F426192

General Info

Members Datasets Scaffolds Average Seq Length
372 226 744 262

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_016963|Ga0590071_016963_223_1125
Length 300
Sequence MPIPHPVLAGDPIIPRTRDPEATMPDHAATASRFLELHHQGRPLLLPNPWDQGSARLLAWLGFEALATTSSGFAATLGRLDGSVTRDEALAHAAAIVGATGLPVSADLENGFADDPAGVADTVRLALEAGLAGCSVEDATGRPDDPIYDAGLAAERVRAAAEAAHRGPVRLVLTARAENHLHGRSDLADTIARLQAYQDAGADVLYAPGLLRLEDIGRLVASVDRPVNVLALPGAPPVPELAAAGVSRVSVGGAFAFAAVGAVVEAATELREAGTYGFWQHASTGRTAAGSAFGGRDLEA

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
223 2619618881 Frankia sp. ACN1ag Isolate Unclassified
224 2619619003 Frankia sp. CpI1-P Isolate Nodule
225 2626541554 Frankia sp. AvcI.1 Isolate Nodule
226 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0.54
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0.81
Rhizoplane 2.42
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_016963 3300059421 Bacteria 1709
2 JGI25406J46586_10003897 3300003203 Bacteria 6975
3 JGI25407J50210_10001223 3300003373 Bacteria 5731
4 JGI25407J50210_10006218 3300003373 Bacteria 2968
5 JGI25407J50210_10008474 3300003373 Bacteria 2591
6 Ga0070658_10122170 3300005327 Bacteria 2164
7 Ga0070676_10061535 3300005328 Bacteria 2232
8 Ga0068869_100059958 3300005334 Bacteria 2787
9 Ga0070680_100089364 3300005336 Bacteria 2549
10 Ga0070682_100044759 3300005337 Bacteria 2741
11 Ga0070682_100215058 3300005337 Bacteria 1364
12 Ga0070660_100082031 3300005339 Unclassified 2532
13 Ga0070687_100086410 3300005343 Bacteria 1724
14 Ga0070661_100163070 3300005344 Bacteria 1689
15 Ga0070692_10065662 3300005345 Bacteria 1922
16 Ga0070674_100080309 3300005356 Bacteria 2328
17 Ga0070688_100336016 3300005365 Bacteria 1102
18 Ga0070659_100134674 3300005366 Bacteria 2009
19 Ga0070714_100092810 3300005435 Bacteria 2647
20 Ga0070713_100370909 3300005436 Bacteria 1332
21 Ga0070711_100048617 3300005439 Bacteria 2902
22 Ga0070708_100007136 3300005445 Bacteria 8915
23 Ga0070708_100164391 3300005445 Bacteria 2069
24 Ga0070663_100073431 3300005455 Bacteria 2495
25 Ga0070678_100198220 3300005456 Bacteria 1655
26 Ga0070678_100363071 3300005456 Bacteria 1248
27 Ga0070662_100022021 3300005457 Bacteria 4358
28 Ga0070662_100461193 3300005457 Bacteria 1056
29 Ga0070681_10009719 3300005458 Bacteria 9465
30 Ga0070681_10083256 3300005458 Bacteria 3153
31 Ga0070685_10135079 3300005466 Bacteria 1546
32 Ga0070706_100085933 3300005467 Bacteria 2915
33 Ga0070706_100321176 3300005467 Bacteria 1444
34 Ga0070706_100370229 3300005467 Bacteria 1335
35 Ga0070706_100439381 3300005467 Bacteria 1214
36 Ga0070707_100011692 3300005468 Bacteria 8191
37 Ga0070707_100024784 3300005468 Bacteria 5687
38 Ga0070707_100039501 3300005468 Unclassified 4510
39 Ga0070707_100046928 3300005468 Bacteria 4134
40 Ga0070707_100108789 3300005468 Bacteria 2688
41 Ga0070707_100125795 3300005468 Bacteria 2491
42 Ga0070707_100457129 3300005468 Bacteria 1237
43 Ga0070699_100007070 3300005518 Bacteria 9749
44 Ga0070679_100064005 3300005530 Bacteria 3665
45 Ga0070679_100102257 3300005530 Bacteria 2852
46 Ga0070672_100377641 3300005543 Bacteria 1212
47 Ga0070665_100100717 3300005548 Bacteria 2893
48 Ga0070665_100255476 3300005548 Bacteria 1753
49 Ga0070665_100266478 3300005548 Bacteria 1714
50 Ga0070665_100484091 3300005548 Bacteria 1248
51 Ga0068855_100003976 3300005563 Bacteria 18055
52 Ga0070664_100289123 3300005564 Unclassified 1479
53 Ga0068854_100090157 3300005578 Bacteria 2279
54 Ga0068854_100091320 3300005578 Unclassified 2266
55 Ga0068854_100244444 3300005578 Bacteria 1430
56 Ga0068856_100195649 3300005614 Bacteria 2036
