195 Ga0075366_10016800 Ga0075366_100168002 250
35 3300006353 Ga0075370_10000267 Ga0075370_1000026713 250
36 3300009093 Ga0105240_10064612 Ga0105240_100646125 250
37 3300009545 Ga0105237_10001228 Ga0105237_1000122835 250
38 3300009551 Ga0105238_10089206 Ga0105238_100892065 250
39 3300010375 Ga0105239_10001198 Ga0105239_100011983 250
40 3300025913 Ga0207695_10022030 Ga0207695_100220305 250
41 3300025914 Ga0207671_10006366 Ga0207671_100063665 250
42 3300026041 Ga0207639_10475532 Ga0207639_104755322 250
43 3300026121 Ga0207683_10054574 Ga0207683_100545745 250
44 3300028794 Ga0307515_10000265 Ga0307515_1000026564 250
45 3300031456 Ga0307513_10247911 Ga0307513_102479112 250
46 3300031548 Ga0307408_100214839 Ga0307408_1002148393 250
47 3300031731 Ga0307405_10051983 Ga0307405_100519832 250
48 3300031911 Ga0307412_10108976 Ga0307412_101089762 250
49 3300032004 Ga0307414_10074346 Ga0307414_100743462 250
50 3300032005 Ga0307411_10176502 Ga0307411_101765022 250
51 3300041404 Ga0439436_0000627 Ga0439436_0000627_4283_5044 250
52 3300041404 Ga0439436_0050116 Ga0439436_0050116_373_1131 250
53 3300041411 Ga0439466_0020103 Ga0439466_0020103_431_1192 250
54 3300041999 Ga0439433_0006960 Ga0439433_0006960_1481_2242 250
55 3300042002 Ga0439442_028121 Ga0439442_028121_107_868 250
56 3300042004 Ga0439445_0005208 Ga0439445_0005208_567_1328 250
57 3300042006 Ga0439432_003793 Ga0439432_003793_2147_2908 250
58 3300042007 Ga0439449_0001686 Ga0439449_0001686_447_1208 250
59 3300042007 Ga0439449_0004433 Ga0439449_0004433_61_819 250
60 3300042011 Ga0439454_006066 Ga0439454_006066_618_1379 250
61 3300042115 Ga0450911_002997 Ga0450911_002997_1130_1882 250
62 3300042128 Ga0450897_000341 Ga0450897_000341_1548_2309 250
63 3300042134 Ga0450898_000725 Ga0450898_000725_1235_1996 250
64 3300042134 Ga0450898_002278 Ga0450898_002278_930_1688 250
65 3300042135 Ga0450899_002166 Ga0450899_002166_222_983 250
66 3300042185 Ga0450909_002317 Ga0450909_002317_445_1203 250
67 3300048924 Ga0496121_0016475 Ga0496121_0016475_781_1533 250
68 3300048927 Ga0496124_0063559 Ga0496124_0063559_208_960 250
69 3300048928 Ga0496125_0003109 Ga0496125_0003109_4220_4972 250
70 3300048928 Ga0496125_0020259 Ga0496125_0020259_4657_5409 250
71 3300048928 Ga0496125_0023409 Ga0496125_0023409_122_874 250
72 3300050492 nmdc:mga0yw44_321304_c1 nmdc:mga0yw44_321304_c1_271_1026 250
73 iso_pu_bacteria 2643221658 2644324546 250
74 iso_pu_bacteria 2643221672 2644396398 250
75 iso_pu_bacteria 2932422444 2932423747 250
76 3300003320 rootH2_10078387 rootH2_100783871 251
77 3300003790 Ga0055528_1023832 Ga0055528_10238322 251
78 3300003792 Ga0055540_1007484 Ga0055540_10074845 251
79 3300003794 Ga0055531_10001947 Ga0055531_1000194712 251
80 3300005327 Ga0070658_10153479 Ga0070658_101534792 251
81 3300005840 Ga0068870_10363045 Ga0068870_103630452 251
82 3300006177 Ga0075362_10165392 Ga0075362_101653922 251
83 3300006195 Ga0075366_10000297 Ga0075366_1000029717 251
84 3300009545 Ga0105237_10071047 Ga0105237_100710471 251
85 3300010375 Ga0105239_10050383 Ga0105239_100503833 251
86 3300013105 Ga0157369_10015870 Ga0157369_100158705 251
