F426070

General Info

Members Datasets Scaffolds Average Seq Length
372 279 312 406

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10058972|Ga0207687_100589722
Length 453
Sequence MAIQTNAYPEGTSTKSEMICFTFATLKNILMNPEVVKPADETSGHLKDLIYAFEHKRPEIVFEWKDTETEAEGWVVINSLRGGSAGGGTRMRKGLDKHEVESLAKTMEIKFSVSGPPIGGAKSGINFDPFDPRKKGVLERWFKAVIPLLRNYYGTGGDLNVDEIHEVIPITEKLGLHHPQQGTAKGHFKASEEKTGEIIGRLRLGVKKVLEDPAFSPDITRKITVADMITGYGVAKSVEHYYKLYSGNIQGKRAVIQGWGNVGAAAGFYLAKMGVKITGIIDKKVGLINKEGYSFEEVRQLYLDRSGNQLSAPGLIPFDSIKQNIWKTDAEIFIPAASSRLIDQEHLDQLLHHGLEVIACGANVPFADREIFFGPISEFADQNVSVIPDFISNCGMARVFAFLMSDEAVISDHAIFDDVSDCIERAMIEVKNRNPKKIHLAETAMEIALEKLI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2643221546 Microbacterium sp. Root53 Isolate Unclassified
6 2643221576 Nocardioides sp. Root614 Isolate Unclassified
7 2643221590 Nocardioides sp. Root682 Isolate Unclassified
8 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
9 2643221604 Nocardioides sp. Root190 Isolate Unclassified
10 2643221617 Nocardioides sp. Root79 Isolate Unclassified
11 2643221620 Nocardioides sp. Root240 Isolate Unclassified
12 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
13 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
14 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
15 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
16 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
17 2738541284 Pedobacter sp. YR016 Isolate Unclassified
18 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
19 2738541305 Nocardioides sp. CF167 Isolate Unclassified
20 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
21 2738543023 Pedobacter sp. OK628 Isolate Unclassified
22 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
23 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
24 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
25 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
26 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
27 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
28 2818991436 Collimonas arenae 515 Isolate Unclassified
29 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
30 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
31 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
32 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
33 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
34 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
35 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
36 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
37 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
38 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
39 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
40 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
41 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
42 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
43 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
44 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
45 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
46 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
47 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
48 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
49 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
50 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
51 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
52 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
53 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
54 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
55 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
56 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
57 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
58 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
64 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
65 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
66 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
67 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
68 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
72 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
74 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
145 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
146 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
147 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
148 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
176 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
177 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
178 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
186 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
187 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
247 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
250 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
251 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
252 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
253 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
266 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
270 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
275 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
276 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
277 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
