F426096

General Info

Members Datasets Scaffolds Average Seq Length
372 258 369 246

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10173683|Ga0307411_101736831
Length 278
Sequence MKRTGIVLVGTLMAVMTLRPAAQQLPPVPPMATQESNGHEGLIEDLVAANRALAMQNILDAWGHVSVRDDRNPNRYIIARSLAPELVTAADIMEFDLDSNPLDRRGPDQYGPRYMYDERFIHGEIYKARPDVKAIVHSHSPAVVPFSMTTVPLRPVYHMSFFLSGGVPIYEIRKYGGMTDLLVRNNALAKGLAETLGDRPVALLRGHGAVVVAEDIPTAVGRSIFLEFNAKVQAEAMALGGTITYVDPAEAKLRVRPNQYMKGWDIWKRKALATLDPS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
3 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
4 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
237 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
240 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
241 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
250 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.14
Nodule 0
Rhizoplane 10.75
Rhizosphere 75.81
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6145835 2162886012 Unclassified 1437
2 JGI25406J46586_10026289 3300003203 Bacteria 2246
3 JGI25406J46586_10042578 3300003203 Bacteria 1588
4 JGI25153J46596_10030957 3300003215 Bacteria 1811
5 Ga0055526_1042924 3300003771 Bacteria 1107
6 Ga0065712_10020245 3300005290 Bacteria 1446
7 Ga0070676_10032998 3300005328 Bacteria 2969
8 Ga0070677_10003287 3300005333 Bacteria 5205
9 Ga0070666_10223484 3300005335 Unclassified 1328
10 Ga0070689_100094480 3300005340 Bacteria 2361
11 Ga0070689_100538487 3300005340 Bacteria 1005
12 Ga0070691_10013259 3300005341 Bacteria 3775
13 Ga0070687_100053371 3300005343 Bacteria 2102
14 Ga0070668_100279062 3300005347 Bacteria 1395
15 Ga0070669_100164167 3300005353 Bacteria 1728
16 Ga0070674_100014977 3300005356 Bacteria 4830
17 Ga0070674_100041235 3300005356 Bacteria 3127
18 Ga0070673_100161257 3300005364 Unclassified 1907
19 Ga0070673_100244428 3300005364 Bacteria 1562
20 Ga0070688_100101076 3300005365 Bacteria 1901
21 Ga0070667_100514769 3300005367 Bacteria 1098
22 Ga0070713_100451442 3300005436 Unclassified 1207
23 Ga0070705_100117082 3300005440 Unclassified 1714
24 Ga0070694_100000760 3300005444 Bacteria 18024
25 Ga0070694_100090864 3300005444 Bacteria 2142
26 Ga0070708_100130254 3300005445 Unclassified 2328
27 Ga0070663_100267956 3300005455 Bacteria 1357
28 Ga0070678_100199541 3300005456 Bacteria 1650
29 Ga0070678_100683425 3300005456 Bacteria 923
30 Ga0068867_100653557 3300005459 Bacteria 923
31 Ga0070706_100358733 3300005467 Bacteria 1358
32 Ga0070698_100002697 3300005471 Bacteria 19514
33 Ga0070698_100045138 3300005471 Bacteria 4511
34 Ga0070699_100003763 3300005518 Bacteria 13408
35 Ga0070699_100031234 3300005518 Bacteria 4597
36 Ga0070699_100402173 3300005518 Unclassified 1238
37 Ga0070684_100188397 3300005535 Bacteria 1877
38 Ga0070697_100000998 3300005536 Bacteria 21338
39 Ga0070697_100043813 3300005536 Bacteria 3624
40 Ga0070672_100079685 3300005543 Bacteria 2622
41 Ga0070686_100190787 3300005544 Bacteria 1462
42 Ga0070686_100253007 3300005544 Bacteria 1287
43 Ga0070695_100000594 3300005545 Bacteria 19125
44 Ga0070695_100033528 3300005545 Bacteria 3213
45 Ga0070695_100772166 3300005545 Bacteria 768
46 Ga0068856_100086874 3300005614 Bacteria 3108
47 Ga0070702_100209476 3300005615 Bacteria 1296
48 Ga0068859_100190269 3300005617 Bacteria 2136
49 Ga0068859_100277028 3300005617 Bacteria 1770
50 Ga0068864_100021742 3300005618 Bacteria 5373
51 Ga0068861_100398947 3300005719 Bacteria 1220
52 Ga0068860_100058720 3300005843 Bacteria 3657
53 Ga0068862_100434352 3300005844 Bacteria 1235
54 Ga0081540_1050365 3300005983 Unclassified 2069
55 Ga0081539_10000521 3300005985 Bacteria 80101
56 Ga0081539_10004549 3300005985 Bacteria 15199
57 Ga0070717_10104503 3300006028 Bacteria 2409
58 Ga0075364_10097402 3300006051 Bacteria 1956
59 Ga0070716_100274666 3300006173 Unclassified 1160
60 Ga0070712_100038899 3300006175 Bacteria 3253
61 Ga0070712_100114304 3300006175 Unclassified 2020
62 Ga0075369_10053004 3300006186 Bacteria 1759
63 Ga0075366_10000650 3300006195 Bacteria 16368
64 Ga0097621_100567935 3300006237 Bacteria 1034
65 Ga0075370_10088231 3300006353 Bacteria 1788
66 Ga0068871_100472239 3300006358 Bacteria 1127
67 Ga0075433_10245540 3300006852 Bacteria 1589
68 Ga0075434_100000363 3300006871 Bacteria 32902
69 Ga0075434_100072872 3300006871 Bacteria 3427
70 Ga0075434_100406925 3300006871 Bacteria 1382
71 Ga0075436_100007036 3300006914 Bacteria 7703
72 Ga0075436_100016942 3300006914 Bacteria 4986
73 Ga0075436_100069776 3300006914 Bacteria 2428
74 Ga0075436_100133981 3300006914 Bacteria 1739
75 Ga0097620_100190271 3300006931 Bacteria 2136
76 Ga0097620_100277044 3300006931 Bacteria 1770
77 Ga0075435_100076854 3300007076 Bacteria 2737
78 Ga0075435_100116762 3300007076 Bacteria 2223
79 Ga0099795_10005538 3300007788 Unclassified 3369
80 Ga0111539_10083147 3300009094 Bacteria 3765
81 Ga0111539_10102299 3300009094 Bacteria 3362
82 Ga0105245_10151514 3300009098 Bacteria 2193
83 Ga0105245_10155209 3300009098 Bacteria 2168
84 Ga0105247_10014312 3300009101 Bacteria 4762
85 Ga0105248_10011801 3300009177 Bacteria 9637
86 Ga0105248_10411104 3300009177 Bacteria 1523
87 Ga0105238_10026328 3300009551 Bacteria 5928
88 Ga0105238_10289240 3300009551 Bacteria 1621
89 Ga0105249_10395342 3300009553 Bacteria 1411
90 Ga0099796_10051364 3300010159 Bacteria 1432
91 Ga0099796_10086041 3300010159 Unclassified 1161
92 Ga0105246_10066329 3300011119 Unclassified 2527