87 3300014497 Ga0182008_10010434 Ga0182008_100104342 251
88 3300017792 Ga0163161_10002694 Ga0163161_100026947 251
89 3300025273 Ga0209673_1012218 Ga0209673_10122183 251
90 3300025303 Ga0209051_1000244 Ga0209051_10002446 251
91 3300025304 Ga0209257_1000144 Ga0209257_1000144173 251
92 3300025914 Ga0207671_10043992 Ga0207671_100439923 251
93 3300026116 Ga0207674_10110478 Ga0207674_101104783 251
94 3300028794 Ga0307515_10166590 Ga0307515_101665903 251
95 3300031238 Ga0265332_10000009 Ga0265332_1000000930 251
96 3300031852 Ga0307410_10087248 Ga0307410_100872482 251
97 3300031903 Ga0307407_10026293 Ga0307407_100262933 251
98 3300031911 Ga0307412_10019027 Ga0307412_100190273 251
99 3300031911 Ga0307412_10047042 Ga0307412_100470422 251
100 3300032002 Ga0307416_100032204 Ga0307416_1000322043 251
101 3300044673 Ga0453683_0003564 Ga0453683_0003564_5940_6701 251
102 3300045051 Ga0451576_0016175 Ga0451576_0016175_5067_5828 251
103 3300046520 Ga0495637_0022626 Ga0495637_0022626_885_1646 251
104 3300046539 Ga0495621_0116915 Ga0495621_0116915_213_974 251
105 3300046660 Ga0495625_0000870 Ga0495625_0000870_5917_6678 251
106 3300046674 Ga0495588_0121551 Ga0495588_0121551_511_1272 251
107 3300048925 Ga0496122_0046931 Ga0496122_0046931_2490_3251 251
108 3300049573 Ga0501037_0150161 Ga0501037_0150161_496_1257 251
109 3300050489 nmdc:mga03683_22103_c1 nmdc:mga03683_22103_c1_1465_2226 251
110 3300050490 nmdc:mga03n38_65252_c1 nmdc:mga03n38_65252_c1_606_1367 251
111 3300050493 nmdc:mga0k408_2216_c1 nmdc:mga0k408_2216_c1_9417_10178 251
112 3300050509 nmdc:mga0qj67_438903_c1 nmdc:mga0qj67_438903_c1_53_814 251
113 iso_pu_bacteria 2511231002 2511246685 251
114 iso_pu_bacteria 2599185214 2599625473 251
115 iso_pu_bacteria 2599185226 2599673486 251
116 iso_pu_bacteria 2599185227 2599683156 251
117 iso_pu_bacteria 2599185229 2599695356 251
118 iso_pu_bacteria 2818991446 2819599577 251
119 iso_pu_bacteria 2885198086 2885200712 251
120 iso_pu_bacteria 2885211737 2885214505 251
121 iso_pu_bacteria 2899924645 2899927792 251
122 iso_pu_bacteria 2928037797 2928041929 251
123 iso_pu_bacteria 2928044640 2928049493 251
124 iso_pu_bacteria 2928051484 2928051831 251
125 iso_pu_bacteria 2928064002 2928065476 251
126 iso_pu_bacteria 2928070936 2928072934 251
127 3300003187 JGI25151J46595_10001970 JGI25151J46595_100019706 252
128 3300025294 Ga0209025_1000122 Ga0209025_1000122149 252
129 3300026041 Ga0207639_10069038 Ga0207639_100690383 252
130 3300030732 Ga0316176_1153216 Ga0316176_11532163 252
131 3300030733 Ga0314311_1138037 Ga0314311_11380377 252
132 3300030744 Ga0316181_1029402 Ga0316181_10294023 252
133 3300030744 Ga0316181_1124666 Ga0316181_11246662 252
134 3300031731 Ga0307405_10656399 Ga0307405_106563991 252
135 3300031911 Ga0307412_10044107 Ga0307412_100441072 252
136 3300032002 Ga0307416_100683915 Ga0307416_1006839152 252
137 3300032002 Ga0307416_100791338 Ga0307416_1007913382 252
138 3300037418 Ga0395900_0377318 Ga0395900_0377318_394_1158 252
139 3300037471 Ga0395905_0000407 Ga0395905_0000407_56009_56773 252
