F426291

General Info

Members Datasets Scaffolds Average Seq Length
373 235 746 155

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100700313|Ga0068861_1007003132
Length 185
Sequence MRTSDDPLTEQRAVRGQSRDDGASRAPRTEPKSMPNKVRTLRLQHYLPYRLSVAANAVSRVIQLAYEEKFGLTIPQWRLIAVLADEGPLTQQELCGRTIMDKVTITRAAQGLLRRRLVKRLPNSADGRSHRLMLTKGGEALYAEVAPMALDYETKLLAGLKAEDIARLEQHLRLLERAAAELRGV

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
233 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
234 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
235 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0.54
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 0
Rhizoplane 4.02
Rhizosphere 82.31
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100700313 3300005719 Bacteria 941
2 JGI24736J21556_1002418 3300001904 Bacteria 3299
3 JGI24741J21665_1018305 3300001915 Bacteria 1122
4 JGI24752J21851_1000010 3300001976 Bacteria 20852
5 JGI24740J21852_10010630 3300001979 Bacteria 3535
6 JGI24739J22299_10064100 3300001989 Bacteria 1156
7 JGI24737J22298_10041790 3300001990 Bacteria 1406
8 JGI24735J21928_10041077 3300002067 Bacteria 1348
9 JGI24750J21931_1000016 3300002070 Bacteria 20913
10 JGI24748J21848_1000079 3300002074 Bacteria 30251
11 JGI24738J21930_10011829 3300002075 Bacteria 1913
12 JGI24749J21850_1000076 3300002076 Bacteria 17900
13 JGI24749J21850_1002128 3300002076 Bacteria 2797
14 JGI24034J26672_10000007 3300002239 Bacteria 224370
15 JGI24751J29686_10004108 3300002459 Bacteria 2951
16 JGI25165J46597_1000012 3300003214 Bacteria 421074
17 Ga0058859_11437825 3300004798 Bacteria 817
18 Ga0065707_10085646 3300005295 Bacteria 5996
19 Ga0070658_10041030 3300005327 Bacteria 3734
20 Ga0070658_10625598 3300005327 Bacteria 934
21 Ga0070683_100364698 3300005329 Bacteria 1376
22 Ga0070690_100000579 3300005330 Bacteria 18433
23 Ga0070670_100144390 3300005331 Bacteria 2058
24 Ga0070670_100219857 3300005331 Bacteria 1652
25 Ga0070677_10868589 3300005333 Bacteria 519
26 Ga0068869_100461749 3300005334 Bacteria 1054
27 Ga0070666_10000017 3300005335 Bacteria 190526
28 Ga0070666_10000090 3300005335 Bacteria 64025
29 Ga0070666_10135207 3300005335 Bacteria 1715
30 Ga0070680_100292563 3300005336 Bacteria 1380
31 Ga0070682_100028127 3300005337 Bacteria 3379
32 Ga0070660_100141789 3300005339 Bacteria 1928
33 Ga0070689_100001897 3300005340 Bacteria 13508
34 Ga0070661_100267731 3300005344 Bacteria 1322
35 Ga0070668_100151555 3300005347 Bacteria 1875
36 Ga0070668_100335429 3300005347 Bacteria 1276
37 Ga0070668_101147309 3300005347 Bacteria 703
38 Ga0070669_100000005 3300005353 Bacteria 309134
39 Ga0070669_100000024 3300005353 Bacteria 173107
40 Ga0070669_100000117 3300005353 Bacteria 74010
41 Ga0070671_100000006 3300005355 Bacteria 250635
42 Ga0070671_100223236 3300005355 Bacteria 1598
43 Ga0070688_100000254 3300005365 Bacteria 28113
44 Ga0070659_100286280 3300005366 Bacteria 1371
45 Ga0070667_100025262 3300005367 Bacteria 4938
46 Ga0070667_100177571 3300005367 Bacteria 1882
47 Ga0070667_100617568 3300005367 Bacteria 999
48 Ga0070713_100242398 3300005436 Bacteria 1642
49 Ga0070711_101572051 3300005439 Unclassified 575
50 Ga0070705_100001608 3300005440 Bacteria 11840
51 Ga0070708_100071881 3300005445 Bacteria 3116
52 Ga0070663_100134191 3300005455 Bacteria 1883
53 Ga0070662_100691247 3300005457 Bacteria 862
54 Ga0070662_101101825 3300005457 Bacteria 681
55 Ga0070681_10011304 3300005458 Bacteria 8832
56 Ga0068867_101425288 3300005459 Bacteria 643
57 Ga0070685_10000384 3300005466 Bacteria 26547
58 Ga0070706_101221222 3300005467 Bacteria 690