93 Ga0157378_10788711 3300013297 Bacteria 975
94 Ga0163162_10216848 3300013306 Bacteria 2044
95 Ga0163162_10321107 3300013306 Bacteria 1681
96 Ga0163162_10569518 3300013306 Bacteria 1260
97 Ga0157375_10161530 3300013308 Bacteria 2382
98 Ga0157380_10095023 3300014326 Bacteria 2468
99 Ga0182008_10024487 3300014497 Bacteria 3073
100 Ga0182008_10058552 3300014497 Unclassified 1901
101 Ga0157379_10059544 3300014968 Bacteria 3414
102 Ga0157376_10280182 3300014969 Unclassified 1570
103 Ga0163161_10534383 3300017792 Unclassified 959
104 Ga0163161_10687579 3300017792 Bacteria 851
105 Ga0209564_1001755 3300025295 Bacteria 20242
106 Ga0209564_1004388 3300025295 Bacteria 8651
107 Ga0209758_1000619 3300025297 Bacteria 54561
108 Ga0207682_10010002 3300025893 Unclassified 3726
109 Ga0207710_10057931 3300025900 Bacteria 1751
110 Ga0207688_10182993 3300025901 Bacteria 1250
111 Ga0207685_10042608 3300025905 Bacteria 1705
112 Ga0207699_10067683 3300025906 Bacteria 2172
113 Ga0207645_10040403 3300025907 Bacteria 2987
114 Ga0207684_10000819 3300025910 Bacteria 35958
115 Ga0207693_10026801 3300025915 Archaea 4559
116 Ga0207693_10066875 3300025915 Bacteria 2814
117 Ga0207663_10043773 3300025916 Bacteria 2744
118 Ga0207662_10016112 3300025918 Bacteria 4214
119 Ga0207646_10000768 3300025922 Bacteria 41565
120 Ga0207700_10041920 3300025928 Bacteria 3352
121 Ga0207700_10134882 3300025928 Bacteria 2021
122 Ga0207664_10348184 3300025929 Bacteria 1311
123 Ga0207644_10082133 3300025931 Bacteria 2383
124 Ga0207706_10016088 3300025933 Bacteria 6760
125 Ga0207706_10320811 3300025933 Unclassified 1348
126 Ga0207669_10001662 3300025937 Bacteria 9467
127 Ga0207669_10296262 3300025937 Bacteria 1227
128 Ga0207704_10278345 3300025938 Bacteria 1271
129 Ga0207691_10134252 3300025940 Bacteria 2185
130 Ga0207711_10005945 3300025941 Bacteria 10316
131 Ga0207651_10036395 3300025960 Bacteria 3213
132 Ga0207677_10193982 3300026023 Unclassified 1609
133 Ga0207708_10118125 3300026075 Bacteria 2064
134 Ga0207708_10128647 3300026075 Bacteria 1978
135 Ga0207702_10178580 3300026078 Unclassified 1953
136 Ga0207641_10140188 3300026088 Bacteria 2181
137 Ga0207641_10321641 3300026088 Bacteria 1467
138 Ga0207648_10016092 3300026089 Bacteria 6851
139 Ga0207674_10206491 3300026116 Bacteria 1914
140 Ga0207683_10004502 3300026121 Bacteria 12024
141 Ga0207683_10030631 3300026121 Bacteria 4663
142 Ga0209968_1001100 3300027526 Bacteria 4123
143 Ga0209983_1003656 3300027665 Bacteria 3263
144 Ga0209971_1000041 3300027682 Bacteria 41543
145 Ga0209966_1000590 3300027695 Bacteria 8755
146 Ga0209998_10000028 3300027717 Bacteria 60458
147 Ga0207428_10000367 3300027907 Bacteria 57765
148 Ga0268265_10219766 3300028380 Bacteria 1662
149 Ga0268265_10316310 3300028380 Bacteria 1412
150 Ga0268265_10655710 3300028380 Bacteria 1009
151 Ga0268264_10111669 3300028381 Bacteria 2395
152 Ga0265338_10151317 3300028800 Bacteria 1802
153 Ga0265330_10047648 3300031235 Bacteria 1885
154 Ga0265320_10043619 3300031240 Bacteria 2216
155 Ga0265325_10002323 3300031241 Bacteria 12907
156 Ga0265325_10041078 3300031241 Bacteria 2426
157 Ga0265316_10589509 3300031344 Bacteria 789
158 Ga0307411_10173683 3300032005 Bacteria 1628
159 Ga0373948_0002422 3300034817 Bacteria 2754
160 Ga0373959_0033626 3300034820 Bacteria 1047
161 Ga0373938_0019045 3300034957 Bacteria 1369
162 Ga0373926_0060506 3300035083 Bacteria 1380
163 Ga0373929_0009753 3300035085 Bacteria 1786
164 Ga0373957_0066036 3300035120 Bacteria 1408
165 Ga0373943_0256822 3300035170 Unclassified 983
166 Ga0373931_0001411 3300035691 Bacteria 10287
167 Ga0373931_0002285 3300035691 Bacteria 8472
168 Ga0373931_0141716 3300035691 Bacteria 1393
169 Ga0373931_0149132 3300035691 Bacteria 1362
170 Ga0373927_0401404 3300035695 Bacteria 904
171 Ga0373947_0093672 3300035725 Bacteria 1878
172 Ga0373925_0405669 3300037068 Bacteria 1112
173 Ga0436364_0111693 3300037853 Bacteria 2055
174 Ga0436361_0142688 3300039447 Bacteria 1274
175 Ga0436362_0207965 3300039453 Bacteria 1450
176 Ga0439446_0096035 3300042156 Bacteria 933
177 Ga0439460_0039043 3300042461 Bacteria 1386
178 Ga0453683_0054334 3300044673 Bacteria 2506
179 Ga0466966_0078583 3300044684 Bacteria 2057
180 Ga0466964_0152696 3300044706 Bacteria 1072
181 Ga0466968_0086310 3300044735 Bacteria 1385
182 Ga0451576_0476624 3300045051 Bacteria 1311
183 Ga0466967_0067321 3300045976 Bacteria 3194
184 Ga0495638_0066388 3300046460 Bacteria 2217
185 Ga0495639_0134132 3300046475 Bacteria 1187
186 Ga0495594_0207487 3300046499 Bacteria 1117
187 Ga0495607_0016522 3300046501 Bacteria 4761
188 Ga0495607_0178267 3300046501 Bacteria 1067
189 Ga0495606_0039213 3300046507 Bacteria 3196
190 Ga0495610_0013419 3300046512 Bacteria 4870
191 Ga0495616_0012679 3300046513 Bacteria 4774
192 Ga0495620_0148545 3300046515 Bacteria 914
193 Ga0495628_0060724 3300046516 Bacteria 2966
194 Ga0495643_0027812 3300046522 Bacteria 3174
195 Ga0495648_0002269 3300046524 Bacteria 17954
196 Ga0495666_0123644 3300046526 Bacteria 1211
197 Ga0495654_0010260 3300046530 Bacteria 5099
198 Ga0495654_0199381 3300046530 Bacteria 857
199 Ga0495640_0318609 3300046533 Bacteria 963
200 Ga0495586_0047157 3300046535 Bacteria 2325
201 Ga0495586_0222269 3300046535 Bacteria 1073
202 Ga0495621_0016082 3300046539 Unclassified 2395
203 Ga0495656_0221456 3300046615 Unclassified 946
204 Ga0495634_0138880 3300046642 Bacteria 1544