140 3300037471 Ga0395905_0025835 Ga0395905_0025835_1395_2159 252
141 3300037471 Ga0395905_0232776 Ga0395905_0232776_947_1711 252
142 3300038443 Ga0395901_0053128 Ga0395901_0053128_2518_3282 252
143 3300039437 Ga0436365_1259853 Ga0436365_1259853_50_814 252
144 3300049570 Ga0501033_0085527 Ga0501033_0085527_304_1068 252
145 3300049579 Ga0501043_0396173 Ga0501043_0396173_196_960 252
146 3300049759 Ga0501262_006399 Ga0501262_006399_568_1332 252
147 3300049822 Ga0501035_0159065 Ga0501035_0159065_46_810 252
148 3300049823 Ga0501044_0235351 Ga0501044_0235351_664_1428 252
149 3300005364 Ga0070673_100432841 Ga0070673_1004328412 253
150 3300005367 Ga0070667_100136373 Ga0070667_1001363731 253
151 3300009148 Ga0105243_10003383 Ga0105243_1000338310 253
152 3300009176 Ga0105242_10557684 Ga0105242_105576842 253
153 3300014497 Ga0182008_10032213 Ga0182008_100322133 253
154 3300015261 Ga0182006_1020976 Ga0182006_10209762 253
155 3300015262 Ga0182007_10007465 Ga0182007_100074655 253
156 3300015683 Ga0183362_10001 Ga0183362_1000147 253
157 3300017792 Ga0163161_10078378 Ga0163161_100783783 253
158 3300017792 Ga0163161_10102857 Ga0163161_101028573 253
159 3300025292 Ga0209676_1001037 Ga0209676_10010377 253
160 3300025303 Ga0209051_1000590 Ga0209051_10005907 253
161 3300025304 Ga0209257_1006011 Ga0209257_10060119 253
162 3300025926 Ga0207659_10352870 Ga0207659_103528702 253
163 3300025935 Ga0207709_10001990 Ga0207709_1000199010 253
164 3300025986 Ga0207658_10259195 Ga0207658_102591952 253
165 3300026023 Ga0207677_10270562 Ga0207677_102705622 253
166 3300026121 Ga0207683_10059893 Ga0207683_100598934 253
167 3300031731 Ga0307405_10032514 Ga0307405_100325144 253
168 3300041498 Ga0451841_0258959 Ga0451841_0258959_27_794 253
169 3300046475 Ga0495639_0001431 Ga0495639_0001431_1093_1860 253
170 3300046674 Ga0495588_0022426 Ga0495588_0022426_1343_2110 253
171 3300047321 Ga0495676_0001289 Ga0495676_0001289_16600_17367 253
172 3300047673 Ga0495593_0011016 Ga0495593_0011016_4156_4923 253
173 3300048904 Ga0496101_0000603 Ga0496101_0000603_19718_20485 253
174 3300048906 Ga0496103_0034608 Ga0496103_0034608_1706_2473 253
175 3300048907 Ga0496104_0001576 Ga0496104_0001576_5214_5981 253
176 3300048908 Ga0496105_0019069 Ga0496105_0019069_2096_2863 253
177 3300048910 Ga0496107_0100564 Ga0496107_0100564_36_803 253
178 3300048912 Ga0496109_0341698 Ga0496109_0341698_398_1165 253
179 3300048913 Ga0496110_0041333 Ga0496110_0041333_2343_3110 253
180 3300048914 Ga0496111_0074325 Ga0496111_0074325_54_821 253
181 3300048916 Ga0496113_0124918 Ga0496113_0124918_837_1604 253
182 3300048917 Ga0496114_0140011 Ga0496114_0140011_1064_1831 253
183 3300048925 Ga0496122_0000998 Ga0496122_0000998_45050_45829 253
184 3300048926 Ga0496123_0000045 Ga0496123_0000045_44988_45767 253
185 3300048926 Ga0496123_0155672 Ga0496123_0155672_102_869 253
186 3300048927 Ga0496124_0050300 Ga0496124_0050300_229_1008 253
187 3300053093 Ga0500651_0000069 Ga0500651_0000069_29044_29811 253
188 3300053094 Ga0500566_0048515 Ga0500566_0048515_894_1661 253
189 3300053110 Ga0500571_000059 Ga0500571_000059_5692_6459 253