278 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
279 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.6
Metatranscriptomes 0.27
Isolates 16.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.48
Nodule 1.61
Rhizoplane 1.08
Rhizosphere 69.62
Stem 0
Stem Tuber 0
Unclassified 17.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2869200 2162886007 Bacteria 6635
2 SwRhRL2b_contig_3344168 2162886007 Bacteria 4566
3 JGI25162J39368_1000001 3300002737 Bacteria 740113
4 JGI25163J39215_1002443 3300002771 Bacteria 1907
5 JGI25165J46597_1000001 3300003214 Bacteria 1111887
6 rootH1_10000402 3300003316 Bacteria 20321
7 rootH1_10050900 3300003316 Bacteria 2691
8 rootH2_10011821 3300003320 Bacteria 27973
9 rootH2_10201577 3300003320 Bacteria 4324
10 rootL2_10012574 3300003322 Bacteria 17437
11 rootL2_10025775 3300003322 Bacteria 2849
12 rootL2_10203464 3300003322 Bacteria 2693
13 rootH1_10010049 3300003323 Bacteria 56441
14 rootH1_10034877 3300003323 Bacteria 15502
15 Ga0006562J51391_1005705 3300003578 Bacteria 2001
16 Ga0055538_1000001 3300003751 Bacteria 1111887
17 Ga0055539_1000001 3300003752 Bacteria 1111887
18 Ga0055533_1000003 3300003756 Bacteria 1111887
19 Ga0055525_1000003 3300003759 Bacteria 962094
20 Ga0055541_1000001 3300003841 Bacteria 1111887
21 Ga0065165_1000797 3300005262 Bacteria 42099
22 Ga0065714_10002724 3300005288 Bacteria 22352
23 Ga0065714_10004448 3300005288 Bacteria 7553
24 Ga0065714_10065718 3300005288 Bacteria 8740
25 Ga0065714_10071893 3300005288 Bacteria 3473
26 Ga0065714_10074257 3300005288 Bacteria 3062
27 Ga0065714_10085820 3300005288 Bacteria 2130
28 Ga0065704_10001588 3300005289 Bacteria 7192
29 Ga0065704_10070311 3300005289 Bacteria 34868
30 Ga0065704_10076563 3300005289 Bacteria 5077
31 Ga0065704_10089198 3300005289 Bacteria 2878
32 Ga0065715_10109731 3300005293 Bacteria 2655
33 Ga0070670_100041194 3300005331 Bacteria 3970
34 Ga0070670_100085330 3300005331 Bacteria 2713
35 Ga0068869_100137244 3300005334 Bacteria 1885
36 Ga0068868_100029118 3300005338 Bacteria 4228
37 Ga0070687_100003390 3300005343 Bacteria 6186
38 Ga0070669_100026460 3300005353 Bacteria 4173
39 Ga0070674_100099621 3300005356 Bacteria 2114
40 Ga0070678_100030100 3300005456 Bacteria 3727
41 Ga0068867_100034314 3300005459 Bacteria 3677
42 Ga0070672_100082325 3300005543 Bacteria 2582
43 Ga0070686_100146269 3300005544 Bacteria 1650
44 Ga0068855_100333311 3300005563 Bacteria 1675
45 Ga0068852_100107012 3300005616 Bacteria 2536
46 Ga0068870_10041594 3300005840 Bacteria 2389
47 Ga0068863_100132983 3300005841 Bacteria 2375
48 Ga0068862_100000646 3300005844 Bacteria 36013
49 Ga0075366_10033459 3300006195 Bacteria 3028
50 Ga0075370_10047477 3300006353 Bacteria 2431
51 Ga0099824_1003063 3300006942 Bacteria 24437
52 Ga0079104_1000421 3300006946 Bacteria 48367
53 Ga0099826_10000257 3300006948 Bacteria 23529
54 Ga0105244_10000057 3300009036 Bacteria 129775
55 Ga0105244_10072970 3300009036 Bacteria 1709
56 Ga0111539_10236421 3300009094 Bacteria 2127
57 Ga0105243_10000004 3300009148 Bacteria 601266
58 Ga0105237_10001800 3300009545 Bacteria 27691
59 Ga0105238_10029975 3300009551 Bacteria 5537
60 Ga0105239_10000798 3300010375 Bacteria 44685
61 Ga0157373_10000111 3300013100 Bacteria 64336
62 Ga0157373_10002248 3300013100 Bacteria 14628
63 Ga0157371_10008229 3300013102 Bacteria 8334
64 Ga0157371_10047539 3300013102 Bacteria 3051
65 Ga0157371_10052337 3300013102 Bacteria 2900
66 Ga0157371_10072353 3300013102 Bacteria 2441
67 Ga0157370_10000257 3300013104 Bacteria 67219
68 Ga0157370_10000395 3300013104 Bacteria 54849
69 Ga0157370_10002728 3300013104 Bacteria 21128
70 Ga0157370_10011859 3300013104 Bacteria 9092
71 Ga0157370_10021353 3300013104 Bacteria 6451
72 Ga0157370_10022209 3300013104 Bacteria 6314
73 Ga0157370_10027462 3300013104 Bacteria 5612
74 Ga0157370_10083949 3300013104 Bacteria 2994
75 Ga0157370_10121207 3300013104 Bacteria 2441
76 Ga0157370_10283841 3300013104 Bacteria 1529
77 Ga0157369_10004901 3300013105 Bacteria 15696
78 Ga0163162_10018023 3300013306 Bacteria 6909
79 Ga0157380_10002630 3300014326 Bacteria 12157
80 Ga0157380_10002748 3300014326 Bacteria 11943
81 Ga0157380_10403864 3300014326 Bacteria 1297
82 Ga0182008_10000047 3300014497 Bacteria 108181
83 Ga0182008_10045914 3300014497 Bacteria 2172
84 Ga0182008_10062871 3300014497 Bacteria 1829
85 Ga0182008_10072713 3300014497 Bacteria 1692
86 Ga0182006_1002172 3300015261 Bacteria 10877
87 Ga0182006_1003730 3300015261 Bacteria 7700
88 Ga0182006_1006682 3300015261 Bacteria 5335
89 Ga0182006_1010138 3300015261 Bacteria 4199
90 Ga0182005_1000654 3300015265 Bacteria 16506
91 Ga0183362_10001 3300015683 Bacteria 2046624
92 Ga0163161_10000075 3300017792 Bacteria 101567
93 Ga0163161_10024072 3300017792 Bacteria 4299
94 Ga0163161_10188576 3300017792 Bacteria 1584
95 Ga0209784_100004 3300025224 Bacteria 1378156
96 Ga0209566_100004 3300025225 Bacteria 1531866
97 Ga0209674_100006 3300025226 Bacteria 1531866
98 Ga0209563_100009 3300025230 Bacteria 1378156
99 Ga0207427_100467 3300025231 Bacteria 22139
100 Ga0209437_100004 3300025233 Bacteria 1378156
101 Ga0209677_100005 3300025253 Bacteria 1378156
102 Ga0209233_1000005 3300025261 Bacteria 1531866
103 Ga0207655_1000038 3300025728 Bacteria 348340
104 Ga0207645_10001260 3300025907 Bacteria 20835
105 Ga0207643_10036044 3300025908 Bacteria 2774