57 Ga0068852_100042047 3300005616 Bacteria 3867
58 Ga0068859_100061122 3300005617 Bacteria 3796
59 Ga0068864_100118449 3300005618 Bacteria 2365
60 Ga0068861_100547218 3300005719 Bacteria 1054
61 Ga0068858_100134686 3300005842 Bacteria 2318
62 Ga0068862_100060424 3300005844 Bacteria 3256
63 Ga0081455_10041406 3300005937 Bacteria 4051
64 Ga0081538_10002106 3300005981 Bacteria 19846
65 Ga0081538_10003259 3300005981 Bacteria 15425
66 Ga0081538_10007436 3300005981 Bacteria 9481
67 Ga0081538_10011767 3300005981 Bacteria 7061
68 Ga0081538_10011912 3300005981 Bacteria 7017
69 Ga0081538_10021269 3300005981 Bacteria 4742
70 Ga0081538_10024540 3300005981 Bacteria 4292
71 Ga0081538_10037023 3300005981 Bacteria 3174
72 Ga0081539_10000601 3300005985 Bacteria 73299
73 Ga0081539_10049146 3300005985 Bacteria 2396
74 Ga0081539_10083195 3300005985 Bacteria 1676
75 Ga0070717_10038441 3300006028 Bacteria 3890
76 Ga0070717_10567191 3300006028 Bacteria 1029
77 Ga0075432_10010770 3300006058 Bacteria 3106
78 Ga0075428_100556812 3300006844 Bacteria 1226
79 Ga0075428_100715181 3300006844 Bacteria 1067
80 Ga0075430_100022054 3300006846 Bacteria 5413
81 Ga0075431_100138987 3300006847 Bacteria 2504
82 Ga0075433_10036286 3300006852 Bacteria 4245
83 Ga0075434_100005125 3300006871 Bacteria 11898
84 Ga0075434_100057727 3300006871 Bacteria 3857
85 Ga0075434_100515667 3300006871 Bacteria 1216
86 Ga0075429_100016842 3300006880 Bacteria 6324
87 Ga0097620_100061124 3300006931 Bacteria 3796
88 Ga0111539_10049353 3300009094 Bacteria 5020
89 Ga0111539_10152660 3300009094 Bacteria 2703
90 Ga0105245_10009402 3300009098 Bacteria 8528
91 Ga0114129_10184720 3300009147 Bacteria 2835
92 Ga0114129_10187334 3300009147 Bacteria 2811
93 Ga0114129_10194374 3300009147 Bacteria 2753
94 Ga0105242_10040366 3300009176 Bacteria 3761
95 Ga0105242_10111031 3300009176 Bacteria 2337
96 Ga0105238_10431254 3300009551 Bacteria 1314
97 Ga0105249_10063826 3300009553 Bacteria 3384
98 Ga0105249_10086292 3300009553 Bacteria 2927
99 Ga0105239_10098730 3300010375 Bacteria 3228
100 Ga0105239_10120734 3300010375 Bacteria 2910
101 Ga0157370_10024926 3300013104 Bacteria 5920
102 Ga0157369_10007164 3300013105 Bacteria 12850
103 Ga0157369_10286314 3300013105 Bacteria 1716
104 Ga0157369_10797706 3300013105 Bacteria 970
105 Ga0157374_10326831 3300013296 Bacteria 1521
106 Ga0157372_10828880 3300013307 Bacteria 1074
107 Ga0157375_10069851 3300013308 Bacteria 3520
108 Ga0163163_10059774 3300014325 Bacteria 3771
109 Ga0163163_10195126 3300014325 Bacteria 2073
110 Ga0163163_10689739 3300014325 Bacteria 1085
111 Ga0157377_10031146 3300014745 Bacteria 2896
112 Ga0163161_10028509 3300017792 Bacteria 3966
113 Ga0163161_10051336 3300017792 Bacteria 2986
114 Ga0206353_10493354 3300020082 Bacteria 1884
115 Ga0206353_11243608 3300020082 Unclassified 1039
116 Ga0213875_10000887 3300021388 Bacteria 21969
117 Ga0207688_10002995 3300025901 Bacteria 9201
118 Ga0207645_10169710 3300025907 Unclassified 1429
119 Ga0207643_10098439 3300025908 Bacteria 1712
120 Ga0207705_10454563 3300025909 Bacteria 993
121 Ga0207684_10065124 3300025910 Bacteria 3095
122 Ga0207684_10289647 3300025910 Bacteria 1412
123 Ga0207684_10401854 3300025910 Bacteria 1178
124 Ga0207684_10463683 3300025910 Bacteria 1087
125 Ga0207707_10017391 3300025912 Bacteria 6269
126 Ga0207660_10076096 3300025917 Bacteria 2454
127 Ga0207662_10046241 3300025918 Bacteria 2575
128 Ga0207657_10022767 3300025919 Bacteria 5852
129 Ga0207652_10088534 3300025921 Bacteria 2716
130 Ga0207646_10001463 3300025922 Bacteria 29237
131 Ga0207646_10020411 3300025922 Bacteria 6138