205 Ga0495625_0121774 3300046660 Bacteria 1774
206 Ga0495635_0113041 3300046663 Bacteria 1854
207 Ga0495635_0308216 3300046663 Bacteria 1061
208 Ga0495661_0256545 3300046665 Bacteria 890
209 Ga0495599_0072692 3300046678 Bacteria 2147
210 Ga0495647_0216002 3300046681 Unclassified 845
211 Ga0495670_0018941 3300046691 Bacteria 3391
212 Ga0495600_0042526 3300046809 Bacteria 2962
213 Ga0495680_0504817 3300047322 Bacteria 820
214 Ga0495686_0023349 3300047472 Bacteria 4080
215 Ga0495615_0025462 3300048090 Bacteria 1373
216 Ga0496100_0005248 3300048903 Bacteria 6961
217 Ga0496101_0147280 3300048904 Bacteria 1798
218 Ga0496102_0012654 3300048905 Bacteria 7306
219 Ga0496102_0224637 3300048905 Bacteria 1770
220 Ga0496102_0953712 3300048905 Bacteria 779
221 Ga0496104_0000354 3300048907 Bacteria 41002
222 Ga0496104_0000651 3300048907 Bacteria 29753
223 Ga0496104_0033078 3300048907 Bacteria 4813
224 Ga0496105_0005041 3300048908 Bacteria 10000
225 Ga0496105_0007413 3300048908 Bacteria 8491
226 Ga0496105_0162314 3300048908 Bacteria 1834
227 Ga0496106_0043361 3300048909 Bacteria 3375
228 Ga0496106_0109031 3300048909 Bacteria 2154
229 Ga0496106_0119494 3300048909 Bacteria 2059
230 Ga0496106_0419484 3300048909 Bacteria 1075
231 Ga0496107_0084564 3300048910 Bacteria 2315
232 Ga0496107_0095141 3300048910 Bacteria 2179
233 Ga0496107_0165760 3300048910 Bacteria 1638
234 Ga0496108_0082924 3300048911 Bacteria 2719
235 Ga0496108_0089267 3300048911 Bacteria 2619
236 Ga0496108_0144705 3300048911 Bacteria 2049
237 Ga0496108_0953687 3300048911 Unclassified 734
238 Ga0496109_0023036 3300048912 Bacteria 5522
239 Ga0496109_0053775 3300048912 Bacteria 3673
240 Ga0496109_0146150 3300048912 Unclassified 2212
241 Ga0496109_0623829 3300048912 Bacteria 1015
242 Ga0496110_0225685 3300048913 Bacteria 1703
243 Ga0496110_0241450 3300048913 Bacteria 1644
244 Ga0496111_0135865 3300048914 Bacteria 1821
245 Ga0496112_0022376 3300048915 Bacteria 6025
246 Ga0496112_0033872 3300048915 Bacteria 4968
247 Ga0496112_0193404 3300048915 Bacteria 1995
248 Ga0496112_0621433 3300048915 Bacteria 1011
249 Ga0496113_0271241 3300048916 Bacteria 1356
250 Ga0496114_0006660 3300048917 Bacteria 9104
251 Ga0496114_0444123 3300048917 Bacteria 1149
252 Ga0496115_0030545 3300048918 Bacteria 4239
253 Ga0496115_0061824 3300048918 Bacteria 3020
254 Ga0496115_0195883 3300048918 Bacteria 1669
255 Ga0496116_0003138 3300048919 Bacteria 16576
256 Ga0496117_0105199 3300048920 Bacteria 1774
257 Ga0496118_0061267 3300048921 Bacteria 2787
258 Ga0496120_0156917 3300048923 Bacteria 1138
259 Ga0496121_0032870 3300048924 Bacteria 4706
260 Ga0496122_0065395 3300048925 Bacteria 2636
261 Ga0496123_0040398 3300048926 Bacteria 3249
262 Ga0496123_0089292 3300048926 Bacteria 1836
263 Ga0496124_0138697 3300048927 Bacteria 1922
264 Ga0496125_0000746 3300048928 Bacteria 53671
265 Ga0496125_0007153 3300048928 Bacteria 11912
266 Ga0496125_0063469 3300048928 Bacteria 2945
267 Ga0496126_0081406 3300048929 Bacteria 2862
268 Ga0501031_0020395 3300049568 Bacteria 4321
269 Ga0501031_0090383 3300049568 Bacteria 1997
270 Ga0501032_0105886 3300049569 Bacteria 1863
271 Ga0501033_0002905 3300049570 Bacteria 14342
272 Ga0501033_0055927 3300049570 Bacteria 2917
273 Ga0501034_0100267 3300049571 Bacteria 2890
274 Ga0501036_0005904 3300049572 Bacteria 9922
275 Ga0501037_0036354 3300049573 Bacteria 3630
276 Ga0501037_0068025 3300049573 Bacteria 2593
277 Ga0501038_0028791 3300049574 Bacteria 4932
278 Ga0501038_0097768 3300049574 Bacteria 2449
279 Ga0501039_0000827 3300049575 Bacteria 22353
280 Ga0501040_0009149 3300049576 Bacteria 6450
281 Ga0501041_0001501 3300049577 Bacteria 12934
282 Ga0501042_0005908 3300049578 Bacteria 7916
283 Ga0501042_0067526 3300049578 Bacteria 2556
284 Ga0501043_0035013 3300049579 Bacteria 3949
285 Ga0501046_0000720 3300049580 Bacteria 31979
286 Ga0501046_0356913 3300049580 Bacteria 1060
287 Ga0501047_0163323 3300049581 Bacteria 2098
288 Ga0501048_0002581 3300049582 Bacteria 13861
289 Ga0501048_0348961 3300049582 Bacteria 1055
290 Ga0501068_0426959 3300049584 Unclassified 856
291 Ga0501070_0003563 3300049586 Bacteria 13466
292 Ga0501070_0966740 3300049586 Bacteria 662
293 Ga0501071_0321845 3300049587 Bacteria 1174
294 Ga0501072_0004796 3300049588 Bacteria 10301
295 Ga0501072_0027339 3300049588 Bacteria 4450
296 Ga0501073_0062155 3300049589 Bacteria 2605
297 Ga0501073_0139014 3300049589 Bacteria 1683
298 Ga0501074_0077877 3300049590 Bacteria 2380
299 Ga0501075_0001731 3300049591 Bacteria 14332
300 Ga0501076_0000813 3300049592 Bacteria 20223
301 Ga0501076_0107479 3300049592 Bacteria 2253
302 Ga0501077_0000176 3300049593 Bacteria 36653
303 Ga0501079_0002177 3300049741 Bacteria 14133
304 Ga0501079_0513141 3300049741 Bacteria 942
305 Ga0501080_0177082 3300049742 Bacteria 1964
306 Ga0501080_0183875 3300049742 Bacteria 1922
307 Ga0501081_0000932 3300049743 Bacteria 17341
308 Ga0501083_0094817 3300049744 Bacteria 1970
309 Ga0501083_0117483 3300049744 Bacteria 1745
310 Ga0501083_0129785 3300049744 Bacteria 1652
311 Ga0501083_0230145 3300049744 Bacteria 1207
312 Ga0501035_0004129 3300049822 Bacteria 13800
313 Ga0501035_0086456 3300049822 Bacteria 2763
314 Ga0501044_0007444 3300049823 Bacteria 12041
315 Ga0501044_0366588 3300049823 Bacteria 1358
316 Ga0501044_0455473 3300049823 Bacteria 1185
317 Ga0501045_0030473 3300049824 Bacteria 3904
318 nmdc:mga0yw44_342932_c1 3300050492 Bacteria 1005