106 Ga0207695_10015196 3300025913 Bacteria 9078
107 Ga0207671_10001730 3300025914 Bacteria 24566
108 Ga0207662_10007128 3300025918 Bacteria 6077
109 Ga0207681_10023994 3300025923 Bacteria 3908
110 Ga0207687_10058972 3300025927 Bacteria 2702
111 Ga0207709_10000010 3300025935 Bacteria 601305
112 Ga0207665_10025596 3300025939 Bacteria 3894
113 Ga0207691_10077858 3300025940 Bacteria 2986
114 Ga0207689_10022102 3300025942 Bacteria 5349
115 Ga0207651_10215793 3300025960 Bacteria 1548
116 Ga0207668_10041921 3300025972 Bacteria 3097
117 Ga0207677_10053310 3300026023 Bacteria 2752
118 Ga0207641_10159257 3300026088 Bacteria 2051
119 Ga0207648_10003223 3300026089 Bacteria 17181
120 Ga0207683_10164648 3300026121 Bacteria 2006
121 Ga0207683_10186447 3300026121 Bacteria 1882
122 Ga0207683_10251509 3300026121 Bacteria 1613
123 Ga0209281_1000570 3300027111 Bacteria 44049
124 Ga0209489_109469 3300027361 Bacteria 12060
125 Ga0209282_1010717 3300027666 Bacteria 5805
126 Ga0268266_10096654 3300028379 Bacteria 2597
127 Ga0268265_10000223 3300028380 Bacteria 65865
128 Ga0265334_10045118 3300028573 Bacteria 1708
129 Ga0265318_10005341 3300028577 Bacteria 6039
130 Ga0307515_10000009 3300028794 Bacteria 653206
131 Ga0307515_10002965 3300028794 Bacteria 35996
132 Ga0307515_10067220 3300028794 Bacteria 4948
133 Ga0307515_10173429 3300028794 Bacteria 2138
134 Ga0316177_1032754 3300030731 Bacteria 20502
135 Ga0316176_1030119 3300030732 Bacteria 23258
136 Ga0316179_1059023 3300030734 Bacteria 3346
137 Ga0316183_1088093 3300030742 Bacteria 36462
138 Ga0316181_1054969 3300030744 Bacteria 17544
139 Ga0265327_10015491 3300031251 Unclassified 4913
140 Ga0307509_10048415 3300031507 Bacteria 4565
141 Ga0307408_100000055 3300031548 Bacteria 140772
142 Ga0307408_100002005 3300031548 Bacteria 14705
143 Ga0316579_10018038 3300031691 Bacteria 3102
144 Ga0316576_10000473 3300031727 Bacteria 18863
145 Ga0316576_10140586 3300031727 Bacteria 1817
146 Ga0316578_10000277 3300031728 Bacteria 15506
147 Ga0316578_10034425 3300031728 Bacteria 2908
148 Ga0307516_10007575 3300031730 Bacteria 12447
149 Ga0307405_10000005 3300031731 Bacteria 376536
150 Ga0307405_10012938 3300031731 Bacteria 4437
151 Ga0316577_10014562 3300031733 Bacteria 4318
152 Ga0316577_10068801 3300031733 Bacteria 1978
153 Ga0307413_10000274 3300031824 Bacteria 15735
154 Ga0307410_10000048 3300031852 Bacteria 42322
155 Ga0307406_10000004 3300031901 Bacteria 179772
156 Ga0307412_10000001 3300031911 Bacteria 822691
157 Ga0307412_10005875 3300031911 Bacteria 6913
158 Ga0307412_10024383 3300031911 Bacteria 3733
159 Ga0307412_10097476 3300031911 Bacteria 2072
160 Ga0307416_100003753 3300032002 Bacteria 9013
161 Ga0307416_100032271 3300032002 Bacteria 3954
162 Ga0307416_100149964 3300032002 Bacteria 2137
163 Ga0307414_10000040 3300032004 Bacteria 148876
164 Ga0307414_10000051 3300032004 Bacteria 127567
165 Ga0307414_10001420 3300032004 Bacteria 12435
166 Ga0307414_10003823 3300032004 Bacteria 8095
167 Ga0307414_10007659 3300032004 Bacteria 6079
168 Ga0307414_10028387 3300032004 Bacteria 3630
169 Ga0307414_10043062 3300032004 Bacteria 3072
170 Ga0307414_10129769 3300032004 Bacteria 1954
171 Ga0307411_10000020 3300032005 Bacteria 75190
172 Ga0307411_10013982 3300032005 Bacteria 4452
173 Ga0307415_100054906 3300032126 Bacteria 2722
174 Ga0316580_10012157 3300032139 Bacteria 2620
175 Ga0316580_10015029 3300032139 Bacteria 2366
176 Ga0307510_10032579 3300033180 Bacteria 5869
177 Ga0373935_0044282 3300035692 Bacteria 2804
178 Ga0373927_0041260 3300035695 Bacteria 2993
179 Ga0316582_0054378 3300036647 Unclassified 2548
180 Ga0316582_0104922 3300036647 Bacteria 1876
181 Ga0316582_0216078 3300036647 Bacteria 1310
182 Ga0316584_0001351 3300036712 Bacteria 14560
183 Ga0395899_0099855 3300037312 Bacteria 2096
184 Ga0395905_0073796 3300037471 Bacteria 3198
185 Ga0395901_0362502 3300038443 Unclassified 1494
186 Ga0400484_36963 3300038725 Bacteria 6916
187 Ga0400483_000149 3300039062 Bacteria 6725
188 Ga0400489_38471 3300039093 Bacteria 13767
189 Ga0439447_015848 3300041407 Bacteria 2082
190 Ga0439447_023752 3300041407 Bacteria 1594
191 Ga0439466_0001833 3300041411 Bacteria 8335
192 Ga0439466_0024408 3300041411 Bacteria 2119
193 Ga0439442_011445 3300042002 Bacteria 1807
194 Ga0439432_020212 3300042006 Bacteria 2215
195 Ga0439449_0001081 3300042007 Bacteria 10720
196 Ga0439457_005386 3300042014 Bacteria 3228
197 Ga0439462_0001016 3300042015 Bacteria 6015
198 Ga0450923_003205 3300042125 Bacteria 2443
199 Ga0450923_014403 3300042125 Bacteria 1467
200 Ga0450898_006210 3300042134 Bacteria 1828
201 Ga0450906_005052 3300042145 Bacteria 2736
202 Ga0439446_0014301 3300042156 Bacteria 2189
203 Ga0439458_0032236 3300042157 Bacteria 1252
204 Ga0450918_010362 3300042531 Bacteria 1629
205 Ga0451577_0001625 3300042876 Bacteria 29150
206 Ga0451577_0018506 3300042876 Bacteria 6417
207 Ga0451577_0054544 3300042876 Bacteria 3568
208 Ga0453683_0017821 3300044673 Bacteria 4566
209 Ga0466965_0009936 3300044683 Bacteria 4428
210 Ga0453684_0003071 3300044712 Bacteria 38643
211 Ga0453684_0004162 3300044712 Bacteria 31248
212 Ga0453684_0017017 3300044712 Bacteria 11295
213 Ga0453684_0071409 3300044712 Bacteria 4389
214 Ga0451576_0000003 3300045051 Bacteria 1550573
215 Ga0451576_0004809 3300045051 Bacteria 17300
216 Ga0451576_0072626 3300045051 Bacteria 3581