132 Ga0207646_10034054 3300025922 Unclassified 4604
133 Ga0207646_10230355 3300025922 Bacteria 1674
134 Ga0207646_10256833 3300025922 Bacteria 1579
135 Ga0207646_10299315 3300025922 Bacteria 1453
136 Ga0207659_10162134 3300025926 Bacteria 1756
137 Ga0207687_10173966 3300025927 Bacteria 1663
138 Ga0207700_10203905 3300025928 Bacteria 1668
139 Ga0207664_10096378 3300025929 Bacteria 2435
140 Ga0207706_10260719 3300025933 Bacteria 1513
141 Ga0207686_10084954 3300025934 Bacteria 2075
142 Ga0207669_10089595 3300025937 Bacteria 1998
143 Ga0207691_10379107 3300025940 Bacteria 1208
144 Ga0207689_10083990 3300025942 Bacteria 2618
145 Ga0207667_10267844 3300025949 Bacteria 1746
146 Ga0207712_10152397 3300025961 Bacteria 1787
147 Ga0207640_10036821 3300025981 Bacteria 3075
148 Ga0207640_10076531 3300025981 Unclassified 2272
149 Ga0207677_10045953 3300026023 Bacteria 2920
150 Ga0207703_10396845 3300026035 Bacteria 1279
151 Ga0207678_10020398 3300026067 Bacteria 5812
152 Ga0207678_10189960 3300026067 Bacteria 1755
153 Ga0207708_10069665 3300026075 Bacteria 2693
154 Ga0207702_10185349 3300026078 Bacteria 1919
155 Ga0207648_10047820 3300026089 Bacteria 3748
156 Ga0207676_10396065 3300026095 Bacteria 1289
157 Ga0207675_100010035 3300026118 Bacteria 8877
158 Ga0207675_100485805 3300026118 Bacteria 1228
159 Ga0207428_10001915 3300027907 Bacteria 21073
160 Ga0207428_10029679 3300027907 Bacteria 4528
161 Ga0268266_10391284 3300028379 Bacteria 1313
162 Ga0268266_10544540 3300028379 Bacteria 1111
163 Ga0265327_10012621 3300031251 Bacteria 5684
164 Ga0307408_100191462 3300031548 Bacteria 1648
165 Ga0307405_10004865 3300031731 Bacteria 6411
166 Ga0307405_10041873 3300031731 Bacteria 2784
167 Ga0307405_10122962 3300031731 Bacteria 1779
168 Ga0307405_10353582 3300031731 Bacteria 1134
169 Ga0307413_10065585 3300031824 Bacteria 2261
170 Ga0307410_10012543 3300031852 Bacteria 4907
171 Ga0307410_10064448 3300031852 Bacteria 2518
172 Ga0307410_10132113 3300031852 Bacteria 1835
173 Ga0307406_10031233 3300031901 Bacteria 3241
174 Ga0307406_10127646 3300031901 Bacteria 1780
175 Ga0307406_10138224 3300031901 Bacteria 1721
176 Ga0307407_10082504 3300031903 Bacteria 1948
177 Ga0307412_10074842 3300031911 Bacteria 2321
178 Ga0307412_10380456 3300031911 Bacteria 1143
179 Ga0307412_10602670 3300031911 Bacteria 930
180 Ga0307409_100004385 3300031995 Bacteria 7921
181 Ga0307409_100021432 3300031995 Bacteria 4430
182 Ga0307409_100183695 3300031995 Bacteria 1854
183 Ga0307409_100328315 3300031995 Bacteria 1434
184 Ga0307409_100393363 3300031995 Bacteria 1321
185 Ga0307416_100000401 3300032002 Bacteria 22209
186 Ga0307416_100002742 3300032002 Bacteria 10220
187 Ga0307416_100075108 3300032002 Bacteria 2827
188 Ga0307414_10032021 3300032004 Bacteria 3457
189 Ga0307411_10033086 3300032005 Bacteria 3203
190 Ga0307415_100000123 3300032126 Bacteria 33429
191 Ga0307415_100034092 3300032126 Bacteria 3310
192 Ga0307415_100082984 3300032126 Bacteria 2294
193 Ga0316214_1003964 3300033545 Bacteria 1888
194 Ga0373934_0000099 3300035086 Bacteria 30256
195 Ga0373953_0002023 3300035117 Bacteria 6031
196 Ga0373954_0000480 3300035118 Bacteria 14998
197 Ga0373954_0065288 3300035118 Bacteria 1722
198 Ga0373956_0000745 3300035119 Bacteria 13421
199 Ga0373956_0015314 3300035119 Bacteria 3209
200 Ga0373957_0000290 3300035120 Bacteria 12638
201 Ga0373955_0000055 3300035172 Bacteria 44447
202 Ga0373955_0136948 3300035172 Bacteria 1433
203 Ga0373924_0003040 3300035410 Bacteria 5721
204 Ga0373933_0000067 3300035724 Bacteria 63675
205 Ga0373933_0017776 3300035724 Bacteria 3990
