F426181

General Info

Members Datasets Scaffolds Average Seq Length
372 252 742 320

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_116722_c1|nmdc:mga0n895_116722_c1_1015_2100
Length 361
Sequence LGDAPGEARRNAAAGFRCGAQTFIVFRQGKTRDARKAQREEQMMKPVTVFVSVLTVAAPLALPAAAQDTLKIAVGQINNWENQAPTLGQDAGIFKKHNLVLENFGTAGAGETVQAVISGSADIGIGVGVAGVMRAFSTGAPVRIVAPAFTGTGDLYWYVRADSALKSLKDTTAQNTLAYSTNGSSSHNLVTAFEELGAKAKPTSTGTPAATLTAVMSGQIDIGWAAPPFGLKEIKEGKIRIIAHGSDVPSLRDQTVRVTIANADTLKNRKDAVVRFVQAYRDAVDWMYSDPKAIELYAKKMNASEELIKESVAQFHPKSALQTDTMSDMPGIMRDAVKLKYLKEPLTSAQLSEFIQIPPRK

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
112 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
113 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
118 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.18
Nodule 0
Rhizoplane 5.91
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_116722_c1 3300050512 Bacteria 2688
2 2214911858 2209111006 Bacteria 6984
3 ARcpr5yngRDRAFT_c000416 3300000043 Bacteria 5603
4 JGI25404J52841_10001068 3300003659 Bacteria 4582
5 Ga0065704_10100477 3300005289 Bacteria 2272
6 Ga0065712_10088404 3300005290 Bacteria 2522
7 Ga0070658_10051458 3300005327 Bacteria 3338
8 Ga0070683_100332638 3300005329 Bacteria 1446
9 Ga0070690_100203247 3300005330 Unclassified 1380
10 Ga0070670_100126206 3300005331 Bacteria 2209
11 Ga0070680_100019270 3300005336 Bacteria 5407
12 Ga0070680_100047266 3300005336 Bacteria 3504
13 Ga0070660_100033096 3300005339 Bacteria 3894
14 Ga0070660_100255062 3300005339 Bacteria 1431
15 Ga0070687_100130772 3300005343 Unclassified 1449
16 Ga0070675_100541121 3300005354 Bacteria 1052
17 Ga0070671_100393055 3300005355 Unclassified 1186
18 Ga0070659_100182732 3300005366 Bacteria 1722
19 Ga0070709_10002905 3300005434 Bacteria 9238
20 Ga0070714_100015537 3300005435 Bacteria 6123
21 Ga0070713_100019737 3300005436 Bacteria 5156
22 Ga0070713_100109529 3300005436 Bacteria 2406
23 Ga0070713_100127199 3300005436 Bacteria 2243
24 Ga0070713_100617630 3300005436 Unclassified 1031
25 Ga0070710_10109125 3300005437 Bacteria 1660
26 Ga0070711_100002925 3300005439 Bacteria 9841
27 Ga0070711_100051430 3300005439 Bacteria 2830
28 Ga0070708_100092096 3300005445 Bacteria 2761
29 Ga0070663_100163677 3300005455 Bacteria 1714
30 Ga0070663_100366858 3300005455 Bacteria 1169
31 Ga0070662_100020435 3300005457 Bacteria 4509
32 Ga0070662_100130247 3300005457 Bacteria 1939
33 Ga0070681_10017593 3300005458 Bacteria 7142
34 Ga0070707_100107098 3300005468 Bacteria 2711
35 Ga0070698_100099343 3300005471 Unclassified 2884
36 Ga0070699_100000676 3300005518 Bacteria 31923
37 Ga0070679_100048213 3300005530 Bacteria 4245
38 Ga0070679_100128522 3300005530 Bacteria 2515
39 Ga0070695_100254153 3300005545 Unclassified 1280
40 Ga0070696_100076744 3300005546 Unclassified 2359
41 Ga0070704_100208134 3300005549 Bacteria 1583
42 Ga0070704_100348302 3300005549 Bacteria 1250
43 Ga0068855_100052022 3300005563 Bacteria 4823
44 Ga0070664_100064210 3300005564 Bacteria 3131
45 Ga0068854_100293023 3300005578 Bacteria 1314
46 Ga0068852_100038215 3300005616 Bacteria 4033
47 Ga0068858_100131766 3300005842 Bacteria 2345
48 Ga0081455_10002266 3300005937 Bacteria 22935
49 Ga0081455_10003756 3300005937 Bacteria 17351
50 Ga0081540_1015025 3300005983 Bacteria 4919
51 Ga0081540_1035995 3300005983 Bacteria 2646
52 Ga0081540_1070439 3300005983 Bacteria 1619
53 Ga0075365_10014490 3300006038 Bacteria 4744
54 Ga0075365_10014812 3300006038 Bacteria 4699
55 Ga0075368_10007331 3300006042 Bacteria 3889
56 Ga0075364_10082627 3300006051 Bacteria 2125