217 Ga0451576_0102301 3300045051 Bacteria 2980
218 Ga0495627_003411 3300046453 Bacteria 7033
219 Ga0495592_0024433 3300046454 Bacteria 4594
220 Ga0495651_0004683 3300046462 Bacteria 10468
221 Ga0495653_0008643 3300046463 Bacteria 8349
222 Ga0495639_0009427 3300046475 Bacteria 4187
223 Ga0495607_0002790 3300046501 Bacteria 13908
224 Ga0495606_0023905 3300046507 Bacteria 4416
225 Ga0495608_0029070 3300046511 Bacteria 3752
226 Ga0495610_0094524 3300046512 Bacteria 1349
227 Ga0495616_0018469 3300046513 Bacteria 3827
228 Ga0495628_0002428 3300046516 Bacteria 16802
229 Ga0495628_0011951 3300046516 Bacteria 7323
230 Ga0495632_0029547 3300046519 Bacteria 2853
231 Ga0495643_0000985 3300046522 Bacteria 29208
232 Ga0495652_0020068 3300046529 Bacteria 5944
233 Ga0495652_0048574 3300046529 Bacteria 3635
234 Ga0495652_0112777 3300046529 Bacteria 2183
235 Ga0495621_0026655 3300046539 Bacteria 1952
236 Ga0495656_0051237 3300046615 Bacteria 1766
237 Ga0495625_0002098 3300046660 Bacteria 22270
238 Ga0495625_0007540 3300046660 Bacteria 9452
239 Ga0495588_0034776 3300046674 Bacteria 2550
240 Ga0495599_0000582 3300046678 Bacteria 20814
241 Ga0495599_0057932 3300046678 Bacteria 2424
242 Ga0495623_0023644 3300046679 Bacteria 3964
243 Ga0495646_0003989 3300046680 Bacteria 9241
244 Ga0495646_0004653 3300046680 Bacteria 8640
245 Ga0495613_0070166 3300046689 Bacteria 2555
246 Ga0495624_0005820 3300046690 Bacteria 8826
247 Ga0495671_0054617 3300046692 Bacteria 1980
248 Ga0495600_0003245 3300046809 Bacteria 9518
249 Ga0495581_0087690 3300047315 Bacteria 1804
250 Ga0495604_0026086 3300047317 Bacteria 4653
251 Ga0495602_0007734 3300048088 Bacteria 11236
252 Ga0495602_0066398 3300048088 Bacteria 3108
253 Ga0496102_0135399 3300048905 Bacteria 2308
254 Ga0496104_0105066 3300048907 Bacteria 2706
255 Ga0496115_0018151 3300048918 Bacteria 5395
256 Ga0496115_0114438 3300048918 Bacteria 2217
257 Ga0496116_0000024 3300048919 Bacteria 471420
258 Ga0496117_0003761 3300048920 Bacteria 17370
259 Ga0496118_0017695 3300048921 Bacteria 6471
260 Ga0496118_0046870 3300048921 Bacteria 3357
261 Ga0496121_0060250 3300048924 Bacteria 3123
262 Ga0496122_0013690 3300048925 Bacteria 7913
263 Ga0496123_0018053 3300048926 Bacteria 5641
264 Ga0496124_0031379 3300048927 Bacteria 4704
265 Ga0496125_0000018 3300048928 Bacteria 482390
266 Ga0496125_0002772 3300048928 Bacteria 22173
267 Ga0496126_0006512 3300048929 Bacteria 12997
268 Ga0501300_001559 3300049523 Bacteria 3447
269 Ga0501031_0014810 3300049568 Bacteria 5068
270 Ga0501032_0021138 3300049569 Bacteria 4527
271 Ga0501033_0007529 3300049570 Bacteria 8473
272 Ga0501034_0000432 3300049571 Bacteria 69492
273 Ga0501036_0005357 3300049572 Bacteria 10387
274 Ga0501036_0170266 3300049572 Bacteria 1835
275 Ga0501038_0022001 3300049574 Bacteria 5718
276 Ga0501039_0018677 3300049575 Bacteria 5323
277 Ga0501043_0017187 3300049579 Bacteria 5673
278 Ga0501070_0057097 3300049586 Bacteria 3236
279 Ga0501206_007863 3300049653 Bacteria 1404
280 Ga0501238_000137 3300049671 Bacteria 11188
281 Ga0501249_000008 3300049679 Bacteria 197587
282 Ga0501252_001432 3300049682 Bacteria 2197
283 Ga0501257_000807 3300049686 Bacteria 6259
284 Ga0501264_000961 3300049761 Bacteria 3561
285 Ga0501266_000002 3300049763 Bacteria 459947
286 Ga0501280_001350 3300049776 Bacteria 4652
287 Ga0501035_0015211 3300049822 Bacteria 7103
288 Ga0501044_0038866 3300049823 Bacteria 4968
289 Ga0501045_0003159 3300049824 Bacteria 11257
290 nmdc:mga03683_4195_c1 3300050489 Bacteria 4749
291 nmdc:mga0k408_5371_c1 3300050493 Bacteria 6812
292 nmdc:mga05p37_167573_c2 3300050507 Bacteria 1813
293 nmdc:mga08y16_11694_c1 3300050511 Bacteria 9223
294 Ga0495601_0144734 3300053077 Bacteria 1551
295 Ga0500646_0008386 3300053090 Bacteria 2640
296 Ga0500651_0002971 3300053093 Bacteria 9136
297 Ga0500641_0000008 3300053096 Bacteria 174314
298 Ga0500641_0000305 3300053096 Bacteria 18258
299 Ga0500641_0000505 3300053096 Bacteria 14050
300 Ga0500562_015233 3300053108 Bacteria 1972
301 Ga0500594_0002775 3300053118 Bacteria 3813
302 Ga0500595_001775 3300053119 Bacteria 11221
303 Ga0500658_0000002 3300053134 Bacteria 548440
304 Ga0500658_0039127 3300053134 Bacteria 1893
305 Ga0500574_000220 3300053141 Bacteria 6744
306 Ga0500604_0007959 3300053151 Bacteria 2811
307 Ga0500616_0014600 3300053153 Bacteria 4509
308 Ga0500619_000710 3300053154 Bacteria 5712
309 Ga0500622_0000009 3300053156 Bacteria 419980
310 Ga0500622_0000016 3300053156 Bacteria 337983
311 Ga0500622_0001265 3300053156 Bacteria 20619
312 Ga0500584_004811 3300053726 Bacteria 5595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042157 Ga0439458_0032236 Ga0439458_0032236_144_1238 350
2 3300014326 Ga0157380_10403864 Ga0157380_104038641 354
3 3300036647 Ga0316582_0216078 Ga0316582_0216078_22_1146 360
4 3300030732 Ga0316176_1030119 Ga0316176_103011914 374
5 3300005343 Ga0070687_100003390 Ga0070687_1000033905 377
6 3300025918 Ga0207662_10007128 Ga0207662_100071289 377
7 3300046462 Ga0495651_0004683 Ga0495651_0004683_2590_3864 379
8 3300046516 Ga0495628_0011951 Ga0495628_0011951_5949_7223 379
9 3300046529 Ga0495652_0048574 Ga0495652_0048574_966_2240 379
10 3300048088 Ga0495602_0066398 Ga0495602_0066398_27_1301 379
11 3300053077 Ga0495601_0144734 Ga0495601_0144734_15_1289 379
12 3300006353 Ga0075370_10047477 Ga0075370_100474773 383