59 Ga0070679_100407594 3300005530 Bacteria 1305
60 Ga0070684_100179209 3300005535 Bacteria 1926
61 Ga0068853_100365269 3300005539 Bacteria 1345
62 Ga0070672_100653803 3300005543 Bacteria 918
63 Ga0070686_100000014 3300005544 Bacteria 166729
64 Ga0070686_100411934 3300005544 Bacteria 1030
65 Ga0070665_100000042 3300005548 Bacteria 292582
66 Ga0070665_100000304 3300005548 Bacteria 76931
67 Ga0070665_100099899 3300005548 Bacteria 2906
68 Ga0068855_100100733 3300005563 Bacteria 3326
69 Ga0068855_100483140 3300005563 Bacteria 1348
70 Ga0070664_101023937 3300005564 Bacteria 776
71 Ga0068857_100320018 3300005577 Bacteria 1432
72 Ga0068856_100491252 3300005614 Bacteria 1248
73 Ga0068856_100714684 3300005614 Bacteria 1022
74 Ga0068852_100014639 3300005616 Bacteria 6048
75 Ga0068852_101012547 3300005616 Bacteria 849
76 Ga0068852_101648522 3300005616 Bacteria 664
77 Ga0068859_100000362 3300005617 Bacteria 45197
78 Ga0068859_100002039 3300005617 Bacteria 20643
79 Ga0068859_100014236 3300005617 Bacteria 7977
80 Ga0068859_100726175 3300005617 Bacteria 1083
81 Ga0068864_100000425 3300005618 Bacteria 36468
82 Ga0068864_100000431 3300005618 Bacteria 36315
83 Ga0068864_101563455 3300005618 Bacteria 663
84 Ga0068861_100001886 3300005719 Bacteria 13493
85 Ga0068861_100013551 3300005719 Bacteria 5705
86 Ga0068861_100056975 3300005719 Bacteria 2984
87 Ga0068851_10093496 3300005834 Bacteria 1586
88 Ga0068870_10363128 3300005840 Unclassified 932
89 Ga0068863_100000068 3300005841 Bacteria 117128
90 Ga0068863_100001138 3300005841 Bacteria 26588
91 Ga0068863_100601397 3300005841 Bacteria 1088
92 Ga0068858_100000583 3300005842 Bacteria 38259
93 Ga0068858_100003970 3300005842 Bacteria 14593
94 Ga0068858_100008254 3300005842 Bacteria 10010
95 Ga0068858_100022080 3300005842 Bacteria 5942
96 Ga0068858_100071283 3300005842 Bacteria 3223
97 Ga0068860_100000062 3300005843 Bacteria 190526
98 Ga0068860_100009886 3300005843 Bacteria 9458
99 Ga0068860_100068897 3300005843 Bacteria 3362
100 Ga0068862_100000005 3300005844 Bacteria 350713
101 Ga0068862_100000283 3300005844 Bacteria 56661
102 Ga0068862_100001396 3300005844 Bacteria 22388
103 Ga0068862_100179209 3300005844 Unclassified 1901
104 Ga0081455_10000188 3300005937 Bacteria 78570
105 Ga0070717_10752308 3300006028 Bacteria 886
106 Ga0075368_10000907 3300006042 Bacteria 9191
107 Ga0075363_100038873 3300006048 Bacteria 2503
108 Ga0075367_10006831 3300006178 Bacteria 5800
109 Ga0075366_10005310 3300006195 Bacteria 6980
110 Ga0075370_10037985 3300006353 Bacteria 2709
111 Ga0068865_101341132 3300006881 Bacteria 637
112 Ga0097620_100000362 3300006931 Bacteria 45197
113 Ga0097620_100002039 3300006931 Bacteria 20643
114 Ga0097620_100014236 3300006931 Bacteria 7977
115 Ga0097620_100726388 3300006931 Bacteria 1083
116 Ga0105251_10154201 3300009011 Bacteria 1036
117 Ga0105250_10024997 3300009092 Bacteria 2407
118 Ga0105240_10053187 3300009093 Bacteria 5085
119 Ga0105240_10678837 3300009093 Bacteria 1126
120 Ga0105245_10006916 3300009098 Bacteria 9944
121 Ga0105245_10681817 3300009098 Bacteria 1060
122 Ga0105247_10000668 3300009101 Bacteria 27068
123 Ga0105247_10004786 3300009101 Bacteria 8624
124 Ga0105247_10061008 3300009101 Bacteria 2338
125 Ga0105243_10078360 3300009148 Bacteria 2690
126 Ga0105241_10657985 3300009174 Bacteria 952
127 Ga0105248_10000171 3300009177 Bacteria 75565
128 Ga0105248_10023239 3300009177 Bacteria 6885
129 Ga0105248_10035095 3300009177 Bacteria 5611
130 Ga0105248_10140820 3300009177 Bacteria 2721
131 Ga0105237_11069912 3300009545 Bacteria 813
132 Ga0105238_10026378 3300009551 Bacteria 5924