57 Ga0070716_100221261 3300006173 Bacteria 1272
58 Ga0075367_10143306 3300006178 Bacteria 1481
59 Ga0075366_10014171 3300006195 Bacteria 4551
60 Ga0097621_100278532 3300006237 Bacteria 1472
61 Ga0075370_10129213 3300006353 Bacteria 1474
62 Ga0075428_100013854 3300006844 Bacteria 8979
63 Ga0075428_100063146 3300006844 Bacteria 4054
64 Ga0075428_100334929 3300006844 Bacteria 1626
65 Ga0075428_100369350 3300006844 Bacteria 1539
66 Ga0075431_100032136 3300006847 Bacteria 5408
67 Ga0075433_10000050 3300006852 Bacteria 50089
68 Ga0075434_100023305 3300006871 Bacteria 6030
69 Ga0075434_100028257 3300006871 Bacteria 5509
70 Ga0075434_100059718 3300006871 Bacteria 3791
71 Ga0075429_100169905 3300006880 Bacteria 1910
72 Ga0075436_100021372 3300006914 Bacteria 4443
73 Ga0075435_100041232 3300007076 Bacteria 3690
74 Ga0075435_100073461 3300007076 Bacteria 2796
75 Ga0099794_10012985 3300007265 Bacteria 3614
76 Ga0111539_10000565 3300009094 Bacteria 47399
77 Ga0111539_10003400 3300009094 Bacteria 20958
78 Ga0114129_10000707 3300009147 Bacteria 42108
79 Ga0114129_10062691 3300009147 Bacteria 5193
80 Ga0114129_10131647 3300009147 Bacteria 3434
81 Ga0114129_10146935 3300009147 Bacteria 3229
82 Ga0114129_10681928 3300009147 Bacteria 1323
83 Ga0105243_10078892 3300009148 Bacteria 2682
84 Ga0105249_10048140 3300009553 Bacteria 3887
85 Ga0099796_10021998 3300010159 Bacteria 1972
86 Ga0105239_10078586 3300010375 Bacteria 3631
87 Ga0105239_10350907 3300010375 Unclassified 1666
88 Ga0157338_1000779 3300012515 Bacteria 2050
89 Ga0157373_10058200 3300013100 Bacteria 2741
90 Ga0157370_10350305 3300013104 Bacteria 1361
91 Ga0163162_10012207 3300013306 Bacteria 8385
92 Ga0157372_10126924 3300013307 Bacteria 2933
93 Ga0157372_10141282 3300013307 Bacteria 2774
94 Ga0157380_10146794 3300014326 Bacteria 2034
95 Ga0206354_11033569 3300020081 Bacteria 1080
96 Ga0213874_10012589 3300021377 Bacteria 2173
97 Ga0207666_1003666 3300025271 Bacteria 1895
98 Ga0207692_10006607 3300025898 Bacteria 4711
99 Ga0207645_10047241 3300025907 Bacteria 2749
100 Ga0207643_10303130 3300025908 Bacteria 995
101 Ga0207705_10046009 3300025909 Bacteria 3135
102 Ga0207707_10187927 3300025912 Unclassified 1803
103 Ga0207707_10205028 3300025912 Bacteria 1718
104 Ga0207663_10032367 3300025916 Bacteria 3103
105 Ga0207663_10281509 3300025916 Bacteria 1235
106 Ga0207660_10048970 3300025917 Bacteria 2992
107 Ga0207660_10130883 3300025917 Bacteria 1910
108 Ga0207662_10038496 3300025918 Bacteria 2802
109 Ga0207657_10010734 3300025919 Bacteria 9120
110 Ga0207657_10032489 3300025919 Bacteria 4714
111 Ga0207652_10032181 3300025921 Bacteria 4406
112 Ga0207652_10040268 3300025921 Bacteria 3967
113 Ga0207652_10167320 3300025921 Bacteria 1972
114 Ga0207681_10107646 3300025923 Bacteria 2022
115 Ga0207700_10119381 3300025928 Bacteria 2135
116 Ga0207644_10304164 3300025931 Bacteria 1286
117 Ga0207690_10127253 3300025932 Bacteria 1859
118 Ga0207706_10031828 3300025933 Bacteria 4698
119 Ga0207670_10020401 3300025936 Bacteria 4072
120 Ga0207704_10045775 3300025938 Unclassified 2602
121 Ga0207665_10065393 3300025939 Bacteria 2473
122 Ga0207691_10038473 3300025940 Bacteria 4427
123 Ga0207689_10162545 3300025942 Bacteria 1840
124 Ga0207661_10118230 3300025944 Bacteria 2253
125 Ga0207667_10081399 3300025949 Bacteria 3354
126 Ga0207640_10315811 3300025981 Bacteria 1242
127 Ga0207703_10375164 3300026035 Bacteria 1314
128 Ga0207639_10243527 3300026041 Bacteria 1565
129 Ga0207678_10009543 3300026067 Bacteria 8535
130 Ga0207648_10007504 3300026089 Bacteria 10711