190 3300053120 Ga0500597_082596 Ga0500597_082596_481_1248 253
191 3300053133 Ga0500655_002237 Ga0500655_002237_1154_1921 253
192 3300053134 Ga0500658_0029580 Ga0500658_0029580_645_1412 253
193 3300053138 Ga0500564_014932 Ga0500564_014932_1053_1820 253
194 3300053177 Ga0500636_0092444 Ga0500636_0092444_739_1506 253
195 3300003781 Ga0055536_1003508 Ga0055536_10035086 254
196 3300003791 Ga0055530_10003666 Ga0055530_100036667 254
197 3300003792 Ga0055540_1003754 Ga0055540_10037543 254
198 3300003794 Ga0055531_10002840 Ga0055531_100028406 254
199 3300005334 Ga0068869_100191555 Ga0068869_1001915552 254
200 3300005344 Ga0070661_100084986 Ga0070661_1000849863 254
201 3300005457 Ga0070662_100005674 Ga0070662_1000056747 254
202 3300005564 Ga0070664_100034414 Ga0070664_1000344142 254
203 3300005618 Ga0068864_100077734 Ga0068864_1000777342 254
204 3300005841 Ga0068863_100063499 Ga0068863_1000634992 254
205 3300006048 Ga0075363_100279268 Ga0075363_1002792682 254
206 3300006237 Ga0097621_100087617 Ga0097621_1000876173 254
207 3300006353 Ga0075370_10006067 Ga0075370_100060672 254
208 3300009036 Ga0105244_10008459 Ga0105244_100084593 254
209 3300009036 Ga0105244_10154368 Ga0105244_101543681 254
210 3300009148 Ga0105243_10004252 Ga0105243_100042528 254
211 3300009551 Ga0105238_10429720 Ga0105238_104297202 254
212 3300013100 Ga0157373_10083804 Ga0157373_100838042 254
213 3300015261 Ga0182006_1003408 Ga0182006_10034087 254
214 3300015262 Ga0182007_10001502 Ga0182007_100015027 254
215 3300025292 Ga0209676_1002496 Ga0209676_100249610 254
216 3300025298 Ga0209050_1003073 Ga0209050_100307310 254
217 3300025303 Ga0209051_1001261 Ga0209051_10012617 254
218 3300025304 Ga0209257_1001281 Ga0209257_10012817 254
219 3300025728 Ga0207655_1009405 Ga0207655_10094056 254
220 3300025920 Ga0207649_10228391 Ga0207649_102283912 254
221 3300025924 Ga0207694_10129964 Ga0207694_101299642 254
222 3300025925 Ga0207650_10120506 Ga0207650_101205062 254
223 3300025933 Ga0207706_10024633 Ga0207706_100246335 254
224 3300025935 Ga0207709_10001402 Ga0207709_1000140215 254
225 3300025942 Ga0207689_10120963 Ga0207689_101209632 254
226 3300025945 Ga0207679_10271143 Ga0207679_102711432 254
227 3300026088 Ga0207641_10052621 Ga0207641_100526212 254
228 3300026095 Ga0207676_10084834 Ga0207676_100848344 254
229 3300026116 Ga0207674_10224338 Ga0207674_102243383 254
230 3300028794 Ga0307515_10000084 Ga0307515_10000084127 254
231 3300028794 Ga0307515_10162348 Ga0307515_101623482 254
232 3300031456 Ga0307513_10011348 Ga0307513_100113489 254
233 3300031456 Ga0307513_10067372 Ga0307513_100673725 254
234 3300031649 Ga0307514_10000319 Ga0307514_1000031935 254
235 3300031730 Ga0307516_10087109 Ga0307516_100871095 254
236 3300042876 Ga0451577_0008035 Ga0451577_0008035_2745_3515 254
237 3300044673 Ga0453683_0012675 Ga0453683_0012675_2659_3429 254
238 3300045051 Ga0451576_0438065 Ga0451576_0438065_402_1172 254
239 3300048905 Ga0496102_0185200 Ga0496102_0185200_369_1139 254
240 3300048919 Ga0496116_0076751 Ga0496116_0076751_714_1484 254
241 3300048925 Ga0496122_0047920 Ga0496122_0047920_1812_2594 254