133 Ga0105249_10000012 3300009553 Bacteria 292640
134 Ga0105249_10004913 3300009553 Bacteria 11536
135 Ga0105249_10061536 3300009553 Bacteria 3445
136 Ga0105249_10075166 3300009553 Bacteria 3128
137 Ga0105239_10155416 3300010375 Bacteria 2554
138 Ga0157326_1004667 3300012513 Bacteria 1443
139 Ga0157373_10120924 3300013100 Bacteria 1841
140 Ga0157371_10406357 3300013102 Bacteria 997
141 Ga0157371_10533802 3300013102 Bacteria 869
142 Ga0157370_10015743 3300013104 Bacteria 7678
143 Ga0157370_10597699 3300013104 Bacteria 1010
144 Ga0157369_10455084 3300013105 Bacteria 1325
145 Ga0157378_11528082 3300013297 Bacteria 712
146 Ga0163162_10007815 3300013306 Bacteria 10425
147 Ga0163162_10017810 3300013306 Bacteria 6951
148 Ga0163162_10095735 3300013306 Bacteria 3056
149 Ga0163162_10830285 3300013306 Bacteria 1040
150 Ga0157372_10085852 3300013307 Bacteria 3570
151 Ga0157372_10147415 3300013307 Bacteria 2714
152 Ga0163163_10013742 3300014325 Bacteria 7419
153 Ga0163163_10033808 3300014325 Bacteria 4949
154 Ga0163163_10148328 3300014325 Bacteria 2390
155 Ga0163163_10500049 3300014325 Unclassified 1277
156 Ga0157380_10002186 3300014326 Bacteria 13139
157 Ga0157380_10004510 3300014326 Bacteria 9657
158 Ga0157380_10076896 3300014326 Bacteria 2718
159 Ga0157379_10001118 3300014968 Bacteria 21939
160 Ga0157379_10011330 3300014968 Bacteria 7773
161 Ga0157379_10044637 3300014968 Bacteria 3956
162 Ga0157379_11594031 3300014968 Bacteria 637
163 Ga0157376_10187358 3300014969 Bacteria 1895
164 Ga0163161_10000025 3300017792 Bacteria 201127
165 Ga0213876_10000150 3300021384 Bacteria 74357
166 Ga0213875_10091793 3300021388 Bacteria 1417
167 Ga0207672_1000368 3300025223 Bacteria 5896
168 Ga0207427_109956 3300025231 Bacteria 1004
169 Ga0209148_1014506 3300025254 Bacteria 1391
170 Ga0209233_1000058 3300025261 Bacteria 421872
171 Ga0207697_10000073 3300025315 Bacteria 43194
172 Ga0207697_10022516 3300025315 Bacteria 2581
173 Ga0207656_10005395 3300025321 Bacteria 4516
174 Ga0207713_1156208 3300025735 Bacteria 731
175 Ga0207710_10000722 3300025900 Bacteria 18297
176 Ga0207710_10028597 3300025900 Bacteria 2420
177 Ga0207710_10044861 3300025900 Bacteria 1970
178 Ga0207680_10000012 3300025903 Bacteria 293810
179 Ga0207680_10000030 3300025903 Bacteria 78257
180 Ga0207680_10106979 3300025903 Bacteria 1807
181 Ga0207680_10535324 3300025903 Unclassified 836
182 Ga0207647_10005615 3300025904 Bacteria 9163
183 Ga0207643_10306816 3300025908 Unclassified 989
184 Ga0207705_10234894 3300025909 Bacteria 1395
185 Ga0207705_10354773 3300025909 Bacteria 1130
186 Ga0207705_10486268 3300025909 Bacteria 958
187 Ga0207684_11303069 3300025910 Bacteria 598
188 Ga0207654_10174119 3300025911 Bacteria 1400
189 Ga0207707_10047633 3300025912 Bacteria 3733
190 Ga0207695_10003749 3300025913 Bacteria 21132
191 Ga0207695_10022180 3300025913 Bacteria 7220
192 Ga0207695_10100421 3300025913 Bacteria 2889
193 Ga0207695_10346717 3300025913 Bacteria 1373
194 Ga0207671_10003715 3300025914 Bacteria 15040
195 Ga0207660_10128850 3300025917 Bacteria 1924
196 Ga0207662_10204155 3300025918 Unclassified 1280
197 Ga0207657_10029682 3300025919 Bacteria 4973
198 Ga0207649_10208367 3300025920 Bacteria 1385
199 Ga0207652_11026777 3300025921 Bacteria 724
200 Ga0207681_10000003 3300025923 Bacteria 713245
201 Ga0207681_10000004 3300025923 Bacteria 559005
202 Ga0207681_10000182 3300025923 Bacteria 51520
203 Ga0207694_10024270 3300025924 Bacteria 4604
204 Ga0207694_10297104 3300025924 Bacteria 1329
205 Ga0207650_10434839 3300025925 Bacteria 1090
206 Ga0207687_10064786 3300025927 Bacteria 2593
207 Ga0207644_10000009 3300025931 Bacteria 251643