131 Ga0207675_100056382 3300026118 Bacteria 3665
132 Ga0207675_100111275 3300026118 Bacteria 2584
133 Ga0209813_10055448 3300027866 Bacteria 1252
134 Ga0207428_10000485 3300027907 Bacteria 47761
135 Ga0207428_10000506 3300027907 Bacteria 46593
136 Ga0268266_10252178 3300028379 Bacteria 1633
137 Ga0265318_10033208 3300028577 Bacteria 1993
138 Ga0265338_10002000 3300028800 Bacteria 31675
139 Ga0265338_10332042 3300028800 Bacteria 1098
140 Ga0265325_10000044 3300031241 Bacteria 89107
141 Ga0265325_10000613 3300031241 Bacteria 26022
142 Ga0265325_10015740 3300031241 Bacteria 4244
143 Ga0265325_10036588 3300031241 Bacteria 2599
144 Ga0265325_10044437 3300031241 Bacteria 2314
145 Ga0265339_10004943 3300031249 Bacteria 8978
146 Ga0265339_10006516 3300031249 Bacteria 7652
147 Ga0265331_10011088 3300031250 Bacteria 4945
148 Ga0265316_10088173 3300031344 Bacteria 2370
149 Ga0265313_10001282 3300031595 Bacteria 23786
150 Ga0265313_10013996 3300031595 Bacteria 4776
151 Ga0265313_10045602 3300031595 Bacteria 2133
152 Ga0265314_10013429 3300031711 Bacteria 6615
153 Ga0265342_10000059 3300031712 Bacteria 118337
154 Ga0265342_10071321 3300031712 Bacteria 2024
155 Ga0373930_0000046 3300034816 Bacteria 11004
156 Ga0373948_0000290 3300034817 Bacteria 6071
157 Ga0373950_0000160 3300034818 Bacteria 9783
158 Ga0373959_0000973 3300034820 Bacteria 4756
159 Ga0373938_0000332 3300034957 Bacteria 7475
160 Ga0373926_0043866 3300035083 Unclassified 1601
161 Ga0373926_0091636 3300035083 Bacteria 1130
162 Ga0373928_0000109 3300035084 Bacteria 14956
163 Ga0373929_0000097 3300035085 Bacteria 14514
164 Ga0373940_0005364 3300035088 Bacteria 2772
165 Ga0373949_0000836 3300035090 Bacteria 9822
166 Ga0373949_0040749 3300035090 Unclassified 1141
167 Ga0373951_0000383 3300035091 Bacteria 13184
168 Ga0373923_0002021 3300035111 Bacteria 6106
169 Ga0373923_0048918 3300035111 Bacteria 1767
170 Ga0373932_0000087 3300035112 Bacteria 24305
171 Ga0373939_0000357 3300035114 Bacteria 11592
172 Ga0373941_0000112 3300035115 Bacteria 13841
173 Ga0373953_0065685 3300035117 Bacteria 1490
174 Ga0373954_0015720 3300035118 Bacteria 3385
175 Ga0373956_0016862 3300035119 Bacteria 3071
176 Ga0373956_0023051 3300035119 Bacteria 2669
177 Ga0373960_0000239 3300035121 Bacteria 10237
178 Ga0373960_0062408 3300035121 Bacteria 1134
179 Ga0373943_0019993 3300035170 Unclassified 3084
180 Ga0373943_0177355 3300035170 Bacteria 1169
181 Ga0373946_0015054 3300035171 Bacteria 2926
182 Ga0373955_0003089 3300035172 Bacteria 7283
183 Ga0373955_0009827 3300035172 Bacteria 4499
184 Ga0373942_0000514 3300035207 Bacteria 10887
185 Ga0373961_0000165 3300035241 Bacteria 32291
186 Ga0373962_0000237 3300035242 Bacteria 11646
187 Ga0373931_0011342 3300035691 Bacteria 4305
188 Ga0373931_0204203 3300035691 Bacteria 1182
189 Ga0373935_0038236 3300035692 Bacteria 3004
190 Ga0373927_0013239 3300035695 Bacteria 5484
191 Ga0373927_0013268 3300035695 Bacteria 5477
192 Ga0373927_0017228 3300035695 Bacteria 4759
193 Ga0373927_0038850 3300035695 Bacteria 3090
194 Ga0373927_0040047 3300035695 Unclassified 3040
195 Ga0373947_0011614 3300035725 Bacteria 5052
196 Ga0373947_0026771 3300035725 Bacteria 3372
197 Ga0373947_0041061 3300035725 Bacteria 2757
198 Ga0373947_0046878 3300035725 Bacteria 2589
199 Ga0373947_0054757 3300035725 Bacteria 2408
200 Ga0373937_0062648 3300036401 Bacteria 3419
201 Ga0373925_0009277 3300037068 Bacteria 7160
202 Ga0373925_0229366 3300037068 Bacteria 1484
203 Ga0395899_0014235 3300037312 Bacteria 6072
204 Ga0395900_0019109 3300037418 Bacteria 6987