242 3300048925 Ga0496122_0088810 Ga0496122_0088810_688_1470 254
243 3300048926 Ga0496123_0033063 Ga0496123_0033063_1445_2227 254
244 3300048927 Ga0496124_0025144 Ga0496124_0025144_2580_3350 254
245 3300048928 Ga0496125_0004135 Ga0496125_0004135_11839_12621 254
246 3300048929 Ga0496126_0026944 Ga0496126_0026944_477_1259 254
247 3300049568 Ga0501031_0001847 Ga0501031_0001847_4700_5470 254
248 3300050496 nmdc:mga07m45_2457_c1 nmdc:mga07m45_2457_c1_5645_6415 254
249 3300053142 Ga0500577_0050573 Ga0500577_0050573_388_1200 254
250 3300002704 JGI25155J39150_1000041 JGI25155J39150_100004125 255
251 3300002705 JGI25156J39149_1000031 JGI25156J39149_100003157 255
252 3300002738 JGI25154J39366_1000049 JGI25154J39366_100004956 255
253 3300002741 JGI25157J39369_1000041 JGI25157J39369_100004156 255
254 3300002773 JGI25152J39213_1001798 JGI25152J39213_10017985 255
255 3300002774 JGI25150J39212_1007756 JGI25150J39212_10077561 255
256 3300002774 JGI25150J39212_1010654 JGI25150J39212_10106542 255
257 3300002987 JGI25159J45721_1003228 JGI25159J45721_10032286 255
258 3300002987 JGI25159J45721_1003296 JGI25159J45721_10032965 255
259 3300002987 JGI25159J45721_1003743 JGI25159J45721_10037434 255
260 3300003187 JGI25151J46595_10003483 JGI25151J46595_100034835 255
261 3300003187 JGI25151J46595_10005666 JGI25151J46595_100056666 255
262 3300003215 JGI25153J46596_10006723 JGI25153J46596_100067235 255
263 3300003316 rootH1_10093713 rootH1_100937134 255
264 3300003323 rootH1_10009766 rootH1_100097663 255
265 3300003354 JGI25160J50197_1000784 JGI25160J50197_10007846 255
266 3300003354 JGI25160J50197_1004782 JGI25160J50197_10047825 255
267 3300003374 JGI25161J50226_1000042 JGI25161J50226_100004222 255
268 3300003374 JGI25161J50226_1002467 JGI25161J50226_10024672 255
269 3300003761 Ga0055535_1000318 Ga0055535_100031844 255
270 3300003762 Ga0055542_1000022 Ga0055542_100002244 255
271 3300003771 Ga0055526_1006294 Ga0055526_10062945 255
272 3300003771 Ga0055526_1007436 Ga0055526_10074365 255
273 3300003771 Ga0055526_1010081 Ga0055526_10100813 255
274 3300003773 Ga0055537_1000897 Ga0055537_10008977 255
275 3300003773 Ga0055537_1002319 Ga0055537_10023195 255
276 3300003773 Ga0055537_1013081 Ga0055537_10130812 255
277 3300003775 Ga0055524_1000260 Ga0055524_100026031 255
278 3300003775 Ga0055524_1004409 Ga0055524_10044095 255
279 3300003781 Ga0055536_1002928 Ga0055536_10029285 255
280 3300003781 Ga0055536_1031308 Ga0055536_10313082 255
281 3300003784 Ga0055534_1001045 Ga0055534_10010457 255
282 3300003784 Ga0055534_1002838 Ga0055534_10028385 255
283 3300003790 Ga0055528_1003019 Ga0055528_10030195 255
284 3300003790 Ga0055528_1003352 Ga0055528_10033526 255
285 3300003791 Ga0055530_10005618 Ga0055530_100056185 255
286 3300003792 Ga0055540_1000010 Ga0055540_100001030 255
287 3300003794 Ga0055531_10001065 Ga0055531_100010655 255
288 3300003794 Ga0055531_10008583 Ga0055531_100085833 255
289 3300004625 Ga0055543_1000279 Ga0055543_100027918 255
290 3300004625 Ga0055543_1001420 Ga0055543_10014207 255
291 3300005262 Ga0065165_1004355 Ga0065165_10043556 255