319 nmdc:mga0k408_2337_c1 3300050493 Bacteria 10087
320 nmdc:mga0n895_256973_c1 3300050512 Bacteria 1773
321 nmdc:mga0n895_34555_c1 3300050512 Bacteria 4867
322 nmdc:mga0n895_88_c1 3300050512 Bacteria 53153
323 nmdc:mga0rr50_1095_c1 3300050513 Bacteria 14709
324 nmdc:mga0rr50_5403_c1 3300050513 Bacteria 7617
325 nmdc:mga08x19_108775_c1 3300050514 Bacteria 1847
326 nmdc:mga08x19_178536_c1 3300050514 Bacteria 1449
327 nmdc:mga08x19_6008_c1 3300050514 Bacteria 7177
328 nmdc:mga08x19_61367_c1 3300050514 Bacteria 2436
329 nmdc:mga08x19_9363_c1 3300050514 Bacteria 5864
330 nmdc:mga0a205_10939_c1 3300050515 Bacteria 8348
331 Ga0495601_0172813 3300053077 Bacteria 1412
332 Ga0495601_0282327 3300053077 Bacteria 1082
333 Ga0495595_0025406 3300053084 Bacteria 2625
334 Ga0495595_0047427 3300053084 Bacteria 1982
335 Ga0495619_0013433 3300053085 Bacteria 5160
336 Ga0495619_0054446 3300053085 Bacteria 2648
337 Ga0495619_0058132 3300053085 Bacteria 2566
338 Ga0500644_0017903 3300053088 Bacteria 2065
339 Ga0500644_0074140 3300053088 Bacteria 1234
340 Ga0500651_0112596 3300053093 Bacteria 1659
341 Ga0500566_0003637 3300053094 Bacteria 9197
342 Ga0500650_0014728 3300053098 Bacteria 3314
343 Ga0500556_0000012 3300053104 Bacteria 250391
344 Ga0500562_036676 3300053108 Bacteria 1300
345 Ga0500592_002032 3300053116 Bacteria 3259
346 Ga0500593_068204 3300053117 Bacteria 1549
347 Ga0500595_059155 3300053119 Bacteria 1163
348 Ga0500608_020441 3300053122 Bacteria 3044
349 Ga0500642_0000055 3300053130 Bacteria 68809
350 Ga0500642_0161089 3300053130 Bacteria 1052
351 Ga0500652_000290 3300053131 Bacteria 18374
352 Ga0500559_0002046 3300053136 Bacteria 10793
353 Ga0500568_0008164 3300053139 Bacteria 5074
354 Ga0500577_0000112 3300053142 Bacteria 19856
355 Ga0500586_000358 3300053145 Bacteria 9071
356 Ga0500604_0020497 3300053151 Bacteria 1861
357 Ga0500616_0000035 3300053153 Bacteria 394242
358 Ga0500633_0017698 3300053160 Bacteria 2097
359 Ga0500636_0011861 3300053177 Bacteria 5103
360 Ga0500567_100231 3300053723 Bacteria 1205
361 Ga0501084_0002547 3300054114 Bacteria 14686
362 Ga0501084_0131778 3300054114 Bacteria 2104
363 Ga0501082_0002665 3300060353 Bacteria 15600
364 Ga0501082_0012892 3300060353 Bacteria 7185
365 Ga0501082_0189239 3300060353 Unclassified 1791
366 Ga0501082_0427546 3300060353 Bacteria 1157
367 Ga0466962_0215738 3300061719 Bacteria 939
368 Ga0530510_0000265 3300061734 Bacteria 33009
369 Ga0530510_0322359 3300061734 Bacteria 1158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0966740 Ga0501070_0966740_19_648 208
2 3300049570 Ga0501033_0002905 Ga0501033_0002905_9869_10579 217
3 3300049572 Ga0501036_0005904 Ga0501036_0005904_3556_4266 217
4 3300049573 Ga0501037_0036354 Ga0501037_0036354_91_801 217
5 3300049574 Ga0501038_0028791 Ga0501038_0028791_380_1090 217
6 3300049575 Ga0501039_0000827 Ga0501039_0000827_20653_21363 217
7 3300049576 Ga0501040_0009149 Ga0501040_0009149_4830_5540 217
8 3300049577 Ga0501041_0001501 Ga0501041_0001501_1719_2429 217
9 3300049578 Ga0501042_0005908 Ga0501042_0005908_3537_4247 217
10 3300049579 Ga0501043_0035013 Ga0501043_0035013_1021_1731 217
11 3300049580 Ga0501046_0000720 Ga0501046_0000720_15452_16162 217
12 3300049582 Ga0501048_0002581 Ga0501048_0002581_3839_4549 217
13 3300049586 Ga0501070_0003563 Ga0501070_0003563_11756_12466 217
14 3300049588 Ga0501072_0004796 Ga0501072_0004796_1114_1824 217
15 3300049589 Ga0501073_0139014 Ga0501073_0139014_914_1624 217
16 3300049591 Ga0501075_0001731 Ga0501075_0001731_996_1706 217
17 3300049592 Ga0501076_0000813 Ga0501076_0000813_3836_4546 217
18 3300049593 Ga0501077_0000176 Ga0501077_0000176_13617_14327 217
19 3300049741 Ga0501079_0002177 Ga0501079_0002177_1150_1860 217
20 3300049742 Ga0501080_0183875 Ga0501080_0183875_1144_1854 217
21 3300049743 Ga0501081_0000932 Ga0501081_0000932_4242_4952 217
22 3300049744 Ga0501083_0129785 Ga0501083_0129785_655_1365 217
23 3300049822 Ga0501035_0004129 Ga0501035_0004129_8758_9468 217
24 3300049823 Ga0501044_0366588 Ga0501044_0366588_64_774 217
25 3300049824 Ga0501045_0030473 Ga0501045_0030473_849_1559 217
26 3300054114 Ga0501084_0002547 Ga0501084_0002547_2654_3364 217
27 3300060353 Ga0501082_0002665 Ga0501082_0002665_11072_11782 217
28 3300061734 Ga0530510_0000265 Ga0530510_0000265_5880_6590 217
29 3300044684 Ga0466966_0078583 Ga0466966_0078583_492_1166 223
30 3300044706 Ga0466964_0152696 Ga0466964_0152696_158_832 223
31 3300028381 Ga0268264_10111669 Ga0268264_101116691 224
32 3300046530 Ga0495654_0199381 Ga0495654_0199381_41_739 226
33 3300048905 Ga0496102_0953712 Ga0496102_0953712_36_734 226
34 3300048928 Ga0496125_0000746 Ga0496125_0000746_4013_4849 226
35 3300048928 Ga0496125_0063469 Ga0496125_0063469_2228_2926 226
36 3300048929 Ga0496126_0081406 Ga0496126_0081406_1880_2716 226
37 3300050492 nmdc:mga0yw44_342932_c1 nmdc:mga0yw44_342932_c1_79_777 226
38 3300053142 Ga0500577_0000112 Ga0500577_0000112_10243_11073 226
39 3300048911 Ga0496108_0953687 Ga0496108_0953687_17_718 227
40 3300014497 Ga0182008_10024487 Ga0182008_100244873 228
41 3300025922 Ga0207646_10000768 Ga0207646_100007682 228
42 3300003203 JGI25406J46586_10042578 JGI25406J46586_100425782 229
43 3300005985 Ga0081539_10000521 Ga0081539_1000052183 229
44 3300006871 Ga0075434_100000363 Ga0075434_10000036325 229
45 3300006914 Ga0075436_100007036 Ga0075436_1000070366 229
46 3300006914 Ga0075436_100016942 Ga0075436_1000169423 229