205 Ga0395900_0019326 3300037418 Bacteria 6949
206 Ga0395898_0005994 3300037466 Bacteria 13052
207 Ga0395898_0010583 3300037466 Bacteria 9632
208 Ga0395898_0203440 3300037466 Bacteria 1890
209 Ga0436364_0128638 3300037853 Bacteria 1479
210 Ga0395901_0054661 3300038443 Bacteria 4150
211 Ga0395901_0088320 3300038443 Bacteria 3242
212 Ga0395901_0168126 3300038443 Bacteria 2301
213 Ga0395901_0208311 3300038443 Bacteria 2047
214 Ga0436361_0333066 3300039447 Bacteria 6240
215 Ga0436363_0577477 3300039450 Bacteria 3405
216 Ga0439434_0055993 3300042435 Unclassified 1228
217 Ga0451577_0014608 3300042876 Bacteria 7315
218 Ga0466963_0012631 3300044694 Bacteria 5172
219 Ga0451576_0010805 3300045051 Bacteria 10448
220 Ga0466958_0041838 3300045836 Bacteria 2758
221 Ga0466967_0007158 3300045976 Bacteria 8011
222 Ga0466967_0044026 3300045976 Bacteria 3869
223 Ga0495617_059394 3300046452 Unclassified 1266
224 Ga0495592_0015785 3300046454 Bacteria 5730
225 Ga0495592_0028646 3300046454 Bacteria 4216
226 Ga0495603_0028479 3300046455 Bacteria 3369
227 Ga0495603_0056119 3300046455 Bacteria 2333
228 Ga0495603_0108156 3300046455 Bacteria 1623
229 Ga0495629_0012331 3300046459 Bacteria 6189
230 Ga0495638_0150693 3300046460 Bacteria 1349
231 Ga0495641_0026445 3300046461 Unclassified 2831
232 Ga0495651_0016988 3300046462 Bacteria 5637
233 Ga0495653_0002617 3300046463 Bacteria 14317
234 Ga0495582_0005927 3300046473 Bacteria 6811
235 Ga0495582_0016432 3300046473 Bacteria 4055
236 Ga0495582_0034339 3300046473 Bacteria 2788
237 Ga0495639_0010858 3300046475 Bacteria 3922
238 Ga0495639_0106395 3300046475 Bacteria 1328
239 Ga0495662_0054254 3300046476 Bacteria 1936
240 Ga0495662_0128287 3300046476 Bacteria 1246
241 Ga0495584_0024131 3300046491 Bacteria 3083
242 Ga0495584_0066713 3300046491 Bacteria 1810
243 Ga0495594_0112655 3300046499 Bacteria 1534
244 Ga0495596_0047620 3300046500 Bacteria 1682
245 Ga0495607_0004001 3300046501 Bacteria 11058
246 Ga0495607_0193135 3300046501 Bacteria 1013
247 Ga0495608_0031384 3300046511 Bacteria 3593
248 Ga0495618_0055223 3300046514 Bacteria 2515
249 Ga0495628_0035125 3300046516 Bacteria 4030
250 Ga0495630_0112738 3300046517 Bacteria 2060
251 Ga0495630_0281903 3300046517 Bacteria 1269
252 Ga0495644_0004449 3300046523 Bacteria 5508
253 Ga0495644_0089116 3300046523 Unclassified 1164
254 Ga0495666_0088320 3300046526 Bacteria 1464
255 Ga0495652_0082677 3300046529 Plasmid 2645
256 Ga0495665_0007499 3300046531 Bacteria 5904
257 Ga0495665_0054298 3300046531 Bacteria 2117
258 Ga0495640_0004790 3300046533 Bacteria 10769
259 Ga0495586_0088718 3300046535 Bacteria 1706
260 Ga0495587_0120202 3300046536 Bacteria 1505
261 Ga0495609_0062723 3300046538 Unclassified 1641
262 Ga0495645_0071739 3300046543 Bacteria 2497
263 Ga0495622_0051082 3300046557 Bacteria 1918
264 Ga0495622_0114518 3300046557 Bacteria 1233
265 Ga0495633_0003183 3300046558 Bacteria 11087
266 Ga0495633_0118618 3300046558 Bacteria 1226
267 Ga0495667_0063488 3300046559 Bacteria 2417
268 Ga0495656_0003271 3300046615 Bacteria 5465
269 Ga0495635_0224849 3300046663 Unclassified 1269
270 Ga0495659_0001233 3300046664 Bacteria 8851
271 Ga0495588_0021367 3300046674 Bacteria 3189
272 Ga0495657_0056191 3300046675 Bacteria 2622
273 Ga0495623_0005670 3300046679 Bacteria 8152
274 Ga0495647_0010515 3300046681 Bacteria 3153
275 Ga0495647_0012978 3300046681 Bacteria 2878
276 Ga0495658_0005416 3300046683 Bacteria 6272
277 Ga0495658_0011992 3300046683 Bacteria 4376
278 Ga0495613_0054712 3300046689 Bacteria 2933
279 Ga0495624_0012824 3300046690 Bacteria 5721