292 3300005467 Ga0070706_100836735 Ga0070706_1008367351 255
293 3300005518 Ga0070699_100402997 Ga0070699_1004029971 255
294 3300005539 Ga0068853_100009116 Ga0068853_1000091168 255
295 3300005539 Ga0068853_100198742 Ga0068853_1001987422 255
296 3300005834 Ga0068851_10005357 Ga0068851_100053575 255
297 3300006048 Ga0075363_100100881 Ga0075363_1001008812 255
298 3300006051 Ga0075364_10150593 Ga0075364_101505932 255
299 3300006177 Ga0075362_10051639 Ga0075362_100516392 255
300 3300006186 Ga0075369_10117415 Ga0075369_101174152 255
301 3300012513 Ga0157326_1001298 Ga0157326_10012983 255
302 3300013102 Ga0157371_10107402 Ga0157371_101074022 255
303 3300021361 Ga0213872_10002408 Ga0213872_1000240811 255
304 3300025206 Ga0209435_100014 Ga0209435_10001456 255
305 3300025208 Ga0209436_105494 Ga0209436_1054942 255
306 3300025208 Ga0209436_106933 Ga0209436_1069333 255
307 3300025228 Ga0209672_100273 Ga0209672_10027329 255
308 3300025242 Ga0209258_100009 Ga0209258_100009707 255
309 3300025245 Ga0207425_1000634 Ga0207425_10006347 255
310 3300025245 Ga0207425_1000913 Ga0207425_100091310 255
311 3300025245 Ga0207425_1002429 Ga0207425_10024295 255
312 3300025246 Ga0209646_1000001 Ga0209646_100000157 255
313 3300025250 Ga0209026_1000073 Ga0209026_100007356 255
314 3300025254 Ga0209148_1000007 Ga0209148_1000007707 255
315 3300025256 Ga0209759_1000013 Ga0209759_100001357 255
316 3300025258 Ga0209129_1000024 Ga0209129_1000024369 255
317 3300025258 Ga0209129_1000085 Ga0209129_1000085150 255
318 3300025258 Ga0209129_1000712 Ga0209129_10007127 255
319 3300025258 Ga0209129_1013304 Ga0209129_10133042 255
320 3300025263 Ga0209565_1000462 Ga0209565_100046218 255
321 3300025263 Ga0209565_1000726 Ga0209565_10007267 255
322 3300025263 Ga0209565_1000981 Ga0209565_10009817 255
323 3300025273 Ga0209673_1000008 Ga0209673_1000008447 255
324 3300025273 Ga0209673_1001121 Ga0209673_100112116 255
325 3300025284 Ga0209130_1000216 Ga0209130_100021655 255
326 3300025284 Ga0209130_1000283 Ga0209130_100028314 255
327 3300025284 Ga0209130_1004700 Ga0209130_10047004 255
328 3300025291 Ga0209675_1000400 Ga0209675_10004006 255
329 3300025291 Ga0209675_1000451 Ga0209675_100045113 255
330 3300025291 Ga0209675_1004272 Ga0209675_10042724 255
331 3300025291 Ga0209675_1043022 Ga0209675_10430221 255
332 3300025292 Ga0209676_1000007 Ga0209676_100000756 255
333 3300025292 Ga0209676_1004230 Ga0209676_10042308 255
334 3300025292 Ga0209676_1007185 Ga0209676_10071852 255
335 3300025294 Ga0209025_1004892 Ga0209025_10048927 255
336 3300025294 Ga0209025_1009796 Ga0209025_10097966 255
337 3300025294 Ga0209025_1028923 Ga0209025_10289232 255
338 3300025295 Ga0209564_1000481 Ga0209564_100048133 255
339 3300025295 Ga0209564_1002817 Ga0209564_10028176 255
340 3300025295 Ga0209564_1004210 Ga0209564_10042101 255
341 3300025295 Ga0209564_1007422 Ga0209564_10074223 255
342 3300025297 Ga0209758_1000049 Ga0209758_1000049288 255
343 3300025297 Ga0209758_1015297 Ga0209758_10152973 255
344 3300025298 Ga0209050_1000003 Ga0209050_10000031452 255
345 3300025298 Ga0209050_1006209 Ga0209050_10062096 255