208 Ga0207644_10005017 3300025931 Bacteria 8640
209 Ga0207690_10926545 3300025932 Bacteria 723
210 Ga0207706_10270731 3300025933 Bacteria 1482
211 Ga0207706_10335953 3300025933 Bacteria 1314
212 Ga0207686_10658440 3300025934 Bacteria 829
213 Ga0207670_10007364 3300025936 Bacteria 6137
214 Ga0207691_10229608 3300025940 Bacteria 1607
215 Ga0207711_10001461 3300025941 Bacteria 22080
216 Ga0207711_10025781 3300025941 Bacteria 4929
217 Ga0207711_10038062 3300025941 Bacteria 4089
218 Ga0207711_10082227 3300025941 Bacteria 2815
219 Ga0207689_10162734 3300025942 Bacteria 1839
220 Ga0207679_10237024 3300025945 Bacteria 1544
221 Ga0207667_10019353 3300025949 Bacteria 7603
222 Ga0207667_10157631 3300025949 Bacteria 2336
223 Ga0207667_10815725 3300025949 Bacteria 929
224 Ga0207712_10000021 3300025961 Bacteria 292649
225 Ga0207712_10025133 3300025961 Bacteria 3955
226 Ga0207712_10026369 3300025961 Bacteria 3870
227 Ga0207712_10036580 3300025961 Bacteria 3345
228 Ga0207668_10000005 3300025972 Bacteria 193572
229 Ga0207668_10001245 3300025972 Bacteria 15179
230 Ga0207668_10002153 3300025972 Bacteria 11488
231 Ga0207640_10287821 3300025981 Bacteria 1294
232 Ga0207640_11373833 3300025981 Bacteria 632
233 Ga0207658_10000966 3300025986 Bacteria 23710
234 Ga0207658_10003120 3300025986 Bacteria 11858
235 Ga0207658_10006420 3300025986 Bacteria 8026
236 Ga0207658_10006467 3300025986 Bacteria 7996
237 Ga0207658_10130038 3300025986 Bacteria 2021
238 Ga0207703_10000715 3300026035 Bacteria 32705
239 Ga0207703_10000738 3300026035 Bacteria 32194
240 Ga0207703_10007602 3300026035 Bacteria 8593
241 Ga0207703_10010652 3300026035 Bacteria 7182
242 Ga0207703_10324022 3300026035 Bacteria 1412
243 Ga0207639_10042131 3300026041 Bacteria 3420
244 Ga0207639_10154658 3300026041 Bacteria 1925
245 Ga0207639_12088945 3300026041 Bacteria 528
246 Ga0207678_10044784 3300026067 Bacteria 3827
247 Ga0207702_10003138 3300026078 Bacteria 15324
248 Ga0207702_10427259 3300026078 Bacteria 1282
249 Ga0207702_10465867 3300026078 Bacteria 1228
250 Ga0207641_10000037 3300026088 Bacteria 206551
251 Ga0207641_10572681 3300026088 Bacteria 1103
252 Ga0207648_11155213 3300026089 Bacteria 727
253 Ga0207676_10000423 3300026095 Bacteria 35673
254 Ga0207676_10001030 3300026095 Bacteria 21326
255 Ga0207676_10001119 3300026095 Bacteria 20319
256 Ga0207676_11468312 3300026095 Bacteria 678
257 Ga0207674_10110613 3300026116 Bacteria 2722
258 Ga0207674_10917293 3300026116 Bacteria 844
259 Ga0207674_10980686 3300026116 Bacteria 814
260 Ga0207675_100000088 3300026118 Bacteria 71728
261 Ga0207675_100000784 3300026118 Bacteria 31581
262 Ga0207675_100001338 3300026118 Bacteria 24709
263 Ga0207675_100091714 3300026118 Bacteria 2857
264 Ga0207698_10003900 3300026142 Bacteria 9036
265 Ga0207698_10590035 3300026142 Bacteria 1094
266 Ga0209813_10029082 3300027866 Bacteria 1616
267 Ga0268266_10000054 3300028379 Bacteria 292717
268 Ga0268266_10000362 3300028379 Bacteria 70533
269 Ga0268266_10196467 3300028379 Bacteria 1844
270 Ga0268265_10000001 3300028380 Bacteria 1230727
271 Ga0268265_10000092 3300028380 Bacteria 114086
272 Ga0268265_10000109 3300028380 Bacteria 104063
273 Ga0268264_10000069 3300028381 Bacteria 270492
274 Ga0268264_10000074 3300028381 Bacteria 259555
275 Ga0268264_10001360 3300028381 Bacteria 22913
276 Ga0265338_10016067 3300028800 Bacteria 8172
277 Ga0265338_10488038 3300028800 Bacteria 868
278 Ga0307511_10023976 3300030521 Bacteria 5668
279 Ga0265770_1022881 3300030878 Bacteria 1003
280 Ga0265327_10000140 3300031251 Bacteria 158935
281 Ga0307513_10031368 3300031456 Bacteria 6020