13 3300003316 rootH1_10050900 rootH1_100509003 388
14 3300003322 rootL2_10203464 rootL2_102034642 389
15 3300003323 rootH1_10010049 rootH1_1001004929 389
16 3300005356 Ga0070674_100099621 Ga0070674_1000996212 389
17 3300005456 Ga0070678_100030100 Ga0070678_1000301005 389
18 3300006195 Ga0075366_10033459 Ga0075366_100334593 389
19 3300015683 Ga0183362_10001 Ga0183362_100011344 389
20 3300026121 Ga0207683_10164648 Ga0207683_101646482 389
21 3300026121 Ga0207683_10251509 Ga0207683_102515091 389
22 3300028794 Ga0307515_10002965 Ga0307515_1000296523 389
23 3300031730 Ga0307516_10007575 Ga0307516_100075757 389
24 3300046660 Ga0495625_0007540 Ga0495625_0007540_5721_6947 389
25 3300046692 Ga0495671_0054617 Ga0495671_0054617_315_1541 389
26 3300050493 nmdc:mga0k408_5371_c1 nmdc:mga0k408_5371_c1_4412_5638 389
27 3300050507 nmdc:mga05p37_167573_c2 nmdc:mga05p37_167573_c2_10_1215 390
28 3300035692 Ga0373935_0044282 Ga0373935_0044282_992_2236 391
29 3300044683 Ga0466965_0009936 Ga0466965_0009936_12_1250 391
30 3300046519 Ga0495632_0029547 Ga0495632_0029547_130_1356 391
31 3300053134 Ga0500658_0039127 Ga0500658_0039127_250_1476 391
32 3300005288 Ga0065714_10085820 Ga0065714_100858202 392
33 3300005331 Ga0070670_100085330 Ga0070670_1000853301 392
34 3300005353 Ga0070669_100026460 Ga0070669_1000264604 392
35 3300005543 Ga0070672_100082325 Ga0070672_1000823252 392
36 3300005840 Ga0068870_10041594 Ga0068870_100415942 392
37 3300013104 Ga0157370_10283841 Ga0157370_102838411 392
38 3300014497 Ga0182008_10045914 Ga0182008_100459142 392
39 3300015261 Ga0182006_1010138 Ga0182006_10101384 392
40 3300017792 Ga0163161_10024072 Ga0163161_100240722 392
41 3300025923 Ga0207681_10023994 Ga0207681_100239941 392
42 3300025940 Ga0207691_10077858 Ga0207691_100778583 392
43 3300025960 Ga0207651_10215793 Ga0207651_102157931 392
44 3300025972 Ga0207668_10041921 Ga0207668_100419213 392
45 3300026121 Ga0207683_10186447 Ga0207683_101864472 392
46 3300046475 Ga0495639_0009427 Ga0495639_0009427_360_1586 392
47 3300046539 Ga0495621_0026655 Ga0495621_0026655_572_1798 392
48 3300046615 Ga0495656_0051237 Ga0495656_0051237_288_1514 392
49 3300046678 Ga0495599_0057932 Ga0495599_0057932_240_1466 392
50 3300046689 Ga0495613_0070166 Ga0495613_0070166_132_1358 392
51 3300048905 Ga0496102_0135399 Ga0496102_0135399_563_1789 392
52 3300048907 Ga0496104_0105066 Ga0496104_0105066_494_1720 392
53 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001618 393
54 3300002771 JGI25163J39215_1002443 JGI25163J39215_10024432 393
55 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001603 393
56 3300003751 Ga0055538_1000001 Ga0055538_1000001431 393
57 3300003752 Ga0055539_1000001 Ga0055539_1000001431 393
58 3300003756 Ga0055533_1000003 Ga0055533_1000003603 393
59 3300003759 Ga0055525_1000003 Ga0055525_1000003603 393
60 3300003841 Ga0055541_1000001 Ga0055541_1000001603 393
61 3300005331 Ga0070670_100041194 Ga0070670_1000411942 393
62 3300005334 Ga0068869_100137244 Ga0068869_1001372442 393
63 3300005338 Ga0068868_100029118 Ga0068868_1000291182 393
64 3300005459 Ga0068867_100034314 Ga0068867_1000343143 393
65 3300005544 Ga0070686_100146269 Ga0070686_1001462691 393
66 3300005844 Ga0068862_100000646 Ga0068862_10000064610 393
67 3300014497 Ga0182008_10062871 Ga0182008_100628712 393
68 3300015261 Ga0182006_1006682 Ga0182006_10066824 393
69 3300015265 Ga0182005_1000654 Ga0182005_10006542 393
70 3300025224 Ga0209784_100004 Ga0209784_100004598 393
71 3300025225 Ga0209566_100004 Ga0209566_100004755 393
72 3300025226 Ga0209674_100006 Ga0209674_100006755 393
73 3300025230 Ga0209563_100009 Ga0209563_100009598 393
74 3300025231 Ga0207427_100467 Ga0207427_10046719 393
75 3300025233 Ga0209437_100004 Ga0209437_100004598 393
76 3300025253 Ga0209677_100005 Ga0209677_100005598 393
77 3300025261 Ga0209233_1000005 Ga0209233_1000005755 393
78 3300025907 Ga0207645_10001260 Ga0207645_100012608 393
79 3300025908 Ga0207643_10036044 Ga0207643_100360443 393
80 3300025942 Ga0207689_10022102 Ga0207689_100221024 393
81 3300026023 Ga0207677_10053310 Ga0207677_100533102 393
82 3300026089 Ga0207648_10003223 Ga0207648_1000322315 393
83 3300028380 Ga0268265_10000223 Ga0268265_1000022330 393
84 3300038443 Ga0395901_0362502 Ga0395901_0362502_40_1275 393
85 3300046454 Ga0495592_0024433 Ga0495592_0024433_947_2218 393
86 3300046463 Ga0495653_0008643 Ga0495653_0008643_4364_5635 393
87 3300046511 Ga0495608_0029070 Ga0495608_0029070_628_1899 393
88 3300046516 Ga0495628_0002428 Ga0495628_0002428_14695_15966 393
89 3300046529 Ga0495652_0020068 Ga0495652_0020068_306_1580 393
90 3300046529 Ga0495652_0112777 Ga0495652_0112777_795_2066 393
91 3300046678 Ga0495599_0000582 Ga0495599_0000582_14443_15714 393
92 3300046679 Ga0495623_0023644 Ga0495623_0023644_2442_3704 393
93 3300046680 Ga0495646_0003989 Ga0495646_0003989_4785_6056 393
94 3300046680 Ga0495646_0004653 Ga0495646_0004653_7276_8550 393
95 3300046690 Ga0495624_0005820 Ga0495624_0005820_2801_4072 393
96 3300046809 Ga0495600_0003245 Ga0495600_0003245_7168_8439 393
97 3300047317 Ga0495604_0026086 Ga0495604_0026086_655_1926 393
98 3300048088 Ga0495602_0007734 Ga0495602_0007734_4890_6161 393
99 3300050489 nmdc:mga03683_4195_c1 nmdc:mga03683_4195_c1_2053_3279 393
100 3300053119 Ga0500595_001775 Ga0500595_001775_3975_5237 393