206 Ga0373937_0000281 3300036401 Bacteria 48727
207 Ga0373937_0018664 3300036401 Bacteria 6197
208 Ga0373937_0065147 3300036401 Bacteria 3353
209 Ga0373937_0073833 3300036401 Bacteria 3147
210 Ga0395900_0092384 3300037418 Bacteria 3109
211 Ga0395900_0122698 3300037418 Bacteria 2665
212 Ga0395900_0295396 3300037418 Bacteria 1608
213 Ga0395898_0049387 3300037466 Bacteria 4122
214 Ga0436364_0030369 3300037853 Bacteria 21989
215 Ga0395901_0020061 3300038443 Bacteria 6839
216 Ga0395901_0056759 3300038443 Bacteria 4073
217 Ga0395901_0194435 3300038443 Bacteria 2127
218 Ga0395901_0303410 3300038443 Bacteria 1655
219 Ga0436365_0939433 3300039437 Bacteria 4415
220 Ga0451853_1561013 3300041512 Bacteria 2834
221 Ga0439448_0002874 3300042005 Bacteria 4718
222 Ga0439448_0016634 3300042005 Bacteria 2240
223 Ga0439455_0014496 3300042012 Bacteria 1801
224 Ga0439435_0018065 3300042436 Bacteria 1790
225 Ga0466969_0101051 3300044656 Bacteria 1357
226 Ga0466969_0134980 3300044656 Bacteria 1143
227 Ga0466972_0017046 3300044658 Bacteria 3634
228 Ga0466972_0032337 3300044658 Bacteria 2569
229 Ga0466965_0024921 3300044683 Bacteria 2895
230 Ga0466965_0027097 3300044683 Bacteria 2780
231 Ga0466965_0384025 3300044683 Bacteria 774
232 Ga0466966_0020935 3300044684 Bacteria 4299
233 Ga0466966_0109320 3300044684 Bacteria 1705
234 Ga0466961_0009077 3300044693 Bacteria 6341
235 Ga0466963_0000051 3300044694 Bacteria 39254
236 Ga0466963_0037399 3300044694 Bacteria 3169
237 Ga0466963_0038617 3300044694 Bacteria 3123
238 Ga0466963_0228295 3300044694 Bacteria 1304
239 Ga0466971_0013628 3300044719 Bacteria 3573
240 Ga0466971_0040727 3300044719 Bacteria 2086
241 Ga0466970_0037203 3300044765 Bacteria 2579
242 Ga0466957_0099570 3300044842 Bacteria 1831
243 Ga0466960_0025110 3300044901 Bacteria 2694
244 Ga0466960_0035903 3300044901 Bacteria 2319
245 Ga0466959_0042285 3300045049 Bacteria 3361
246 Ga0466959_0081112 3300045049 Bacteria 2338
247 Ga0466959_0084147 3300045049 Bacteria 2290
248 Ga0466959_0218066 3300045049 Bacteria 1324
249 Ga0466958_0012244 3300045836 Bacteria 4855
250 Ga0466958_0022775 3300045836 Bacteria 3672
251 Ga0466958_0040843 3300045836 Bacteria 2788
252 Ga0466958_0129608 3300045836 Bacteria 1583
253 Ga0466958_0242057 3300045836 Bacteria 1153
254 Ga0466967_0000612 3300045976 Bacteria 17825
255 Ga0466967_0001088 3300045976 Bacteria 15045
256 Ga0466967_0005868 3300045976 Bacteria 8595
257 Ga0466967_0153267 3300045976 Bacteria 2156
258 Ga0466967_0188391 3300045976 Bacteria 1949
259 Ga0466967_0611007 3300045976 Bacteria 1076
260 Ga0495592_0000041 3300046454 Bacteria 123431
261 Ga0495592_0149172 3300046454 Bacteria 1619
262 Ga0495603_0002488 3300046455 Bacteria 10843
263 Ga0495641_0000010 3300046461 Bacteria 158798
264 Ga0495651_0000018 3300046462 Bacteria 123195
265 Ga0495651_0008017 3300046462 Bacteria 8097
266 Ga0495651_0122601 3300046462 Bacteria 1907
267 Ga0495653_0059287 3300046463 Bacteria 2906
268 Ga0495584_0022521 3300046491 Bacteria 3196
269 Ga0495608_0000039 3300046511 Bacteria 123195
270 Ga0495608_0025246 3300046511 Bacteria 4056
271 Ga0495608_0267208 3300046511 Bacteria 1064
272 Ga0495628_0000604 3300046516 Bacteria 33024
273 Ga0495652_0000092 3300046529 Bacteria 96258
274 Ga0495652_0042877 3300046529 Bacteria 3900
275 Ga0495587_0000034 3300046536 Bacteria 123432
276 Ga0495587_0097983 3300046536 Bacteria 1690
277 Ga0495667_0000095 3300046559 Bacteria 63648
278 Ga0495667_0090320 3300046559 Bacteria 1985
279 Ga0495634_0252317 3300046642 Bacteria 1079
280 Ga0495657_0001525 3300046675 Bacteria 19937