282 Ga0307513_10352523 3300031456 Bacteria 1219
283 Ga0307513_10393947 3300031456 Bacteria 1121
284 Ga0307509_10433055 3300031507 Bacteria 1013
285 Ga0307508_10002139 3300031616 Bacteria 21168
286 Ga0307406_10503162 3300031901 Bacteria 983
287 Ga0307510_10106447 3300033180 Bacteria 2567
288 Ga0307510_10278614 3300033180 Bacteria 1144
289 Ga0373945_0083964 3300035116 Bacteria 1224
290 Ga0373943_0011490 3300035170 Bacteria 3985
291 Ga0373946_0490959 3300035171 Bacteria 629
292 Ga0373935_0329764 3300035692 Bacteria 1084
293 Ga0373925_0035413 3300037068 Bacteria 3683
294 Ga0395900_0002796 3300037418 Bacteria 19064
295 Ga0395900_0147533 3300037418 Bacteria 2405
296 Ga0395898_0017635 3300037466 Bacteria 7288
297 Ga0395898_0568834 3300037466 Bacteria 1076
298 Ga0395905_0014055 3300037471 Bacteria 7655
299 Ga0436364_1452298 3300037853 Bacteria 4037
300 Ga0436365_1247886 3300039437 Bacteria 61397
301 Ga0436361_0602413 3300039447 Bacteria 1659
302 Ga0436363_1541909 3300039450 Bacteria 3705
303 Ga0451793_1837155 3300041452 Bacteria 2175
304 Ga0451795_0406994 3300041456 Bacteria 906
305 Ga0466972_0098547 3300044658 Bacteria 1384
306 Ga0466961_0405561 3300044693 Bacteria 827
307 Ga0466971_0341593 3300044719 Bacteria 723
308 Ga0466960_0391785 3300044901 Bacteria 799
309 Ga0466959_0112477 3300045049 Bacteria 1942
310 Ga0495627_000139 3300046453 Bacteria 86240
311 Ga0495638_0000481 3300046460 Bacteria 47890
312 Ga0495585_0124577 3300046492 Bacteria 1361
313 Ga0495585_0257966 3300046492 Bacteria 868
314 Ga0495596_0000430 3300046500 Bacteria 26887
315 Ga0495583_0033867 3300046506 Bacteria 2453
316 Ga0495643_0333376 3300046522 Bacteria 683
317 Ga0495648_0004739 3300046524 Bacteria 11521
318 Ga0495648_0107172 3300046524 Bacteria 1528
319 Ga0495648_0245695 3300046524 Bacteria 867
320 Ga0495663_0015727 3300046525 Bacteria 2134
321 Ga0495666_0169204 3300046526 Bacteria 1011
322 Ga0495622_0313963 3300046557 Bacteria 682
323 Ga0495668_0102975 3300046616 Bacteria 1562
324 Ga0495625_0000112 3300046660 Bacteria 124365
325 Ga0495625_0139551 3300046660 Bacteria 1636
326 Ga0495670_0112833 3300046691 Bacteria 1408
327 Ga0495649_0246738 3300046694 Bacteria 918
328 Ga0495649_0349083 3300046694 Bacteria 748
329 Ga0495677_0096713 3300047445 Bacteria 1115
330 Ga0495679_056350 3300047446 Bacteria 1165
331 Ga0495673_0077315 3300047469 Bacteria 1386
332 Ga0495686_0077985 3300047472 Bacteria 2028
333 Ga0496101_0213335 3300048904 Bacteria 1496
334 Ga0496102_0055699 3300048905 Bacteria 3605
335 Ga0496103_0002043 3300048906 Bacteria 12947
336 Ga0496103_0273465 3300048906 Bacteria 1087
337 Ga0496104_0141065 3300048907 Bacteria 2315
338 Ga0496105_0348507 3300048908 Unclassified 1183
339 Ga0496106_0180627 3300048909 Bacteria 1675
340 Ga0496106_0438539 3300048909 Bacteria 1049
341 Ga0496107_0030051 3300048910 Bacteria 3871
342 Ga0496108_0261785 3300048911 Bacteria 1505
343 Ga0496110_0788742 3300048913 Bacteria 854
344 Ga0496112_0505008 3300048915 Unclassified 1144
345 Ga0496115_0193866 3300048918 Bacteria 1679
346 Ga0496116_0041868 3300048919 Bacteria 3138
347 Ga0496118_0056652 3300048921 Bacteria 2944
348 Ga0496121_0001030 3300048924 Bacteria 49689
349 Ga0496121_0054054 3300048924 Bacteria 3359
350 Ga0496124_0078148 3300048927 Bacteria 2728
351 Ga0496125_0072088 3300048928 Bacteria 2694
352 Ga0501037_0782389 3300049573 Bacteria 631
353 nmdc:mga03n38_10269_c1 3300050490 Bacteria 3436
354 nmdc:mga00v17_1399_c1 3300050491 Bacteria 12661
355 nmdc:mga0k408_152398_c1 3300050493 Bacteria 1377
356 nmdc:mga06z11_312210_c1 3300050494 Bacteria 937