101 3300053141 Ga0500574_000220 Ga0500574_000220_3336_4607 393
102 3300053154 Ga0500619_000710 Ga0500619_000710_671_1942 393
103 3300042156 Ga0439446_0014301 Ga0439446_0014301_394_1623 395
104 3300049653 Ga0501206_007863 Ga0501206_007863_144_1391 395
105 3300032005 Ga0307411_10013982 Ga0307411_100139824 396
106 3300028573 Ga0265334_10045118 Ga0265334_100451182 398
107 3300039062 Ga0400483_000149 Ga0400483_000149_3232_4461 403
108 3300039093 Ga0400489_38471 Ga0400489_38471_2063_3292 403
109 3300036647 Ga0316582_0104922 Ga0316582_0104922_232_1452 404
110 iso_pu_bacteria 2513020052 2513232310 404
111 iso_pu_bacteria 2519899754 2520879477 404
112 iso_pu_bacteria 2585428062 2587757875 404
113 iso_pu_bacteria 2643221576 2643890785 404
114 iso_pu_bacteria 2643221590 2643959841 404
115 iso_pu_bacteria 2643221600 2644009121 404
116 iso_pu_bacteria 2643221604 2644032715 404
117 iso_pu_bacteria 2643221617 2644100799 404
118 iso_pu_bacteria 2643221620 2644117207 404
119 iso_pu_bacteria 2643221667 2644371208 404
120 iso_pu_bacteria 2643221667 2644373032 404
121 iso_pu_bacteria 2643221716 2644643997 404
122 iso_pu_bacteria 2643221725 2644681890 404
123 iso_pu_bacteria 2738541279 2738733165 404
124 iso_pu_bacteria 2738541284 2738761589 404
125 iso_pu_bacteria 2738541285 2738765703 404
126 iso_pu_bacteria 2738543007 2739214746 404
127 iso_pu_bacteria 2738543023 2739305323 404
128 iso_pu_bacteria 2739367857 2740002761 404
129 iso_pu_bacteria 2739367858 2740007578 404
130 iso_pu_bacteria 2739367866 2740032175 404
131 iso_pu_bacteria 2775506987 2776615776 404
132 iso_pu_bacteria 2802428842 2802655200 404
133 iso_pu_bacteria 2816332280 2817413609 404
134 iso_pu_bacteria 2818991436 2819540627 404
135 iso_pu_bacteria 2833640130 2833641013 404
136 iso_pu_bacteria 2839989709 2839990476 404
137 iso_pu_bacteria 2842903701 2842906820 404
138 iso_pu_bacteria 2852627209 2852627989 404
139 iso_pu_bacteria 2857613821 2857616982 404
140 iso_pu_bacteria 2857618242 2857619635 404
141 iso_pu_bacteria 2881247448 2881247458 404
142 iso_pu_bacteria 2881359912 2881362593 404
143 iso_pu_bacteria 2884634485 2884635535 404
144 iso_pu_bacteria 2890804823 2890805242 404
145 iso_pu_bacteria 2902048731 2902049617 404
146 iso_pu_bacteria 2903895155 2903896742 404
147 iso_pu_bacteria 2904419702 2904422465 404
148 iso_pu_bacteria 2904555929 2904558425 404
149 iso_pu_bacteria 2919186247 2919188346 404
150 iso_pu_bacteria 2919191525 2919194140 404
151 iso_pu_bacteria 2919509842 2919510734 404
152 iso_pu_bacteria 2919683626 2919684696 404
153 iso_pu_bacteria 2919692658 2919693674 404
154 iso_pu_bacteria 2929150217 2929150679 404
155 iso_pu_bacteria 2939664404 2939667570 404
156 iso_pu_bacteria 2958458903 2958462061 404
157 iso_pu_bacteria 2958512119 2958513836 404
158 iso_pu_bacteria 2965320100 2965321841 404
159 iso_pu_bacteria 2977268062 2977272133 404
160 iso_pu_bacteria 8036736890 8036738602 404
161 iso_pu_bacteria 8054307821 8054311357 404
162 iso_pu_bacteria 8055419101 8055423640 404
163 iso_pu_bacteria 8055592153 8055595003 404
164 iso_pu_bacteria 8056440228 8056443584 404
165 3300031691 Ga0316579_10018038 Ga0316579_100180382 405
166 3300031727 Ga0316576_10000473 Ga0316576_100004733 405
167 3300031727 Ga0316576_10140586 Ga0316576_101405862 405
168 3300031728 Ga0316578_10000277 Ga0316578_100002773 405
169 3300031728 Ga0316578_10034425 Ga0316578_100344252 405
170 3300031733 Ga0316577_10014562 Ga0316577_100145622 405
171 3300031733 Ga0316577_10068801 Ga0316577_100688012 405
172 3300032139 Ga0316580_10012157 Ga0316580_100121572 405
173 3300032139 Ga0316580_10015029 Ga0316580_100150291 405
174 3300036647 Ga0316582_0054378 Ga0316582_0054378_1077_2396 405
175 3300036712 Ga0316584_0001351 Ga0316584_0001351_3118_4437 405
176 3300037312 Ga0395899_0099855 Ga0395899_0099855_172_1392 406
177 3300003316 rootH1_10000402 rootH1_1000040213 407
178 3300003320 rootH2_10011821 rootH2_1001182111 407
179 3300003322 rootL2_10012574 rootL2_100125749 407
180 3300003322 rootL2_10025775 rootL2_100257752 407
181 3300031251 Ga0265327_10015491 Ga0265327_100154912 407
182 3300037471 Ga0395905_0073796 Ga0395905_0073796_1942_3183 407
183 3300038725 Ga0400484_36963 Ga0400484_36963_1843_3075 407
184 3300045051 Ga0451576_0000003 Ga0451576_0000003_658630_659853 407
185 3300049523 Ga0501300_001559 Ga0501300_001559_770_1996 407
186 3300049568 Ga0501031_0014810 Ga0501031_0014810_3681_4907 407
187 3300049569 Ga0501032_0021138 Ga0501032_0021138_1523_2755 407
188 3300049570 Ga0501033_0007529 Ga0501033_0007529_3879_5105 407
189 3300049571 Ga0501034_0000432 Ga0501034_0000432_8593_9819 407
190 3300049572 Ga0501036_0005357 Ga0501036_0005357_7773_8999 407
191 3300049574 Ga0501038_0022001 Ga0501038_0022001_59_1285 407
192 3300049575 Ga0501039_0018677 Ga0501039_0018677_3709_4935 407
193 3300049579 Ga0501043_0017187 Ga0501043_0017187_3675_4901 407
194 3300049586 Ga0501070_0057097 Ga0501070_0057097_388_1614 407
195 3300049686 Ga0501257_000807 Ga0501257_000807_4984_6210 407
196 3300049761 Ga0501264_000961 Ga0501264_000961_2288_3514 407
197 3300049822 Ga0501035_0015211 Ga0501035_0015211_3739_4965 407
198 3300049823 Ga0501044_0038866 Ga0501044_0038866_3581_4807 407
199 3300049824 Ga0501045_0003159 Ga0501045_0003159_3708_4934 407
200 iso_pu_bacteria 2643221546 2643752466 407
201 iso_pu_bacteria 2721755487 2722727442 407