281 Ga0495657_0027094 3300046675 Bacteria 4049
282 Ga0495599_0000079 3300046678 Bacteria 67315
283 Ga0495599_0016673 3300046678 Bacteria 4563
284 Ga0495599_0080984 3300046678 Bacteria 2028
285 Ga0495623_0000411 3300046679 Bacteria 28201
286 Ga0495647_0008668 3300046681 Bacteria 3423
287 Ga0495658_0152221 3300046683 Unclassified 1421
288 Ga0495613_0131523 3300046689 Bacteria 1792
289 Ga0495670_0020264 3300046691 Bacteria 3278
290 Ga0495600_0021279 3300046809 Bacteria 4152
291 Ga0495600_0102444 3300046809 Bacteria 1866
292 Ga0495604_0000039 3300047317 Bacteria 123431
293 Ga0495604_0036728 3300047317 Bacteria 3862
294 Ga0495680_0000028 3300047322 Bacteria 112865
295 Ga0495680_0024529 3300047322 Bacteria 5002
296 Ga0495675_0003426 3300047444 Bacteria 9553
297 Ga0495675_0017693 3300047444 Bacteria 4518
298 Ga0495684_0260305 3300047471 Bacteria 1259
299 Ga0495602_0000043 3300048088 Bacteria 123431
300 Ga0495602_0072404 3300048088 Bacteria 2938
301 Ga0495602_0361714 3300048088 Bacteria 1044
302 Ga0496108_0000004 3300048911 Bacteria 545055
303 Ga0496108_0191789 3300048911 Bacteria 1771
304 Ga0496109_0000031 3300048912 Bacteria 163998
305 Ga0496110_0051740 3300048913 Bacteria 3609
306 Ga0496110_0265028 3300048913 Bacteria 1564
307 Ga0496110_0524598 3300048913 Bacteria 1077
308 Ga0496111_0382408 3300048914 Bacteria 1041
309 Ga0496112_0011122 3300048915 Bacteria 8203
310 Ga0496114_0090404 3300048917 Bacteria 2599
311 Ga0496125_0310538 3300048928 Archaea 961
312 Ga0496126_0126860 3300048929 Bacteria 2208
313 Ga0501031_0004068 3300049568 Bacteria 9434
314 Ga0501031_0150668 3300049568 Bacteria 1520
315 Ga0501032_0022422 3300049569 Bacteria 4376
316 Ga0501036_0000097 3300049572 Bacteria 54396
317 Ga0501037_0026227 3300049573 Bacteria 4306
318 Ga0501038_0004920 3300049574 Bacteria 12407
319 Ga0501039_0002216 3300049575 Bacteria 14366
320 Ga0501040_0000363 3300049576 Bacteria 26824
321 Ga0501041_0003714 3300049577 Bacteria 8774
322 Ga0501042_0005784 3300049578 Bacteria 7984
323 Ga0501042_0044338 3300049578 Bacteria 3169
324 Ga0501043_0014431 3300049579 Bacteria 6182
325 Ga0501046_0007301 3300049580 Bacteria 9720
326 Ga0501048_0000134 3300049582 Bacteria 44224
327 Ga0501070_0231883 3300049586 Unclassified 1512
328 Ga0501071_0000068 3300049587 Bacteria 36843
329 Ga0501072_0000176 3300049588 Bacteria 46095
330 Ga0501074_0002239 3300049590 Bacteria 13426
331 Ga0501075_0001605 3300049591 Bacteria 14800
332 Ga0501077_0003349 3300049593 Bacteria 9630
333 Ga0501079_0000238 3300049741 Bacteria 33084
334 Ga0501080_0004966 3300049742 Bacteria 11842
335 Ga0501080_0162394 3300049742 Bacteria 2063
336 Ga0501081_0006861 3300049743 Bacteria 7404
337 Ga0501083_0011467 3300049744 Bacteria 6218
338 Ga0501035_0025537 3300049822 Bacteria 5415
339 Ga0501044_0403871 3300049823 Bacteria 1278
340 Ga0501044_0428716 3300049823 Bacteria 1232
341 Ga0501045_0000734 3300049824 Bacteria 20887
342 nmdc:mga05p37_131549_c1 3300050507 Bacteria 3070
343 nmdc:mga05p37_189193_c1 3300050507 Bacteria 2500
344 nmdc:mga05p37_4509_c1 3300050507 Bacteria 16276
345 nmdc:mga05p37_6294_c1 3300050507 Bacteria 13968
346 nmdc:mga09592_84189_c1 3300050508 Bacteria 2712
347 nmdc:mga0qj67_5049_c1 3300050509 Bacteria 9597
348 nmdc:mga06r32_134320_c1 3300050510 Bacteria 2449
349 nmdc:mga08y16_117526_c1 3300050511 Bacteria 2768
350 nmdc:mga08y16_36287_c1 3300050511 Bacteria 5176
351 nmdc:mga08y16_44938_c1 3300050511 Bacteria 4629
352 nmdc:mga0n895_115889_c1 3300050512 Bacteria 2698
353 nmdc:mga0n895_65441_c1 3300050512 Bacteria 3598
354 nmdc:mga08x19_78776_c1 3300050514 Bacteria 2160