357 nmdc:mga04h51_7364_c1 3300050495 Bacteria 2901
358 nmdc:mga07m45_150892_c1 3300050496 Bacteria 1348
359 nmdc:mga07m45_3954_c1 3300050496 Bacteria 7203
360 Ga0500643_008495 3300053087 Bacteria 4030
361 Ga0500651_0592472 3300053093 Bacteria 602
362 Ga0500641_0060265 3300053096 Bacteria 1579
363 Ga0500562_042357 3300053108 Bacteria 1211
364 Ga0500562_044398 3300053108 Bacteria 1183
365 Ga0500658_0001269 3300053134 Bacteria 10240
366 Ga0500559_0022218 3300053136 Bacteria 2691
367 Ga0500559_0254507 3300053136 Bacteria 827
368 Ga0500568_0001066 3300053139 Bacteria 18620
369 Ga0500616_0277473 3300053153 Bacteria 705
370 2643998457 2643221598 Bacteria 4578346
371 2644086669 2643221614 Bacteria 4260023
372 2644341623 2643221661 Bacteria 4267604
373 2644367910 2643221666 Bacteria 4265935
374 Ga0068861_100700313
375 JGI24736J21556_1002418
376 JGI24741J21665_1018305
377 JGI24752J21851_1000010
378 JGI24740J21852_10010630
379 JGI24739J22299_10064100
380 JGI24737J22298_10041790
381 JGI24735J21928_10041077
382 JGI24750J21931_1000016
383 JGI24748J21848_1000079
384 JGI24738J21930_10011829
385 JGI24749J21850_1000076
386 JGI24749J21850_1002128
387 JGI24034J26672_10000007
388 JGI24751J29686_10004108
389 JGI25165J46597_1000012
390 Ga0058859_11437825
391 Ga0065707_10085646
392 Ga0070658_10041030
393 Ga0070658_10625598
394 Ga0070683_100364698
395 Ga0070690_100000579
396 Ga0070670_100144390
397 Ga0070670_100219857
398 Ga0070677_10868589
399 Ga0068869_100461749
400 Ga0070666_10000017
401 Ga0070666_10000090
402 Ga0070666_10135207
403 Ga0070680_100292563
404 Ga0070682_100028127
405 Ga0070660_100141789
406 Ga0070689_100001897
407 Ga0070661_100267731
408 Ga0070668_100151555
409 Ga0070668_100335429
410 Ga0070668_101147309
411 Ga0070669_100000005
412 Ga0070669_100000024
413 Ga0070669_100000117
414 Ga0070671_100000006
415 Ga0070671_100223236
416 Ga0070688_100000254
417 Ga0070659_100286280
418 Ga0070667_100025262
419 Ga0070667_100177571
420 Ga0070667_100617568
421 Ga0070713_100242398
422 Ga0070711_101572051
423 Ga0070705_100001608
424 Ga0070708_100071881
425 Ga0070663_100134191
426 Ga0070662_100691247
427 Ga0070662_101101825
428 Ga0070681_10011304
429 Ga0068867_101425288
430 Ga0070685_10000384
431 Ga0070706_101221222
432 Ga0070679_100407594
433 Ga0070684_100179209
434 Ga0068853_100365269
435 Ga0070672_100653803
436 Ga0070686_100000014
437 Ga0070686_100411934
438 Ga0070665_100000042
439 Ga0070665_100000304
440 Ga0070665_100099899
441 Ga0068855_100100733
442 Ga0068855_100483140
443 Ga0070664_101023937
444 Ga0068857_100320018
445 Ga0068856_100491252
446 Ga0068856_100714684
447 Ga0068852_100014639
448 Ga0068852_101012547
449 Ga0068852_101648522
450 Ga0068859_100000362
451 Ga0068859_100002039
452 Ga0068859_100014236
453 Ga0068859_100726175
454 Ga0068864_100000425
455 Ga0068864_100000431
456 Ga0068864_101563455
457 Ga0068861_100001886
458 Ga0068861_100013551
459 Ga0068861_100056975
460 Ga0068851_10093496
461 Ga0068870_10363128
462 Ga0068863_100000068
463 Ga0068863_100001138
464 Ga0068863_100601397
465 Ga0068858_100000583
466 Ga0068858_100003970
467 Ga0068858_100008254
468 Ga0068858_100022080
469 Ga0068858_100071283
470 Ga0068860_100000062
471 Ga0068860_100009886
472 Ga0068860_100068897
473 Ga0068862_100000005
474 Ga0068862_100000283
475 Ga0068862_100001396
476 Ga0068862_100179209
477 Ga0081455_10000188
478 Ga0070717_10752308
479 Ga0075368_10000907
480 Ga0075363_100038873
481 Ga0075367_10006831
482 Ga0075366_10005310
483 Ga0075370_10037985
484 Ga0068865_101341132
485 Ga0097620_100000362
486 Ga0097620_100002039
487 Ga0097620_100014236
488 Ga0097620_100726388
489 Ga0105251_10154201