280 Ga0495624_0043179 3300046690 Bacteria 2876
281 Ga0495624_0048929 3300046690 Bacteria 2682
282 Ga0495670_0001899 3300046691 Bacteria 10303
283 Ga0495600_0002443 3300046809 Bacteria 10655
284 Ga0495581_0033176 3300047315 Bacteria 2989
285 Ga0495581_0152478 3300047315 Bacteria 1350
286 Ga0495604_0004875 3300047317 Bacteria 10629
287 Ga0495604_0318338 3300047317 Bacteria 1040
288 Ga0495674_0134024 3300047319 Unclassified 2086
289 Ga0495676_0026729 3300047321 Bacteria 4962
290 Ga0495676_0053853 3300047321 Bacteria 3203
291 Ga0495680_0010914 3300047322 Bacteria 8070
292 Ga0495680_0015896 3300047322 Bacteria 6479
293 Ga0495684_0006309 3300047471 Bacteria 9215
294 Ga0495593_0019989 3300047673 Bacteria 3750
295 Ga0495614_0089499 3300048089 Unclassified 1338
296 Ga0496101_0115923 3300048904 Bacteria 2021
297 Ga0496102_0026841 3300048905 Bacteria 5140
298 Ga0496104_0007452 3300048907 Bacteria 9667
299 Ga0496104_0041872 3300048907 Bacteria 4295
300 Ga0496104_0046989 3300048907 Bacteria 4068
301 Ga0496104_0173373 3300048907 Unclassified 2067
302 Ga0496105_0000402 3300048908 Bacteria 28437
303 Ga0496105_0012250 3300048908 Bacteria 6789
304 Ga0496106_0050709 3300048909 Bacteria 3128
305 Ga0496106_0091116 3300048909 Bacteria 2353
306 Ga0496106_0325326 3300048909 Unclassified 1234
307 Ga0496108_0000543 3300048911 Bacteria 29524
308 Ga0496109_0000967 3300048912 Bacteria 23738
309 Ga0496110_0038064 3300048913 Bacteria 4183
310 Ga0496111_0073266 3300048914 Bacteria 2494
311 Ga0496111_0205515 3300048914 Bacteria 1463
312 Ga0496112_0006925 3300048915 Bacteria 10005
313 Ga0496112_0236377 3300048915 Bacteria 1781
314 Ga0496113_0000246 3300048916 Bacteria 25589
315 Ga0496114_0051078 3300048917 Bacteria 3442
316 Ga0496115_0105902 3300048918 Bacteria 2308
317 Ga0496115_0256012 3300048918 Bacteria 1440
318 Ga0496121_0239947 3300048924 Bacteria 1264
319 Ga0501034_0134320 3300049571 Bacteria 2456
320 Ga0501036_0059458 3300049572 Bacteria 3238
321 Ga0501037_0174996 3300049573 Bacteria 1524
322 Ga0501047_0072025 3300049581 Bacteria 3326
323 Ga0501047_0079261 3300049581 Bacteria 3158
324 Ga0501070_0061120 3300049586 Bacteria 3122
325 Ga0501070_0130137 3300049586 Unclassified 2079
326 Ga0501071_0045338 3300049587 Bacteria 3157
327 Ga0501072_0006813 3300049588 Bacteria 8673
328 Ga0501073_0073010 3300049589 Bacteria 2389
329 Ga0501073_0091669 3300049589 Bacteria 2112
330 Ga0501073_0106194 3300049589 Bacteria 1949
331 nmdc:mga00v17_55796_c1 3300050491 Bacteria 2413
332 nmdc:mga0yw44_4842_c1 3300050492 Bacteria 6255
333 nmdc:mga0k408_69350_c1 3300050493 Bacteria 2057
334 nmdc:mga06z11_12808_c1 3300050494 Bacteria 3658
335 nmdc:mga06z11_54261_c1 3300050494 Bacteria 2065
336 nmdc:mga04h51_36832_c1 3300050495 Bacteria 1576
337 nmdc:mga07m45_45289_c1 3300050496 Bacteria 2470
338 nmdc:mga05p37_20292_c1 3300050507 Bacteria 8041
339 nmdc:mga05p37_21302_c1 3300050507 Bacteria 7848
340 nmdc:mga05p37_219_c1 3300050507 Bacteria 57577
341 nmdc:mga05p37_24971_c1 3300050507 Bacteria 7264
342 nmdc:mga05p37_289049_c1 3300050507 Bacteria 1952
343 nmdc:mga09592_512266_c1 3300050508 Bacteria 1032
344 nmdc:mga09592_88589_c1 3300050508 Bacteria 2643
345 nmdc:mga0qj67_1123_c1 3300050509 Bacteria 18547
346 nmdc:mga06r32_90203_c1 3300050510 Bacteria 2994
347 nmdc:mga08y16_127569_c1 3300050511 Unclassified 2646
348 nmdc:mga08y16_521271_c1 3300050511 Bacteria 1205
349 nmdc:mga08y16_56414_c1 3300050511 Bacteria 4106
350 nmdc:mga0n895_245483_c1 3300050512 Bacteria 1817
351 nmdc:mga0n895_318458_c1 3300050512 Bacteria 1576
352 nmdc:mga0rr50_27122_c1 3300050513 Bacteria 4006