47 3300007076 Ga0075435_100076854 Ga0075435_1000768543 229
48 3300025929 Ga0207664_10348184 Ga0207664_103481842 229
49 3300045976 Ga0466967_0067321 Ga0466967_0067321_835_1542 229
50 3300049568 Ga0501031_0020395 Ga0501031_0020395_201_911 229
51 3300050512 nmdc:mga0n895_88_c1 nmdc:mga0n895_88_c1_7290_7997 229
52 3300050513 nmdc:mga0rr50_1095_c1 nmdc:mga0rr50_1095_c1_1860_2567 229
53 3300050514 nmdc:mga08x19_6008_c1 nmdc:mga08x19_6008_c1_5314_6021 229
54 3300050514 nmdc:mga08x19_9363_c1 nmdc:mga08x19_9363_c1_2797_3504 229
55 3300005444 Ga0070694_100090864 Ga0070694_1000908642 231
56 3300009094 Ga0111539_10102299 Ga0111539_101022993 231
57 3300026088 Ga0207641_10140188 Ga0207641_101401883 232
58 3300003203 JGI25406J46586_10026289 JGI25406J46586_100262892 233
59 3300003215 JGI25153J46596_10030957 JGI25153J46596_100309572 233
60 3300005290 Ga0065712_10020245 Ga0065712_100202452 233
61 3300005328 Ga0070676_10032998 Ga0070676_100329983 233
62 3300005333 Ga0070677_10003287 Ga0070677_100032874 233
63 3300005335 Ga0070666_10223484 Ga0070666_102234842 233
64 3300005340 Ga0070689_100094480 Ga0070689_1000944802 233
65 3300005340 Ga0070689_100538487 Ga0070689_1005384871 233
66 3300005343 Ga0070687_100053371 Ga0070687_1000533713 233
67 3300005347 Ga0070668_100279062 Ga0070668_1002790622 233
68 3300005353 Ga0070669_100164167 Ga0070669_1001641672 233
69 3300005356 Ga0070674_100014977 Ga0070674_1000149772 233
70 3300005356 Ga0070674_100041235 Ga0070674_1000412354 233
71 3300005364 Ga0070673_100161257 Ga0070673_1001612572 233
72 3300005364 Ga0070673_100244428 Ga0070673_1002444283 233
73 3300005365 Ga0070688_100101076 Ga0070688_1001010762 233
74 3300005367 Ga0070667_100514769 Ga0070667_1005147692 233
75 3300005455 Ga0070663_100267956 Ga0070663_1002679561 233
76 3300005456 Ga0070678_100199541 Ga0070678_1001995412 233
77 3300005456 Ga0070678_100683425 Ga0070678_1006834251 233
78 3300005459 Ga0068867_100653557 Ga0068867_1006535572 233
79 3300005535 Ga0070684_100188397 Ga0070684_1001883972 233
80 3300005543 Ga0070672_100079685 Ga0070672_1000796852 233
81 3300005544 Ga0070686_100190787 Ga0070686_1001907871 233
82 3300005544 Ga0070686_100253007 Ga0070686_1002530072 233
83 3300005545 Ga0070695_100772166 Ga0070695_1007721661 233
84 3300005615 Ga0070702_100209476 Ga0070702_1002094762 233
85 3300005617 Ga0068859_100190269 Ga0068859_1001902692 233
86 3300005617 Ga0068859_100277028 Ga0068859_1002770282 233
87 3300005618 Ga0068864_100021742 Ga0068864_1000217422 233
88 3300005719 Ga0068861_100398947 Ga0068861_1003989472 233
89 3300005844 Ga0068862_100434352 Ga0068862_1004343521 233
90 3300005985 Ga0081539_10004549 Ga0081539_100045499 233
91 3300006175 Ga0070712_100038899 Ga0070712_1000388993 233
92 3300006195 Ga0075366_10000650 Ga0075366_1000065015 233
93 3300006237 Ga0097621_100567935 Ga0097621_1005679352 233
94 3300006353 Ga0075370_10088231 Ga0075370_100882312 233
95 3300006358 Ga0068871_100472239 Ga0068871_1004722391 233
96 3300006931 Ga0097620_100190271 Ga0097620_1001902712 233
97 3300006931 Ga0097620_100277044 Ga0097620_1002770442 233
98 3300009094 Ga0111539_10083147 Ga0111539_100831474 233
99 3300009098 Ga0105245_10151514 Ga0105245_101515143 233
100 3300009098 Ga0105245_10155209 Ga0105245_101552092 233
101 3300009101 Ga0105247_10014312 Ga0105247_100143122 233
102 3300009177 Ga0105248_10011801 Ga0105248_100118013 233
103 3300009551 Ga0105238_10026328 Ga0105238_100263282 233
104 3300009551 Ga0105238_10289240 Ga0105238_102892402 233
105 3300009553 Ga0105249_10395342 Ga0105249_103953421 233
106 3300011119 Ga0105246_10066329 Ga0105246_100663292 233
107 3300013297 Ga0157378_10788711 Ga0157378_107887112 233
108 3300013306 Ga0163162_10216848 Ga0163162_102168482 233
109 3300013306 Ga0163162_10321107 Ga0163162_103211072 233
110 3300013306 Ga0163162_10569518 Ga0163162_105695182 233
111 3300013308 Ga0157375_10161530 Ga0157375_101615302 233
112 3300014326 Ga0157380_10095023 Ga0157380_100950232 233
113 3300014968 Ga0157379_10059544 Ga0157379_100595442 233
114 3300014969 Ga0157376_10280182 Ga0157376_102801822 233
115 3300017792 Ga0163161_10534383 Ga0163161_105343831 233
116 3300017792 Ga0163161_10687579 Ga0163161_106875792 233
117 3300025297 Ga0209758_1000619 Ga0209758_100061933 233
118 3300025893 Ga0207682_10010002 Ga0207682_100100022 233
119 3300025900 Ga0207710_10057931 Ga0207710_100579312 233
120 3300025901 Ga0207688_10182993 Ga0207688_101829932 233
121 3300025905 Ga0207685_10042608 Ga0207685_100426082 233
122 3300025907 Ga0207645_10040403 Ga0207645_100404033 233
123 3300025915 Ga0207693_10026801 Ga0207693_100268016 233
124 3300025918 Ga0207662_10016112 Ga0207662_100161122 233
125 3300025928 Ga0207700_10134882 Ga0207700_101348822 233
126 3300025931 Ga0207644_10082133 Ga0207644_100821332 233
127 3300025933 Ga0207706_10320811 Ga0207706_103208111 233
128 3300025937 Ga0207669_10001662 Ga0207669_100016629 233
129 3300025937 Ga0207669_10296262 Ga0207669_102962622 233
130 3300025938 Ga0207704_10278345 Ga0207704_102783452 233
131 3300025940 Ga0207691_10134252 Ga0207691_101342522 233
132 3300025941 Ga0207711_10005945 Ga0207711_100059455 233
133 3300025960 Ga0207651_10036395 Ga0207651_100363952 233
134 3300026023 Ga0207677_10193982 Ga0207677_101939822 233
135 3300026075 Ga0207708_10118125 Ga0207708_101181252 233
136 3300026075 Ga0207708_10128647 Ga0207708_101286472 233
137 3300026088 Ga0207641_10321641 Ga0207641_103216412 233