346 3300025298 Ga0209050_1017680 Ga0209050_10176804 255
347 3300025299 Ga0209256_1000001 Ga0209256_10000011454 255
348 3300025299 Ga0209256_1000464 Ga0209256_100046413 255
349 3300025302 Ga0207426_1000053 Ga0207426_1000053324 255
350 3300025302 Ga0207426_1000117 Ga0207426_100011710 255
351 3300025302 Ga0207426_1001659 Ga0207426_10016597 255
352 3300025302 Ga0207426_1042319 Ga0207426_10423192 255
353 3300025303 Ga0209051_1000003 Ga0209051_10000031452 255
354 3300025303 Ga0209051_1015163 Ga0209051_10151635 255
355 3300025303 Ga0209051_1048089 Ga0209051_10480892 255
356 3300025304 Ga0209257_1000020 Ga0209257_100002056 255
357 3300025304 Ga0209257_1005583 Ga0209257_10055837 255
358 3300025321 Ga0207656_10016717 Ga0207656_100167172 255
359 3300025910 Ga0207684_10385869 Ga0207684_103858691 255
360 3300026041 Ga0207639_10012850 Ga0207639_100128502 255
361 3300031456 Ga0307513_10000008 Ga0307513_10000008378 255
362 3300031456 Ga0307513_10000020 Ga0307513_1000002018 255
363 3300031730 Ga0307516_10038615 Ga0307516_100386156 255
364 3300039447 Ga0436361_0508128 Ga0436361_0508128_5197_6012 255
365 3300041453 Ga0451797_0830558 Ga0451797_0830558_150_917 255
366 3300048921 Ga0496118_0003992 Ga0496118_0003992_12240_13019 255
367 3300048927 Ga0496124_0225754 Ga0496124_0225754_591_1370 255
368 3300048928 Ga0496125_0056621 Ga0496125_0056621_1256_2035 255
369 3300053093 Ga0500651_0041847 Ga0500651_0041847_1627_2394 255
370 3300053117 Ga0500593_000342 Ga0500593_000342_12796_13563 255
371 3300053129 Ga0500628_002321 Ga0500628_002321_1882_2649 255
372 3300053730 Ga0500645_002479 Ga0500645_002479_4517_5284 255
373 3300053730 Ga0500645_003847 Ga0500645_003847_3476_4249 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

49

252

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7588 5 138
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7404 5 138
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7195 6 140
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7084 6 140
1wyz-assembly1.cif.gz_C x-ray structure of the putative methyltransferase from bacteroides thetaiotaomicron vpi-5482 at the resolution 2.5 a. norteast structural genomics consortium target btr28 0.6564 6 255
ID Description Score Start End Superfamily
1wyzA02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.8759 144 255 3.30.950.10
1wyzC01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8756 6 141 3.40.1010.10
1wyzC01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8681 6 141 3.40.1010.10
1wyzA02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.8528 144 255 3.30.950.10
5hw4C01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.7738 7 138 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A7C6MT16-F1-model_v4 deleted 0.9543 170 255
AF-A0A4Q3PYE0-F1-model_v4 deleted 0.9465 5 103
AF-A0A0B7IIP2-F1-model_v4 Uncharacterized protein 0.9463 157 254 GO:0008168
AF-A0A520US04-F1-model_v4 SAM-dependent methyltransferase 0.9359 154 254 GO:0008168
AF-A0A7C6MT16-F1-model_v4 deleted 0.933 170 255

Feature Viewer

pLDDT pTM Quality
83.03 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map