355 nmdc:mga0a205_1177_c2 3300050515 Bacteria 13064
356 nmdc:mga0a205_64736_c1 3300050515 Bacteria 3532
357 Ga0495595_0000471 3300053084 Bacteria 15316
358 Ga0495595_0124267 3300053084 Bacteria 1258
359 Ga0495595_0234782 3300053084 Bacteria 917
360 Ga0495619_0305474 3300053085 Bacteria 1102
361 Ga0500614_000060 3300053123 Bacteria 23367
362 Ga0501084_0001210 3300054114 Bacteria 20253
363 Ga0590075_019014 3300059424 Bacteria 1702
364 Ga0501082_0002817 3300060353 Bacteria 15180
365 Ga0466962_0008017 3300061719 Bacteria 5065
366 Ga0466962_0018993 3300061719 Bacteria 3302
367 Ga0530510_0001013 3300061734 Bacteria 18636
368 2579856254 2579778521 Bacteria 7624758
369 2619854831 2619618881 Bacteria 7521104
370 2620352484 2619619003 Bacteria 7619552
371 2626640059 2626541554 Bacteria 7741902
372 8054923606 8054920844 Bacteria 7068637
373 Ga0590071_016963
374 JGI25406J46586_10003897
375 JGI25407J50210_10001223
376 JGI25407J50210_10006218
377 JGI25407J50210_10008474
378 Ga0070658_10122170
379 Ga0070676_10061535
380 Ga0068869_100059958
381 Ga0070680_100089364
382 Ga0070682_100044759
383 Ga0070682_100215058
384 Ga0070660_100082031
385 Ga0070687_100086410
386 Ga0070661_100163070
387 Ga0070692_10065662
388 Ga0070674_100080309
389 Ga0070688_100336016
390 Ga0070659_100134674
391 Ga0070714_100092810
392 Ga0070713_100370909
393 Ga0070711_100048617
394 Ga0070708_100007136
395 Ga0070708_100164391
396 Ga0070663_100073431
397 Ga0070678_100198220
398 Ga0070678_100363071
399 Ga0070662_100022021
400 Ga0070662_100461193
401 Ga0070681_10009719
402 Ga0070681_10083256
403 Ga0070685_10135079
404 Ga0070706_100085933
405 Ga0070706_100321176
406 Ga0070706_100370229
407 Ga0070706_100439381
408 Ga0070707_100011692
409 Ga0070707_100024784
410 Ga0070707_100039501
411 Ga0070707_100046928
412 Ga0070707_100108789
413 Ga0070707_100125795
414 Ga0070707_100457129
415 Ga0070699_100007070
416 Ga0070679_100064005
417 Ga0070679_100102257
418 Ga0070672_100377641
419 Ga0070665_100100717
420 Ga0070665_100255476
421 Ga0070665_100266478
422 Ga0070665_100484091
423 Ga0068855_100003976
424 Ga0070664_100289123
425 Ga0068854_100090157
426 Ga0068854_100091320
427 Ga0068854_100244444
428 Ga0068856_100195649
429 Ga0068852_100042047
430 Ga0068859_100061122
431 Ga0068864_100118449
432 Ga0068861_100547218
433 Ga0068858_100134686
434 Ga0068862_100060424
435 Ga0081455_10041406
436 Ga0081538_10002106
437 Ga0081538_10003259
438 Ga0081538_10007436
439 Ga0081538_10011767
440 Ga0081538_10011912
441 Ga0081538_10021269
442 Ga0081538_10024540
443 Ga0081538_10037023
444 Ga0081539_10000601
445 Ga0081539_10049146
446 Ga0081539_10083195
447 Ga0070717_10038441
448 Ga0070717_10567191
449 Ga0075432_10010770
450 Ga0075428_100556812
451 Ga0075428_100715181
452 Ga0075430_100022054
453 Ga0075431_100138987
454 Ga0075433_10036286
455 Ga0075434_100005125
456 Ga0075434_100057727
457 Ga0075434_100515667
458 Ga0075429_100016842
459 Ga0097620_100061124
460 Ga0111539_10049353
461 Ga0111539_10152660
462 Ga0105245_10009402
463 Ga0114129_10184720
464 Ga0114129_10187334
465 Ga0114129_10194374
466 Ga0105242_10040366
467 Ga0105242_10111031
468 Ga0105238_10431254
469 Ga0105249_10063826
470 Ga0105249_10086292
471 Ga0105239_10098730
472 Ga0105239_10120734
473 Ga0157370_10024926
474 Ga0157369_10007164
475 Ga0157369_10286314
476 Ga0157369_10797706
477 Ga0157374_10326831
478 Ga0157372_10828880
479 Ga0157375_10069851
480 Ga0163163_10059774
481 Ga0163163_10195126
482 Ga0163163_10689739
483 Ga0157377_10031146
484 Ga0163161_10028509
485 Ga0163161_10051336
486 Ga0206353_10493354
487 Ga0206353_11243608
488 Ga0213875_10000887