138 3300026089 Ga0207648_10016092 Ga0207648_100160927 233
139 3300026116 Ga0207674_10206491 Ga0207674_102064912 233
140 3300026121 Ga0207683_10004502 Ga0207683_100045026 233
141 3300026121 Ga0207683_10030631 Ga0207683_100306313 233
142 3300028380 Ga0268265_10316310 Ga0268265_103163102 233
143 3300031240 Ga0265320_10043619 Ga0265320_100436192 233
144 3300031241 Ga0265325_10002323 Ga0265325_100023236 233
145 3300031344 Ga0265316_10589509 Ga0265316_105895091 233
146 3300034820 Ga0373959_0033626 Ga0373959_0033626_199_921 233
147 3300034957 Ga0373938_0019045 Ga0373938_0019045_115_837 233
148 3300035083 Ga0373926_0060506 Ga0373926_0060506_550_1272 233
149 3300035085 Ga0373929_0009753 Ga0373929_0009753_768_1502 233
150 3300035691 Ga0373931_0001411 Ga0373931_0001411_7810_8532 233
151 3300035691 Ga0373931_0002285 Ga0373931_0002285_7610_8332 233
152 3300035691 Ga0373931_0149132 Ga0373931_0149132_485_1213 233
153 3300035695 Ga0373927_0401404 Ga0373927_0401404_157_873 233
154 3300035725 Ga0373947_0093672 Ga0373947_0093672_227_943 233
155 3300037853 Ga0436364_0111693 Ga0436364_0111693_896_1615 233
156 3300039447 Ga0436361_0142688 Ga0436361_0142688_313_1032 233
157 3300039453 Ga0436362_0207965 Ga0436362_0207965_31_750 233
158 3300042156 Ga0439446_0096035 Ga0439446_0096035_18_872 233
159 3300046516 Ga0495628_0060724 Ga0495628_0060724_97_813 233
160 3300046539 Ga0495621_0016082 Ga0495621_0016082_909_1760 233
161 3300046615 Ga0495656_0221456 Ga0495656_0221456_32_883 233
162 3300046663 Ga0495635_0308216 Ga0495635_0308216_28_744 233
163 3300046681 Ga0495647_0216002 Ga0495647_0216002_82_798 233
164 3300048090 Ga0495615_0025462 Ga0495615_0025462_47_898 233
165 3300048903 Ga0496100_0005248 Ga0496100_0005248_1495_2217 233
166 3300048904 Ga0496101_0147280 Ga0496101_0147280_445_1167 233
167 3300048905 Ga0496102_0012654 Ga0496102_0012654_104_826 233
168 3300048907 Ga0496104_0033078 Ga0496104_0033078_3694_4416 233
169 3300048908 Ga0496105_0162314 Ga0496105_0162314_1004_1726 233
170 3300048909 Ga0496106_0043361 Ga0496106_0043361_297_1019 233
171 3300048910 Ga0496107_0084564 Ga0496107_0084564_942_1661 233
172 3300048910 Ga0496107_0095141 Ga0496107_0095141_1022_1744 233
173 3300048911 Ga0496108_0089267 Ga0496108_0089267_1365_2087 233
174 3300048911 Ga0496108_0144705 Ga0496108_0144705_876_1595 233
175 3300048912 Ga0496109_0053775 Ga0496109_0053775_1688_2410 233
176 3300048912 Ga0496109_0623829 Ga0496109_0623829_152_871 233
177 3300048913 Ga0496110_0241450 Ga0496110_0241450_28_747 233
178 3300048914 Ga0496111_0135865 Ga0496111_0135865_244_966 233
179 3300048915 Ga0496112_0022376 Ga0496112_0022376_2769_3488 233
180 3300048915 Ga0496112_0193404 Ga0496112_0193404_939_1661 233
181 3300048915 Ga0496112_0621433 Ga0496112_0621433_183_908 233
182 3300048916 Ga0496113_0271241 Ga0496113_0271241_337_1062 233
183 3300048917 Ga0496114_0006660 Ga0496114_0006660_4257_4979 233
184 3300048917 Ga0496114_0444123 Ga0496114_0444123_232_948 233
185 3300048918 Ga0496115_0030545 Ga0496115_0030545_1759_2481 233
186 3300049568 Ga0501031_0090383 Ga0501031_0090383_22_744 233
187 3300049569 Ga0501032_0105886 Ga0501032_0105886_119_841 233
188 3300049571 Ga0501034_0100267 Ga0501034_0100267_1082_1804 233
189 3300049573 Ga0501037_0068025 Ga0501037_0068025_787_1509 233
190 3300049581 Ga0501047_0163323 Ga0501047_0163323_329_1051 233
191 3300049589 Ga0501073_0062155 Ga0501073_0062155_1748_2470 233
192 3300049741 Ga0501079_0513141 Ga0501079_0513141_108_830 233
193 3300049744 Ga0501083_0117483 Ga0501083_0117483_709_1431 233
194 3300049822 Ga0501035_0086456 Ga0501035_0086456_694_1416 233
195 3300049823 Ga0501044_0455473 Ga0501044_0455473_427_1149 233
196 3300050493 nmdc:mga0k408_2337_c1 nmdc:mga0k408_2337_c1_2000_2722 233
197 3300053077 Ga0495601_0282327 Ga0495601_0282327_248_964 233
198 3300053084 Ga0495595_0025406 Ga0495595_0025406_121_840 233
199 3300053084 Ga0495595_0047427 Ga0495595_0047427_626_1342 233
200 3300053085 Ga0495619_0013433 Ga0495619_0013433_625_1344 233
201 3300053085 Ga0495619_0054446 Ga0495619_0054446_1235_1951 233
202 3300053119 Ga0500595_059155 Ga0500595_059155_295_1014 233
203 3300053130 Ga0500642_0161089 Ga0500642_0161089_102_821 233
204 3300053145 Ga0500586_000358 Ga0500586_000358_2195_3004 233
205 3300060353 Ga0501082_0012892 Ga0501082_0012892_2010_2732 233
206 3300060353 Ga0501082_0427546 Ga0501082_0427546_409_1137 233
207 3300061719 Ga0466962_0215738 Ga0466962_0215738_36_818 233
208 3300005436 Ga0070713_100451442 Ga0070713_1004514421 234
209 3300005445 Ga0070708_100130254 Ga0070708_1001302542 234
210 3300005614 Ga0068856_100086874 Ga0068856_1000868742 234
211 3300006028 Ga0070717_10104503 Ga0070717_101045031 234
212 3300006173 Ga0070716_100274666 Ga0070716_1002746662 234
213 3300006175 Ga0070712_100114304 Ga0070712_1001143043 234
214 3300006914 Ga0075436_100069776 Ga0075436_1000697763 234
215 3300007076 Ga0075435_100116762 Ga0075435_1001167622 234
216 3300007788 Ga0099795_10005538 Ga0099795_100055383 234
217 3300010159 Ga0099796_10051364 Ga0099796_100513641 234
218 3300010159 Ga0099796_10086041 Ga0099796_100860412 234
219 3300014497 Ga0182008_10058552 Ga0182008_100585522 234
220 3300025906 Ga0207699_10067683 Ga0207699_100676833 234
221 3300025915 Ga0207693_10066875 Ga0207693_100668753 234
222 3300025916 Ga0207663_10043773 Ga0207663_100437733 234
223 3300025928 Ga0207700_10041920 Ga0207700_100419202 234