490 Ga0105250_10024997
491 Ga0105240_10053187
492 Ga0105240_10678837
493 Ga0105245_10006916
494 Ga0105245_10681817
495 Ga0105247_10000668
496 Ga0105247_10004786
497 Ga0105247_10061008
498 Ga0105243_10078360
499 Ga0105241_10657985
500 Ga0105248_10000171
501 Ga0105248_10023239
502 Ga0105248_10035095
503 Ga0105248_10140820
504 Ga0105237_11069912
505 Ga0105238_10026378
506 Ga0105249_10000012
507 Ga0105249_10004913
508 Ga0105249_10061536
509 Ga0105249_10075166
510 Ga0105239_10155416
511 Ga0157326_1004667
512 Ga0157373_10120924
513 Ga0157371_10406357
514 Ga0157371_10533802
515 Ga0157370_10015743
516 Ga0157370_10597699
517 Ga0157369_10455084
518 Ga0157378_11528082
519 Ga0163162_10007815
520 Ga0163162_10017810
521 Ga0163162_10095735
522 Ga0163162_10830285
523 Ga0157372_10085852
524 Ga0157372_10147415
525 Ga0163163_10013742
526 Ga0163163_10033808
527 Ga0163163_10148328
528 Ga0163163_10500049
529 Ga0157380_10002186
530 Ga0157380_10004510
531 Ga0157380_10076896
532 Ga0157379_10001118
533 Ga0157379_10011330
534 Ga0157379_10044637
535 Ga0157379_11594031
536 Ga0157376_10187358
537 Ga0163161_10000025
538 Ga0213876_10000150
539 Ga0213875_10091793
540 Ga0207672_1000368
541 Ga0207427_109956
542 Ga0209148_1014506
543 Ga0209233_1000058
544 Ga0207697_10000073
545 Ga0207697_10022516
546 Ga0207656_10005395
547 Ga0207713_1156208
548 Ga0207710_10000722
549 Ga0207710_10028597
550 Ga0207710_10044861
551 Ga0207680_10000012
552 Ga0207680_10000030
553 Ga0207680_10106979
554 Ga0207680_10535324
555 Ga0207647_10005615
556 Ga0207643_10306816
557 Ga0207705_10234894
558 Ga0207705_10354773
559 Ga0207705_10486268
560 Ga0207684_11303069
561 Ga0207654_10174119
562 Ga0207707_10047633
563 Ga0207695_10003749
564 Ga0207695_10022180
565 Ga0207695_10100421
566 Ga0207695_10346717
567 Ga0207671_10003715
568 Ga0207660_10128850
569 Ga0207662_10204155
570 Ga0207657_10029682
571 Ga0207649_10208367
572 Ga0207652_11026777
573 Ga0207681_10000003
574 Ga0207681_10000004
575 Ga0207681_10000182
576 Ga0207694_10024270
577 Ga0207694_10297104
578 Ga0207650_10434839
579 Ga0207687_10064786
580 Ga0207644_10000009
581 Ga0207644_10005017
582 Ga0207690_10926545
583 Ga0207706_10270731
584 Ga0207706_10335953
585 Ga0207686_10658440
586 Ga0207670_10007364
587 Ga0207691_10229608
588 Ga0207711_10001461
589 Ga0207711_10025781
590 Ga0207711_10038062
591 Ga0207711_10082227
592 Ga0207689_10162734
593 Ga0207679_10237024
594 Ga0207667_10019353
595 Ga0207667_10157631
596 Ga0207667_10815725
597 Ga0207712_10000021
598 Ga0207712_10025133
599 Ga0207712_10026369
600 Ga0207712_10036580
601 Ga0207668_10000005
602 Ga0207668_10001245
603 Ga0207668_10002153
604 Ga0207640_10287821
605 Ga0207640_11373833
606 Ga0207658_10000966
607 Ga0207658_10003120
608 Ga0207658_10006420
609 Ga0207658_10006467
610 Ga0207658_10130038
611 Ga0207703_10000715
612 Ga0207703_10000738
613 Ga0207703_10007602
614 Ga0207703_10010652
615 Ga0207703_10324022
616 Ga0207639_10042131
617 Ga0207639_10154658
618 Ga0207639_12088945
619 Ga0207678_10044784
620 Ga0207702_10003138
621 Ga0207702_10427259
622 Ga0207702_10465867
623 Ga0207641_10000037
624 Ga0207641_10572681
625 Ga0207648_11155213
626 Ga0207676_10000423
627 Ga0207676_10001030
628 Ga0207676_10001119
629 Ga0207676_11468312
630 Ga0207674_10110613
631 Ga0207674_10917293
632 Ga0207674_10980686
633 Ga0207675_100000088
634 Ga0207675_100000784
635 Ga0207675_100001338
636 Ga0207675_100091714
637 Ga0207698_10003900
638 Ga0207698_10590035
639 Ga0209813_10029082
640 Ga0268266_10000054
641 Ga0268266_10000362
642 Ga0268266_10196467
643 Ga0268265_10000001
644 Ga0268265_10000092
645 Ga0268265_10000109