489 Ga0207688_10002995
490 Ga0207645_10169710
491 Ga0207643_10098439
492 Ga0207705_10454563
493 Ga0207684_10065124
494 Ga0207684_10289647
495 Ga0207684_10401854
496 Ga0207684_10463683
497 Ga0207707_10017391
498 Ga0207660_10076096
499 Ga0207662_10046241
500 Ga0207657_10022767
501 Ga0207652_10088534
502 Ga0207646_10001463
503 Ga0207646_10020411
504 Ga0207646_10034054
505 Ga0207646_10230355
506 Ga0207646_10256833
507 Ga0207646_10299315
508 Ga0207659_10162134
509 Ga0207687_10173966
510 Ga0207700_10203905
511 Ga0207664_10096378
512 Ga0207706_10260719
513 Ga0207686_10084954
514 Ga0207669_10089595
515 Ga0207691_10379107
516 Ga0207689_10083990
517 Ga0207667_10267844
518 Ga0207712_10152397
519 Ga0207640_10036821
520 Ga0207640_10076531
521 Ga0207677_10045953
522 Ga0207703_10396845
523 Ga0207678_10020398
524 Ga0207678_10189960
525 Ga0207708_10069665
526 Ga0207702_10185349
527 Ga0207648_10047820
528 Ga0207676_10396065
529 Ga0207675_100010035
530 Ga0207675_100485805
531 Ga0207428_10001915
532 Ga0207428_10029679
533 Ga0268266_10391284
534 Ga0268266_10544540
535 Ga0265327_10012621
536 Ga0307408_100191462
537 Ga0307405_10004865
538 Ga0307405_10041873
539 Ga0307405_10122962
540 Ga0307405_10353582
541 Ga0307413_10065585
542 Ga0307410_10012543
543 Ga0307410_10064448
544 Ga0307410_10132113
545 Ga0307406_10031233
546 Ga0307406_10127646
547 Ga0307406_10138224
548 Ga0307407_10082504
549 Ga0307412_10074842
550 Ga0307412_10380456
551 Ga0307412_10602670
552 Ga0307409_100004385
553 Ga0307409_100021432
554 Ga0307409_100183695
555 Ga0307409_100328315
556 Ga0307409_100393363
557 Ga0307416_100000401
558 Ga0307416_100002742
559 Ga0307416_100075108
560 Ga0307414_10032021
561 Ga0307411_10033086
562 Ga0307415_100000123
563 Ga0307415_100034092
564 Ga0307415_100082984
565 Ga0316214_1003964
566 Ga0373934_0000099
567 Ga0373953_0002023
568 Ga0373954_0000480
569 Ga0373954_0065288
570 Ga0373956_0000745
571 Ga0373956_0015314
572 Ga0373957_0000290
573 Ga0373955_0000055
574 Ga0373955_0136948
575 Ga0373924_0003040
576 Ga0373933_0000067
577 Ga0373933_0017776
578 Ga0373937_0000281
579 Ga0373937_0018664
580 Ga0373937_0065147
581 Ga0373937_0073833
582 Ga0395900_0092384
583 Ga0395900_0122698
584 Ga0395900_0295396
585 Ga0395898_0049387
586 Ga0436364_0030369
587 Ga0395901_0020061
588 Ga0395901_0056759
589 Ga0395901_0194435
590 Ga0395901_0303410
591 Ga0436365_0939433
592 Ga0451853_1561013
593 Ga0439448_0002874
594 Ga0439448_0016634
595 Ga0439455_0014496
596 Ga0439435_0018065
597 Ga0466969_0101051
598 Ga0466969_0134980
599 Ga0466972_0017046
600 Ga0466972_0032337
601 Ga0466965_0024921
602 Ga0466965_0027097
603 Ga0466965_0384025
604 Ga0466966_0020935
605 Ga0466966_0109320
606 Ga0466961_0009077
607 Ga0466963_0000051
608 Ga0466963_0037399
609 Ga0466963_0038617
610 Ga0466963_0228295
611 Ga0466971_0013628
612 Ga0466971_0040727
613 Ga0466970_0037203
614 Ga0466957_0099570
615 Ga0466960_0025110
616 Ga0466960_0035903
617 Ga0466959_0042285
618 Ga0466959_0081112
619 Ga0466959_0084147
620 Ga0466959_0218066
621 Ga0466958_0012244
622 Ga0466958_0022775
623 Ga0466958_0040843
624 Ga0466958_0129608
625 Ga0466958_0242057
626 Ga0466967_0000612
627 Ga0466967_0001088
628 Ga0466967_0005868
629 Ga0466967_0153267
630 Ga0466967_0188391
631 Ga0466967_0611007
632 Ga0495592_0000041
633 Ga0495592_0149172
634 Ga0495603_0002488
635 Ga0495641_0000010
636 Ga0495651_0000018
637 Ga0495651_0008017
638 Ga0495651_0122601
639 Ga0495653_0059287
640 Ga0495584_0022521
641 Ga0495608_0000039
642 Ga0495608_0025246
643 Ga0495608_0267208
644 Ga0495628_0000604
645 Ga0495652_0000092
646 Ga0495652_0042877