202 2162886007 SwRhRL2b_contig_2869200 SwRhRL2b_0239.00000530 408
203 2162886007 SwRhRL2b_contig_3344168 SwRhRL2b_0518.00003970 408
204 3300003320 rootH2_10201577 rootH2_102015774 408
205 3300003323 rootH1_10034877 rootH1_1003487712 408
206 3300003578 Ga0006562J51391_1005705 Ga0006562J51391_10057052 408
207 3300005262 Ga0065165_1000797 Ga0065165_100079715 408
208 3300005288 Ga0065714_10002724 Ga0065714_1000272424 408
209 3300005288 Ga0065714_10004448 Ga0065714_100044489 408
210 3300005288 Ga0065714_10065718 Ga0065714_100657182 408
211 3300005288 Ga0065714_10071893 Ga0065714_100718933 408
212 3300005288 Ga0065714_10074257 Ga0065714_100742571 408
213 3300005289 Ga0065704_10001588 Ga0065704_100015883 408
214 3300005289 Ga0065704_10070311 Ga0065704_1007031120 408
215 3300005289 Ga0065704_10076563 Ga0065704_100765634 408
216 3300005289 Ga0065704_10089198 Ga0065704_100891982 408
217 3300005293 Ga0065715_10109731 Ga0065715_101097312 408
218 3300005563 Ga0068855_100333311 Ga0068855_1003333112 408
219 3300005616 Ga0068852_100107012 Ga0068852_1001070122 408
220 3300005841 Ga0068863_100132983 Ga0068863_1001329832 408
221 3300006942 Ga0099824_1003063 Ga0099824_10030634 408
222 3300006946 Ga0079104_1000421 Ga0079104_100042134 408
223 3300006948 Ga0099826_10000257 Ga0099826_1000025720 408
224 3300009036 Ga0105244_10000057 Ga0105244_1000005745 408
225 3300009036 Ga0105244_10072970 Ga0105244_100729702 408
226 3300009094 Ga0111539_10236421 Ga0111539_102364212 408
227 3300009148 Ga0105243_10000004 Ga0105243_10000004100 408
228 3300009545 Ga0105237_10001800 Ga0105237_1000180021 408
229 3300009551 Ga0105238_10029975 Ga0105238_100299755 408
230 3300010375 Ga0105239_10000798 Ga0105239_1000079815 408
231 3300013100 Ga0157373_10000111 Ga0157373_1000011154 408
232 3300013100 Ga0157373_10002248 Ga0157373_100022482 408
233 3300013102 Ga0157371_10008229 Ga0157371_100082297 408
234 3300013102 Ga0157371_10047539 Ga0157371_100475392 408
235 3300013102 Ga0157371_10052337 Ga0157371_100523372 408
236 3300013102 Ga0157371_10072353 Ga0157371_100723532 408
237 3300013104 Ga0157370_10000257 Ga0157370_1000025750 408
238 3300013104 Ga0157370_10000395 Ga0157370_100003951 408
239 3300013104 Ga0157370_10002728 Ga0157370_100027281 408
240 3300013104 Ga0157370_10011859 Ga0157370_100118592 408
241 3300013104 Ga0157370_10021353 Ga0157370_100213536 408
242 3300013104 Ga0157370_10022209 Ga0157370_100222094 408
243 3300013104 Ga0157370_10027462 Ga0157370_100274623 408
244 3300013104 Ga0157370_10083949 Ga0157370_100839492 408
245 3300013104 Ga0157370_10121207 Ga0157370_101212072 408
246 3300013105 Ga0157369_10004901 Ga0157369_100049015 408
247 3300013306 Ga0163162_10018023 Ga0163162_100180236 408
248 3300014326 Ga0157380_10002630 Ga0157380_100026308 408
249 3300014326 Ga0157380_10002748 Ga0157380_100027482 408
250 3300014497 Ga0182008_10000047 Ga0182008_100000472 408
251 3300014497 Ga0182008_10072713 Ga0182008_100727132 408
252 3300015261 Ga0182006_1002172 Ga0182006_100217211 408
253 3300015261 Ga0182006_1003730 Ga0182006_10037307 408
254 3300017792 Ga0163161_10000075 Ga0163161_100000753 408
255 3300017792 Ga0163161_10188576 Ga0163161_101885761 408
256 3300025728 Ga0207655_1000038 Ga0207655_1000038291 408
257 3300025913 Ga0207695_10015196 Ga0207695_100151961 408
258 3300025914 Ga0207671_10001730 Ga0207671_100017305 408
259 3300025927 Ga0207687_10058972 Ga0207687_100589722 408
260 3300025935 Ga0207709_10000010 Ga0207709_10000010102 408
261 3300025939 Ga0207665_10025596 Ga0207665_100255962 408
262 3300026088 Ga0207641_10159257 Ga0207641_101592571 408
263 3300027111 Ga0209281_1000570 Ga0209281_10005705 408
264 3300027361 Ga0209489_109469 Ga0209489_10946912 408
265 3300027666 Ga0209282_1010717 Ga0209282_10107172 408
266 3300028379 Ga0268266_10096654 Ga0268266_100966543 408
267 3300028577 Ga0265318_10005341 Ga0265318_100053413 408
268 3300028794 Ga0307515_10000009 Ga0307515_1000000938 408
269 3300028794 Ga0307515_10067220 Ga0307515_100672202 408
270 3300028794 Ga0307515_10173429 Ga0307515_101734292 408
271 3300030731 Ga0316177_1032754 Ga0316177_10327545 408
272 3300030734 Ga0316179_1059023 Ga0316179_10590233 408
273 3300030742 Ga0316183_1088093 Ga0316183_108809311 408
274 3300030744 Ga0316181_1054969 Ga0316181_10549694 408
275 3300031507 Ga0307509_10048415 Ga0307509_100484152 408
276 3300031548 Ga0307408_100000055 Ga0307408_10000005539 408
277 3300031548 Ga0307408_100002005 Ga0307408_1000020055 408
278 3300031731 Ga0307405_10000005 Ga0307405_10000005320 408
279 3300031731 Ga0307405_10012938 Ga0307405_100129383 408
280 3300031824 Ga0307413_10000274 Ga0307413_1000027414 408
281 3300031852 Ga0307410_10000048 Ga0307410_100000488 408
282 3300031901 Ga0307406_10000004 Ga0307406_1000000445 408
283 3300031911 Ga0307412_10000001 Ga0307412_10000001574 408
284 3300031911 Ga0307412_10005875 Ga0307412_100058752 408
285 3300031911 Ga0307412_10024383 Ga0307412_100243832 408
286 3300031911 Ga0307412_10097476 Ga0307412_100974762 408
287 3300032002 Ga0307416_100003753 Ga0307416_1000037538 408
288 3300032002 Ga0307416_100032271 Ga0307416_1000322714 408
289 3300032002 Ga0307416_100149964 Ga0307416_1001499642 408
290 3300032004 Ga0307414_10000040 Ga0307414_1000004017 408
291 3300032004 Ga0307414_10000051 Ga0307414_1000005135 408
292 3300032004 Ga0307414_10001420 Ga0307414_100014206 408