646 Ga0268264_10000069
647 Ga0268264_10000074
648 Ga0268264_10001360
649 Ga0265338_10016067
650 Ga0265338_10488038
651 Ga0307511_10023976
652 Ga0265770_1022881
653 Ga0265327_10000140
654 Ga0307513_10031368
655 Ga0307513_10352523
656 Ga0307513_10393947
657 Ga0307509_10433055
658 Ga0307508_10002139
659 Ga0307406_10503162
660 Ga0307510_10106447
661 Ga0307510_10278614
662 Ga0373945_0083964
663 Ga0373943_0011490
664 Ga0373946_0490959
665 Ga0373935_0329764
666 Ga0373925_0035413
667 Ga0395900_0002796
668 Ga0395900_0147533
669 Ga0395898_0017635
670 Ga0395898_0568834
671 Ga0395905_0014055
672 Ga0436364_1452298
673 Ga0436365_1247886
674 Ga0436361_0602413
675 Ga0436363_1541909
676 Ga0451793_1837155
677 Ga0451795_0406994
678 Ga0466972_0098547
679 Ga0466961_0405561
680 Ga0466971_0341593
681 Ga0466960_0391785
682 Ga0466959_0112477
683 Ga0495627_000139
684 Ga0495638_0000481
685 Ga0495585_0124577
686 Ga0495585_0257966
687 Ga0495596_0000430
688 Ga0495583_0033867
689 Ga0495643_0333376
690 Ga0495648_0004739
691 Ga0495648_0107172
692 Ga0495648_0245695
693 Ga0495663_0015727
694 Ga0495666_0169204
695 Ga0495622_0313963
696 Ga0495668_0102975
697 Ga0495625_0000112
698 Ga0495625_0139551
699 Ga0495670_0112833
700 Ga0495649_0246738
701 Ga0495649_0349083
702 Ga0495677_0096713
703 Ga0495679_056350
704 Ga0495673_0077315
705 Ga0495686_0077985
706 Ga0496101_0213335
707 Ga0496102_0055699
708 Ga0496103_0002043
709 Ga0496103_0273465
710 Ga0496104_0141065
711 Ga0496105_0348507
712 Ga0496106_0180627
713 Ga0496106_0438539
714 Ga0496107_0030051
715 Ga0496108_0261785
716 Ga0496110_0788742
717 Ga0496112_0505008
718 Ga0496115_0193866
719 Ga0496116_0041868
720 Ga0496118_0056652
721 Ga0496121_0001030
722 Ga0496121_0054054
723 Ga0496124_0078148
724 Ga0496125_0072088
725 Ga0501037_0782389
726 nmdc:mga03n38_10269_c1
727 nmdc:mga00v17_1399_c1
728 nmdc:mga0k408_152398_c1
729 nmdc:mga06z11_312210_c1
730 nmdc:mga04h51_7364_c1
731 nmdc:mga07m45_150892_c1
732 nmdc:mga07m45_3954_c1
733 Ga0500643_008495
734 Ga0500651_0592472
735 Ga0500641_0060265
736 Ga0500562_042357
737 Ga0500562_044398
738 Ga0500658_0001269
739 Ga0500559_0022218
740 Ga0500559_0254507
741 Ga0500568_0001066
742 Ga0500616_0277473
743 2643998457
744 2644086669
745 2644341623
746 2644367910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

72

130

0.98

PF12802

MarR_2

MarR family

70

129

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9739 41 100
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9347 41 99
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9263 46 99
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9261 41 99
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.925 41 100
ID Description Score Start End Superfamily
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9739 41 100 1.10.10.10
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9711 41 81 1.10.10.10
af_Q2G033_15_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.942 41 114 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9369 41 101 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9347 41 99 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1X7BNV3-F1-model_v4 Putative HTH-type transcriptional regulator/GBAA_1941/BAS1801 0.8804 1 144 GO:0003677
GO:0003700
AF-A0A3A0FVZ1-F1-model_v4 MarR family transcriptional regulator 0.8795 12 149 GO:0003700
GO:0006950
AF-A0A1U7JEF1-F1-model_v4 HTH marR-type domain-containing protein 0.8724 2 141 GO:0003700
GO:0006950
AF-A0A379N4T7-F1-model_v4 deleted 0.8665 3 145
AF-A0A3S8RPI6-F1-model_v4 MarR family transcriptional regulator 0.8661 6 143 GO:0003677
GO:0003700

Map