224 3300026078 Ga0207702_10178580 Ga0207702_101785801 234
225 3300028800 Ga0265338_10151317 Ga0265338_101513172 234
226 3300031235 Ga0265330_10047648 Ga0265330_100476482 234
227 3300031241 Ga0265325_10041078 Ga0265325_100410783 234
228 3300035170 Ga0373943_0256822 Ga0373943_0256822_123_845 234
229 3300035691 Ga0373931_0141716 Ga0373931_0141716_610_1332 234
230 3300048915 Ga0496112_0033872 Ga0496112_0033872_598_1320 234
231 3300049570 Ga0501033_0055927 Ga0501033_0055927_204_923 234
232 3300049574 Ga0501038_0097768 Ga0501038_0097768_137_856 234
233 3300049578 Ga0501042_0067526 Ga0501042_0067526_499_1218 234
234 3300049580 Ga0501046_0356913 Ga0501046_0356913_206_925 234
235 3300049582 Ga0501048_0348961 Ga0501048_0348961_39_758 234
236 3300049584 Ga0501068_0426959 Ga0501068_0426959_68_787 234
237 3300049587 Ga0501071_0321845 Ga0501071_0321845_436_1155 234
238 3300049588 Ga0501072_0027339 Ga0501072_0027339_44_763 234
239 3300049590 Ga0501074_0077877 Ga0501074_0077877_1639_2364 234
240 3300049592 Ga0501076_0107479 Ga0501076_0107479_1411_2130 234
241 3300049742 Ga0501080_0177082 Ga0501080_0177082_182_901 234
242 3300049744 Ga0501083_0230145 Ga0501083_0230145_439_1164 234
243 3300049823 Ga0501044_0007444 Ga0501044_0007444_4600_5319 234
244 3300050514 nmdc:mga08x19_178536_c1 nmdc:mga08x19_178536_c1_178_900 234
245 3300050514 nmdc:mga08x19_61367_c1 nmdc:mga08x19_61367_c1_1626_2348 234
246 3300053723 Ga0500567_100231 Ga0500567_100231_94_903 234
247 3300054114 Ga0501084_0131778 Ga0501084_0131778_19_738 234
248 3300060353 Ga0501082_0189239 Ga0501082_0189239_158_883 234
249 3300061734 Ga0530510_0322359 Ga0530510_0322359_82_801 234
250 3300005341 Ga0070691_10013259 Ga0070691_100132595 236
251 3300005444 Ga0070694_100000760 Ga0070694_10000076010 236
252 3300005536 Ga0070697_100043813 Ga0070697_1000438132 236
253 3300005545 Ga0070695_100000594 Ga0070695_10000059422 236
254 3300034817 Ga0373948_0002422 Ga0373948_0002422_1128_1943 236
255 3300046501 Ga0495607_0178267 Ga0495607_0178267_254_1057 236
256 3300046507 Ga0495606_0039213 Ga0495606_0039213_668_1471 236
257 3300046512 Ga0495610_0013419 Ga0495610_0013419_333_1136 236
258 3300046513 Ga0495616_0012679 Ga0495616_0012679_3532_4335 236
259 3300046515 Ga0495620_0148545 Ga0495620_0148545_19_822 236
260 3300046522 Ga0495643_0027812 Ga0495643_0027812_2183_2986 236
261 3300046660 Ga0495625_0121774 Ga0495625_0121774_189_992 236
262 3300047472 Ga0495686_0023349 Ga0495686_0023349_577_1380 236
263 3300049744 Ga0501083_0094817 Ga0501083_0094817_756_1670 236
264 3300053093 Ga0500651_0112596 Ga0500651_0112596_742_1545 236
265 3300053108 Ga0500562_036676 Ga0500562_036676_320_1123 236
266 3300053116 Ga0500592_002032 Ga0500592_002032_40_843 236
267 3300053117 Ga0500593_068204 Ga0500593_068204_158_961 236
268 3300053131 Ga0500652_000290 Ga0500652_000290_546_1349 236
269 3300053160 Ga0500633_0017698 Ga0500633_0017698_492_1295 236
270 3300035120 Ga0373957_0066036 Ga0373957_0066036_63_794 237
271 3300037068 Ga0373925_0405669 Ga0373925_0405669_77_808 237
272 3300046475 Ga0495639_0134132 Ga0495639_0134132_328_1059 237
273 3300046499 Ga0495594_0207487 Ga0495594_0207487_216_947 237
274 3300046526 Ga0495666_0123644 Ga0495666_0123644_248_979 237
275 3300046533 Ga0495640_0318609 Ga0495640_0318609_158_889 237
276 3300046535 Ga0495586_0047157 Ga0495586_0047157_281_1012 237
277 3300046535 Ga0495586_0222269 Ga0495586_0222269_118_849 237
278 3300046642 Ga0495634_0138880 Ga0495634_0138880_773_1504 237
279 3300046663 Ga0495635_0113041 Ga0495635_0113041_237_968 237
280 3300046678 Ga0495599_0072692 Ga0495599_0072692_265_996 237
281 3300046809 Ga0495600_0042526 Ga0495600_0042526_103_834 237
282 3300047322 Ga0495680_0504817 Ga0495680_0504817_60_791 237
283 3300053077 Ga0495601_0172813 Ga0495601_0172813_589_1320 237
284 3300053085 Ga0495619_0058132 Ga0495619_0058132_1037_1768 237
285 3300048905 Ga0496102_0224637 Ga0496102_0224637_934_1677 238
286 3300048907 Ga0496104_0000354 Ga0496104_0000354_28266_29012 238
287 3300048907 Ga0496104_0000651 Ga0496104_0000651_23326_24069 238
288 3300048908 Ga0496105_0005041 Ga0496105_0005041_8354_9097 238
289 3300048908 Ga0496105_0007413 Ga0496105_0007413_5978_6724 238
290 3300048909 Ga0496106_0109031 Ga0496106_0109031_1349_2092 238
291 3300048909 Ga0496106_0119494 Ga0496106_0119494_964_1710 238
292 3300048910 Ga0496107_0165760 Ga0496107_0165760_525_1271 238
293 3300048911 Ga0496108_0082924 Ga0496108_0082924_860_1603 238
294 3300048912 Ga0496109_0023036 Ga0496109_0023036_3882_4625 238
295 3300048912 Ga0496109_0146150 Ga0496109_0146150_805_1551 238
296 3300048913 Ga0496110_0225685 Ga0496110_0225685_681_1427 238
297 3300048918 Ga0496115_0061824 Ga0496115_0061824_745_1491 238
298 3300048918 Ga0496115_0195883 Ga0496115_0195883_20_763 238
299 3300005467 Ga0070706_100358733 Ga0070706_1003587332 239
300 3300005471 Ga0070698_100002697 Ga0070698_10000269723 239
301 3300005518 Ga0070699_100031234 Ga0070699_1000312341 239
302 3300005536 Ga0070697_100000998 Ga0070697_10000099814 239
303 3300005545 Ga0070695_100033528 Ga0070695_1000335282 239
304 3300025910 Ga0207684_10000819 Ga0207684_100008192 239
305 3300027526 Ga0209968_1001100 Ga0209968_10011005 239
306 3300027665 Ga0209983_1003656 Ga0209983_10036565 239
307 3300027682 Ga0209971_1000041 Ga0209971_100004124 239
308 3300027695 Ga0209966_1000590 Ga0209966_10005906 239