647 Ga0495587_0000034
648 Ga0495587_0097983
649 Ga0495667_0000095
650 Ga0495667_0090320
651 Ga0495634_0252317
652 Ga0495657_0001525
653 Ga0495657_0027094
654 Ga0495599_0000079
655 Ga0495599_0016673
656 Ga0495599_0080984
657 Ga0495623_0000411
658 Ga0495647_0008668
659 Ga0495658_0152221
660 Ga0495613_0131523
661 Ga0495670_0020264
662 Ga0495600_0021279
663 Ga0495600_0102444
664 Ga0495604_0000039
665 Ga0495604_0036728
666 Ga0495680_0000028
667 Ga0495680_0024529
668 Ga0495675_0003426
669 Ga0495675_0017693
670 Ga0495684_0260305
671 Ga0495602_0000043
672 Ga0495602_0072404
673 Ga0495602_0361714
674 Ga0496108_0000004
675 Ga0496108_0191789
676 Ga0496109_0000031
677 Ga0496110_0051740
678 Ga0496110_0265028
679 Ga0496110_0524598
680 Ga0496111_0382408
681 Ga0496112_0011122
682 Ga0496114_0090404
683 Ga0496125_0310538
684 Ga0496126_0126860
685 Ga0501031_0004068
686 Ga0501031_0150668
687 Ga0501032_0022422
688 Ga0501036_0000097
689 Ga0501037_0026227
690 Ga0501038_0004920
691 Ga0501039_0002216
692 Ga0501040_0000363
693 Ga0501041_0003714
694 Ga0501042_0005784
695 Ga0501042_0044338
696 Ga0501043_0014431
697 Ga0501046_0007301
698 Ga0501048_0000134
699 Ga0501070_0231883
700 Ga0501071_0000068
701 Ga0501072_0000176
702 Ga0501074_0002239
703 Ga0501075_0001605
704 Ga0501077_0003349
705 Ga0501079_0000238
706 Ga0501080_0004966
707 Ga0501080_0162394
708 Ga0501081_0006861
709 Ga0501083_0011467
710 Ga0501035_0025537
711 Ga0501044_0403871
712 Ga0501044_0428716
713 Ga0501045_0000734
714 nmdc:mga05p37_131549_c1
715 nmdc:mga05p37_189193_c1
716 nmdc:mga05p37_4509_c1
717 nmdc:mga05p37_6294_c1
718 nmdc:mga09592_84189_c1
719 nmdc:mga0qj67_5049_c1
720 nmdc:mga06r32_134320_c1
721 nmdc:mga08y16_117526_c1
722 nmdc:mga08y16_36287_c1
723 nmdc:mga08y16_44938_c1
724 nmdc:mga0n895_115889_c1
725 nmdc:mga0n895_65441_c1
726 nmdc:mga08x19_78776_c1
727 nmdc:mga0a205_1177_c2
728 nmdc:mga0a205_64736_c1
729 Ga0495595_0000471
730 Ga0495595_0124267
731 Ga0495595_0234782
732 Ga0495619_0305474
733 Ga0500614_000060
734 Ga0501084_0001210
735 Ga0590075_019014
736 Ga0501082_0002817
737 Ga0466962_0008017
738 Ga0466962_0018993
739 Ga0530510_0001013
740 2579856254
741 2619854831
742 2620352484
743 2626640059
744 8054923606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

34

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.8899 4 241
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.8875 4 241
4iqe-assembly1.cif.gz_A crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from bacillus anthracis str. ames ancestor 0.8586 7 227
4iqe-assembly1.cif.gz_B crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from bacillus anthracis str. ames ancestor 0.8584 4 227
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.8501 4 241
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8788 4 203 3.20.20.60
af_P9WLN9_1_257_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8447 11 223 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8424 4 203 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8403 6 226 3.20.20.60
1s2vC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8344 7 226 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7V8XHL1-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9518 126 230 GO:0016829
AF-A0A535HI30-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9409 134 245 GO:0016829
AF-A0A428YS20-F1-model_v4 Uncharacterized protein 0.9328 135 212 GO:0003824
AF-A0A535HI30-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9251 134 245 GO:0016829
AF-A0A6I5GUR1-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9235 157 228 GO:0016829

Map