353 nmdc:mga0rr50_43305_c2 3300050513 Bacteria 2958
354 nmdc:mga08x19_19561_c1 3300050514 Bacteria 4157
355 nmdc:mga08x19_347335_c1 3300050514 Bacteria 1035
356 nmdc:mga0a205_209021_c1 3300050515 Bacteria 1840
357 nmdc:mga0a205_97_c1 3300050515 Bacteria 49530
358 Ga0495601_0015957 3300053077 Bacteria 4545
359 Ga0495612_0019963 3300053078 Bacteria 2685
360 Ga0495595_0012426 3300053084 Bacteria 3579
361 Ga0495619_0055310 3300053085 Bacteria 2627
362 Ga0500644_0000722 3300053088 Bacteria 11687
363 Ga0500651_0000483 3300053093 Bacteria 20822
364 Ga0500652_057653 3300053131 Bacteria 1594
365 Ga0500616_0000006 3300053153 Bacteria 944738
366 Ga0500616_0004316 3300053153 Bacteria 10198
367 Ga0500616_0021747 3300053153 Bacteria 3590
368 Ga0500645_000290 3300053730 Bacteria 36019
369 Ga0501084_0112701 3300054114 Bacteria 2285
370 Ga0501082_0027351 3300060353 Bacteria 4911
371 Ga0501082_0032029 3300060353 Bacteria 4535
372 nmdc:mga0n895_116722_c1
373 2214911858
374 ARcpr5yngRDRAFT_c000416
375 JGI25404J52841_10001068
376 Ga0065704_10100477
377 Ga0065712_10088404
378 Ga0070658_10051458
379 Ga0070683_100332638
380 Ga0070690_100203247
381 Ga0070670_100126206
382 Ga0070680_100019270
383 Ga0070680_100047266
384 Ga0070660_100033096
385 Ga0070660_100255062
386 Ga0070687_100130772
387 Ga0070675_100541121
388 Ga0070671_100393055
389 Ga0070659_100182732
390 Ga0070709_10002905
391 Ga0070714_100015537
392 Ga0070713_100019737
393 Ga0070713_100109529
394 Ga0070713_100127199
395 Ga0070713_100617630
396 Ga0070710_10109125
397 Ga0070711_100002925
398 Ga0070711_100051430
399 Ga0070708_100092096
400 Ga0070663_100163677
401 Ga0070663_100366858
402 Ga0070662_100020435
403 Ga0070662_100130247
404 Ga0070681_10017593
405 Ga0070707_100107098
406 Ga0070698_100099343
407 Ga0070699_100000676
408 Ga0070679_100048213
409 Ga0070679_100128522
410 Ga0070695_100254153
411 Ga0070696_100076744
412 Ga0070704_100208134
413 Ga0070704_100348302
414 Ga0068855_100052022
415 Ga0070664_100064210
416 Ga0068854_100293023
417 Ga0068852_100038215
418 Ga0068858_100131766
419 Ga0081455_10002266
420 Ga0081455_10003756
421 Ga0081540_1015025
422 Ga0081540_1035995
423 Ga0081540_1070439
424 Ga0075365_10014490
425 Ga0075365_10014812
426 Ga0075368_10007331
427 Ga0075364_10082627
428 Ga0070716_100221261
429 Ga0075367_10143306
430 Ga0075366_10014171
431 Ga0097621_100278532
432 Ga0075370_10129213
433 Ga0075428_100013854
434 Ga0075428_100063146
435 Ga0075428_100334929
436 Ga0075428_100369350
437 Ga0075431_100032136
438 Ga0075433_10000050
439 Ga0075434_100023305
440 Ga0075434_100028257
441 Ga0075434_100059718
442 Ga0075429_100169905
443 Ga0075436_100021372
444 Ga0075435_100041232
445 Ga0075435_100073461
446 Ga0099794_10012985
447 Ga0111539_10000565
448 Ga0111539_10003400
449 Ga0114129_10000707
450 Ga0114129_10062691
451 Ga0114129_10131647
452 Ga0114129_10146935
453 Ga0114129_10681928
454 Ga0105243_10078892
455 Ga0105249_10048140
456 Ga0099796_10021998
457 Ga0105239_10078586
458 Ga0105239_10350907
459 Ga0157338_1000779
460 Ga0157373_10058200
461 Ga0157370_10350305
462 Ga0163162_10012207
463 Ga0157372_10126924
464 Ga0157372_10141282
465 Ga0157380_10146794
466 Ga0206354_11033569
467 Ga0213874_10012589
468 Ga0207666_1003666
469 Ga0207692_10006607
470 Ga0207645_10047241
471 Ga0207643_10303130
472 Ga0207705_10046009
473 Ga0207707_10187927
474 Ga0207707_10205028
475 Ga0207663_10032367
476 Ga0207663_10281509
477 Ga0207660_10048970
478 Ga0207660_10130883
479 Ga0207662_10038496
480 Ga0207657_10010734
481 Ga0207657_10032489
482 Ga0207652_10032181