309 3300027717 Ga0209998_10000028 Ga0209998_1000002844 239
310 3300042461 Ga0439460_0039043 Ga0439460_0039043_28_843 239
311 3300044673 Ga0453683_0054334 Ga0453683_0054334_436_1251 239
312 3300006051 Ga0075364_10097402 Ga0075364_100974022 240
313 3300005440 Ga0070705_100117082 Ga0070705_1001170822 243
314 3300005518 Ga0070699_100003763 Ga0070699_10000376311 243
315 3300005843 Ga0068860_100058720 Ga0068860_1000587204 243
316 3300005983 Ga0081540_1050365 Ga0081540_10503652 243
317 3300006852 Ga0075433_10245540 Ga0075433_102455402 243
318 3300006871 Ga0075434_100406925 Ga0075434_1004069252 243
319 3300006914 Ga0075436_100133981 Ga0075436_1001339812 243
320 3300009177 Ga0105248_10411104 Ga0105248_104111041 243
321 3300028380 Ga0268265_10219766 Ga0268265_102197661 243
322 3300044735 Ga0466968_0086310 Ga0466968_0086310_80_850 243
323 3300045051 Ga0451576_0476624 Ga0451576_0476624_236_1051 243
324 3300050512 nmdc:mga0n895_256973_c1 nmdc:mga0n895_256973_c1_480_1295 243
325 3300050513 nmdc:mga0rr50_5403_c1 nmdc:mga0rr50_5403_c1_2213_3028 243
326 3300050514 nmdc:mga08x19_108775_c1 nmdc:mga08x19_108775_c1_238_1053 243
327 3300003771 Ga0055526_1042924 Ga0055526_10429242 244
328 3300006186 Ga0075369_10053004 Ga0075369_100530042 244
329 3300006871 Ga0075434_100072872 Ga0075434_1000728722 244
330 3300025295 Ga0209564_1001755 Ga0209564_100175513 244
331 3300025295 Ga0209564_1004388 Ga0209564_100438810 244
332 3300025933 Ga0207706_10016088 Ga0207706_100160882 244
333 3300027907 Ga0207428_10000367 Ga0207428_1000036720 244
334 3300028380 Ga0268265_10655710 Ga0268265_106557102 244
335 3300046460 Ga0495638_0066388 Ga0495638_0066388_614_1417 244
336 3300046501 Ga0495607_0016522 Ga0495607_0016522_3871_4674 244
337 3300046524 Ga0495648_0002269 Ga0495648_0002269_2788_3612 244
338 3300046530 Ga0495654_0010260 Ga0495654_0010260_1719_2522 244
339 3300046665 Ga0495661_0256545 Ga0495661_0256545_37_840 244
340 3300046691 Ga0495670_0018941 Ga0495670_0018941_1029_1832 244
341 3300048909 Ga0496106_0419484 Ga0496106_0419484_39_842 244
342 3300048919 Ga0496116_0003138 Ga0496116_0003138_4987_5790 244
343 3300048920 Ga0496117_0105199 Ga0496117_0105199_814_1617 244
344 3300048921 Ga0496118_0061267 Ga0496118_0061267_1830_2633 244
345 3300048923 Ga0496120_0156917 Ga0496120_0156917_311_1114 244
346 3300048924 Ga0496121_0032870 Ga0496121_0032870_1375_2178 244
347 3300048925 Ga0496122_0065395 Ga0496122_0065395_938_1753 244
348 3300048926 Ga0496123_0040398 Ga0496123_0040398_542_1357 244
349 3300048926 Ga0496123_0089292 Ga0496123_0089292_457_1260 244
350 3300048927 Ga0496124_0138697 Ga0496124_0138697_469_1284 244
351 3300048928 Ga0496125_0007153 Ga0496125_0007153_4650_5453 244
352 3300050512 nmdc:mga0n895_34555_c1 nmdc:mga0n895_34555_c1_2216_3025 244
353 3300050515 nmdc:mga0a205_10939_c1 nmdc:mga0a205_10939_c1_6758_7567 244
354 3300053088 Ga0500644_0017903 Ga0500644_0017903_146_949 244
355 3300053088 Ga0500644_0074140 Ga0500644_0074140_189_992 244
356 3300053094 Ga0500566_0003637 Ga0500566_0003637_1754_2557 244
357 3300053098 Ga0500650_0014728 Ga0500650_0014728_87_890 244
358 3300053104 Ga0500556_0000012 Ga0500556_0000012_219550_220353 244
359 3300053122 Ga0500608_020441 Ga0500608_020441_271_1074 244
360 3300053130 Ga0500642_0000055 Ga0500642_0000055_66078_66881 244
361 3300053136 Ga0500559_0002046 Ga0500559_0002046_6587_7390 244
362 3300053139 Ga0500568_0008164 Ga0500568_0008164_359_1162 244
363 3300053151 Ga0500604_0020497 Ga0500604_0020497_430_1233 244
364 3300053153 Ga0500616_0000035 Ga0500616_0000035_163354_164157 244
365 3300053177 Ga0500636_0011861 Ga0500636_0011861_1503_2306 244
366 iso_pu_bacteria 2602042107 2603857877 244
367 iso_pu_bacteria 2857524615 2857527250 244
368 iso_pu_bacteria 2919073203 2919078367 244
369 2162886012 MBSR1b_contig_6145835 MBSR1b_0395.00002620 245
370 3300005471 Ga0070698_100045138 Ga0070698_1000451385 245
371 3300005518 Ga0070699_100402173 Ga0070699_1004021732 245
372 3300032005 Ga0307411_10173683 Ga0307411_101736831 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

44

234

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.951 17 244
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.9082 17 244
4c25-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase 0.8851 15 225
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.8667 17 225
1e48-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant e73q/y113f/y209f 0.8511 17 225
ID Description Score Start End Superfamily
2z7bA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9424 17 244 3.40.225.10
2z7bA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9033 17 244 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8894 19 211 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8754 19 211 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8714 19 227 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A537D8V4-F1-model_v4 Class II aldolase/adducin family protein 0.9855 13 218 GO:0005829
GO:0016832
GO:0019323
AF-A0A382W328-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9834 17 223 GO:0005829
GO:0016832
GO:0019323
AF-A0A0R2TN52-F1-model_v4 Aldolase 0.9778 15 177 GO:0005829
GO:0016832
GO:0019323
AF-A0A2V6T257-F1-model_v4 Aldolase 0.9766 18 245 GO:0005829
GO:0016832
GO:0019323
AF-V8QNL7-F1-model_v4 Aldolase 0.9753 29 244 GO:0005856
GO:0051015

Feature Viewer

pLDDT pTM Quality
92.71 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map