483 Ga0207652_10040268
484 Ga0207652_10167320
485 Ga0207681_10107646
486 Ga0207700_10119381
487 Ga0207644_10304164
488 Ga0207690_10127253
489 Ga0207706_10031828
490 Ga0207670_10020401
491 Ga0207704_10045775
492 Ga0207665_10065393
493 Ga0207691_10038473
494 Ga0207689_10162545
495 Ga0207661_10118230
496 Ga0207667_10081399
497 Ga0207640_10315811
498 Ga0207703_10375164
499 Ga0207639_10243527
500 Ga0207678_10009543
501 Ga0207648_10007504
502 Ga0207675_100056382
503 Ga0207675_100111275
504 Ga0209813_10055448
505 Ga0207428_10000485
506 Ga0207428_10000506
507 Ga0268266_10252178
508 Ga0265318_10033208
509 Ga0265338_10002000
510 Ga0265338_10332042
511 Ga0265325_10000044
512 Ga0265325_10000613
513 Ga0265325_10015740
514 Ga0265325_10036588
515 Ga0265325_10044437
516 Ga0265339_10004943
517 Ga0265339_10006516
518 Ga0265331_10011088
519 Ga0265316_10088173
520 Ga0265313_10001282
521 Ga0265313_10013996
522 Ga0265313_10045602
523 Ga0265314_10013429
524 Ga0265342_10000059
525 Ga0265342_10071321
526 Ga0373930_0000046
527 Ga0373948_0000290
528 Ga0373950_0000160
529 Ga0373959_0000973
530 Ga0373938_0000332
531 Ga0373926_0043866
532 Ga0373926_0091636
533 Ga0373928_0000109
534 Ga0373929_0000097
535 Ga0373940_0005364
536 Ga0373949_0000836
537 Ga0373949_0040749
538 Ga0373951_0000383
539 Ga0373923_0002021
540 Ga0373923_0048918
541 Ga0373932_0000087
542 Ga0373939_0000357
543 Ga0373941_0000112
544 Ga0373953_0065685
545 Ga0373954_0015720
546 Ga0373956_0016862
547 Ga0373956_0023051
548 Ga0373960_0000239
549 Ga0373960_0062408
550 Ga0373943_0019993
551 Ga0373943_0177355
552 Ga0373946_0015054
553 Ga0373955_0003089
554 Ga0373955_0009827
555 Ga0373942_0000514
556 Ga0373961_0000165
557 Ga0373962_0000237
558 Ga0373931_0011342
559 Ga0373931_0204203
560 Ga0373935_0038236
561 Ga0373927_0013239
562 Ga0373927_0013268
563 Ga0373927_0017228
564 Ga0373927_0038850
565 Ga0373927_0040047
566 Ga0373947_0011614
567 Ga0373947_0026771
568 Ga0373947_0041061
569 Ga0373947_0046878
570 Ga0373947_0054757
571 Ga0373937_0062648
572 Ga0373925_0009277
573 Ga0373925_0229366
574 Ga0395899_0014235
575 Ga0395900_0019109
576 Ga0395900_0019326
577 Ga0395898_0005994
578 Ga0395898_0010583
579 Ga0395898_0203440
580 Ga0436364_0128638
581 Ga0395901_0054661
582 Ga0395901_0088320
583 Ga0395901_0168126
584 Ga0395901_0208311
585 Ga0436361_0333066
586 Ga0436363_0577477
587 Ga0439434_0055993
588 Ga0451577_0014608
589 Ga0466963_0012631
590 Ga0451576_0010805
591 Ga0466958_0041838
592 Ga0466967_0007158
593 Ga0466967_0044026
594 Ga0495617_059394
595 Ga0495592_0015785
596 Ga0495592_0028646
597 Ga0495603_0028479
598 Ga0495603_0056119
599 Ga0495603_0108156
600 Ga0495629_0012331
601 Ga0495638_0150693
602 Ga0495641_0026445
603 Ga0495651_0016988
604 Ga0495653_0002617
605 Ga0495582_0005927
606 Ga0495582_0016432
607 Ga0495582_0034339
608 Ga0495639_0010858
609 Ga0495639_0106395
610 Ga0495662_0054254
611 Ga0495662_0128287
612 Ga0495584_0024131
613 Ga0495584_0066713
614 Ga0495594_0112655
615 Ga0495596_0047620
616 Ga0495607_0004001
617 Ga0495607_0193135
618 Ga0495608_0031384
619 Ga0495618_0055223
620 Ga0495628_0035125
621 Ga0495630_0112738
622 Ga0495630_0281903
623 Ga0495644_0004449
624 Ga0495644_0089116
625 Ga0495666_0088320
626 Ga0495652_0082677
627 Ga0495665_0007499
628 Ga0495665_0054298
629 Ga0495640_0004790
630 Ga0495586_0088718
631 Ga0495587_0120202
632 Ga0495609_0062723
633 Ga0495645_0071739
634 Ga0495622_0051082
635 Ga0495622_0114518
636 Ga0495633_0003183
637 Ga0495633_0118618
638 Ga0495667_0063488
639 Ga0495656_0003271
640 Ga0495635_0224849
641 Ga0495659_0001233
642 Ga0495588_0021367
643 Ga0495657_0056191
644 Ga0495623_0005670
645 Ga0495647_0010515
646 Ga0495647_0012978
647 Ga0495658_0005416
648 Ga0495658_0011992
649 Ga0495613_0054712
650 Ga0495624_0012824
651 Ga0495624_0043179
652 Ga0495624_0048929
653 Ga0495670_0001899
654 Ga0495600_0002443
655 Ga0495581_0033176
656 Ga0495581_0152478
657 Ga0495604_0004875
658 Ga0495604_0318338
659 Ga0495674_0134024
660 Ga0495676_0026729
661 Ga0495676_0053853
662 Ga0495680_0010914
663 Ga0495680_0015896
664 Ga0495684_0006309
665 Ga0495593_0019989
666 Ga0495614_0089499
667 Ga0496101_0115923
668 Ga0496102_0026841
669 Ga0496104_0007452
670 Ga0496104_0041872
671 Ga0496104_0046989
672 Ga0496104_0173373
673 Ga0496105_0000402
674 Ga0496105_0012250
675 Ga0496106_0050709
676 Ga0496106_0091116
677 Ga0496106_0325326
678 Ga0496108_0000543
679 Ga0496109_0000967
680 Ga0496110_0038064
681 Ga0496111_0073266
682 Ga0496111_0205515
683 Ga0496112_0006925
684 Ga0496112_0236377
685 Ga0496113_0000246
686 Ga0496114_0051078
687 Ga0496115_0105902
688 Ga0496115_0256012
689 Ga0496121_0239947
690 Ga0501034_0134320
691 Ga0501036_0059458
692 Ga0501037_0174996
693 Ga0501047_0072025
694 Ga0501047_0079261
695 Ga0501070_0061120
696 Ga0501070_0130137
697 Ga0501071_0045338
698 Ga0501072_0006813
699 Ga0501073_0073010
700 Ga0501073_0091669
701 Ga0501073_0106194
702 nmdc:mga00v17_55796_c1
703 nmdc:mga0yw44_4842_c1
704 nmdc:mga0k408_69350_c1
705 nmdc:mga06z11_12808_c1
706 nmdc:mga06z11_54261_c1
707 nmdc:mga04h51_36832_c1
708 nmdc:mga07m45_45289_c1
709 nmdc:mga05p37_20292_c1
710 nmdc:mga05p37_21302_c1
711 nmdc:mga05p37_219_c1
712 nmdc:mga05p37_24971_c1
713 nmdc:mga05p37_289049_c1
714 nmdc:mga09592_512266_c1
715 nmdc:mga09592_88589_c1
716 nmdc:mga0qj67_1123_c1
717 nmdc:mga06r32_90203_c1
718 nmdc:mga08y16_127569_c1
719 nmdc:mga08y16_521271_c1
720 nmdc:mga08y16_56414_c1
721 nmdc:mga0n895_245483_c1
722 nmdc:mga0n895_318458_c1
723 nmdc:mga0rr50_27122_c1
724 nmdc:mga0rr50_43305_c2
725 nmdc:mga08x19_19561_c1
726 nmdc:mga08x19_347335_c1
727 nmdc:mga0a205_209021_c1
728 nmdc:mga0a205_97_c1
729 Ga0495601_0015957
730 Ga0495612_0019963
731 Ga0495595_0012426
732 Ga0495619_0055310
733 Ga0500644_0000722
734 Ga0500651_0000483
735 Ga0500652_057653
736 Ga0500616_0000006
737 Ga0500616_0004316
738 Ga0500616_0021747
739 Ga0500645_000290
740 Ga0501084_0112701
741 Ga0501082_0027351
742 Ga0501082_0032029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

82

294

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8458 27 317
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8297 27 317
3qsl-assembly1.cif.gz_A structure of cae31940 from bordetella bronchiseptica rb50 0.7887 24 298
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.7813 26 316
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.781 24 316
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8524 113 201 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.828 110 204 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8213 113 201 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8083 113 200 3.40.190.10
3gxaC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8082 26 108 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537SMP8-F1-model_v4 ABC transporter substrate-binding protein 0.9727 24 321
AF-A0A2E0IIF2-F1-model_v4 deleted 0.9661 14 314
AF-A0A537N981-F1-model_v4 ABC transporter substrate-binding protein 0.9506 4 320
AF-A0A537N981-F1-model_v4 ABC transporter substrate-binding protein 0.9475 4 320
AF-A0A537UMU3-F1-model_v4 ABC transporter substrate-binding protein 0.9427 15 167

Map