293 3300032004 Ga0307414_10003823 Ga0307414_100038235 408
294 3300032004 Ga0307414_10007659 Ga0307414_100076591 408
295 3300032004 Ga0307414_10028387 Ga0307414_100283872 408
296 3300032004 Ga0307414_10043062 Ga0307414_100430622 408
297 3300032004 Ga0307414_10129769 Ga0307414_101297692 408
298 3300032005 Ga0307411_10000020 Ga0307411_1000002036 408
299 3300032126 Ga0307415_100054906 Ga0307415_1000549063 408
300 3300033180 Ga0307510_10032579 Ga0307510_100325795 408
301 3300035695 Ga0373927_0041260 Ga0373927_0041260_1731_2963 408
302 3300041407 Ga0439447_015848 Ga0439447_015848_656_1882 408
303 3300041407 Ga0439447_023752 Ga0439447_023752_64_1290 408
304 3300041411 Ga0439466_0001833 Ga0439466_0001833_4261_5487 408
305 3300041411 Ga0439466_0024408 Ga0439466_0024408_560_1786 408
306 3300042002 Ga0439442_011445 Ga0439442_011445_269_1495 408
307 3300042006 Ga0439432_020212 Ga0439432_020212_782_2008 408
308 3300042007 Ga0439449_0001081 Ga0439449_0001081_4250_5476 408
309 3300042014 Ga0439457_005386 Ga0439457_005386_1472_2698 408
310 3300042015 Ga0439462_0001016 Ga0439462_0001016_2306_3532 408
311 3300042125 Ga0450923_003205 Ga0450923_003205_247_1530 408
312 3300042125 Ga0450923_014403 Ga0450923_014403_149_1375 408
313 3300042134 Ga0450898_006210 Ga0450898_006210_126_1352 408
314 3300042145 Ga0450906_005052 Ga0450906_005052_1400_2626 408
315 3300042531 Ga0450918_010362 Ga0450918_010362_158_1384 408
316 3300042876 Ga0451577_0001625 Ga0451577_0001625_22772_24085 408
317 3300042876 Ga0451577_0018506 Ga0451577_0018506_1541_2767 408
318 3300042876 Ga0451577_0054544 Ga0451577_0054544_1649_2878 408
319 3300044673 Ga0453683_0017821 Ga0453683_0017821_1645_2874 408
320 3300044712 Ga0453684_0003071 Ga0453684_0003071_23809_25122 408
321 3300044712 Ga0453684_0004162 Ga0453684_0004162_11866_13095 408
322 3300044712 Ga0453684_0017017 Ga0453684_0017017_2531_3757 408
323 3300044712 Ga0453684_0071409 Ga0453684_0071409_552_1778 408
324 3300045051 Ga0451576_0004809 Ga0451576_0004809_13452_14678 408
325 3300045051 Ga0451576_0072626 Ga0451576_0072626_2281_3510 408
326 3300045051 Ga0451576_0102301 Ga0451576_0102301_387_1700 408
327 3300046453 Ga0495627_003411 Ga0495627_003411_702_1928 408
328 3300046501 Ga0495607_0002790 Ga0495607_0002790_3072_4298 408
329 3300046507 Ga0495606_0023905 Ga0495606_0023905_1493_2719 408
330 3300046512 Ga0495610_0094524 Ga0495610_0094524_11_1237 408
331 3300046513 Ga0495616_0018469 Ga0495616_0018469_1480_2706 408
332 3300046522 Ga0495643_0000985 Ga0495643_0000985_10118_11371 408
333 3300046660 Ga0495625_0002098 Ga0495625_0002098_2856_4082 408
334 3300046674 Ga0495588_0034776 Ga0495588_0034776_989_2215 408
335 3300047315 Ga0495581_0087690 Ga0495581_0087690_250_1476 408
336 3300048918 Ga0496115_0018151 Ga0496115_0018151_1012_2247 408
337 3300048918 Ga0496115_0114438 Ga0496115_0114438_814_2040 408
338 3300048919 Ga0496116_0000024 Ga0496116_0000024_25222_26448 408
339 3300048920 Ga0496117_0003761 Ga0496117_0003761_1370_2623 408
340 3300048921 Ga0496118_0017695 Ga0496118_0017695_2791_4017 408
341 3300048921 Ga0496118_0046870 Ga0496118_0046870_1615_2868 408
342 3300048924 Ga0496121_0060250 Ga0496121_0060250_133_1359 408
343 3300048925 Ga0496122_0013690 Ga0496122_0013690_5013_6266 408
344 3300048926 Ga0496123_0018053 Ga0496123_0018053_567_1820 408
345 3300048927 Ga0496124_0031379 Ga0496124_0031379_3236_4462 408
346 3300048928 Ga0496125_0000018 Ga0496125_0000018_454059_455285 408
347 3300048928 Ga0496125_0002772 Ga0496125_0002772_12325_13551 408
348 3300048929 Ga0496126_0006512 Ga0496126_0006512_2226_3452 408
349 3300049572 Ga0501036_0170266 Ga0501036_0170266_533_1759 408
350 3300049671 Ga0501238_000137 Ga0501238_000137_1350_2576 408
351 3300049679 Ga0501249_000008 Ga0501249_000008_153027_154253 408
352 3300049682 Ga0501252_001432 Ga0501252_001432_829_2055 408
353 3300049763 Ga0501266_000002 Ga0501266_000002_419954_421180 408
354 3300049776 Ga0501280_001350 Ga0501280_001350_2194_3420 408
355 3300050511 nmdc:mga08y16_11694_c1 nmdc:mga08y16_11694_c1_7601_8827 408
356 3300053090 Ga0500646_0008386 Ga0500646_0008386_1326_2552 408
357 3300053093 Ga0500651_0002971 Ga0500651_0002971_7864_9090 408
358 3300053096 Ga0500641_0000008 Ga0500641_0000008_105219_106445 408
359 3300053096 Ga0500641_0000305 Ga0500641_0000305_15732_16958 408
360 3300053096 Ga0500641_0000505 Ga0500641_0000505_523_1749 408
361 3300053108 Ga0500562_015233 Ga0500562_015233_334_1566 408
362 3300053118 Ga0500594_0002775 Ga0500594_0002775_2143_3369 408
363 3300053134 Ga0500658_0000002 Ga0500658_0000002_107196_108422 408
364 3300053151 Ga0500604_0007959 Ga0500604_0007959_458_1690 408
365 3300053153 Ga0500616_0014600 Ga0500616_0014600_2048_3274 408
366 3300053156 Ga0500622_0000009 Ga0500622_0000009_240597_241829 408
367 3300053156 Ga0500622_0000016 Ga0500622_0000016_246374_247606 408
368 3300053156 Ga0500622_0001265 Ga0500622_0001265_1444_2670 408
369 3300053726 Ga0500584_004811 Ga0500584_004811_3677_4903 408
370 iso_pu_bacteria 2738541305 2738869678 408
371 iso_pu_bacteria 2904780799 2904781788 408
372 iso_pu_bacteria 2919177583 2919181546 408

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02812

ELFV_dehydrog_N

Glu/Leu/Phe/Val dehydrogenase, dimerisation domain

58

166

0.88

PF00208

ELFV_dehydrog

Glutamate/Leucine/Phenylalanine/Valine dehydrogenase

223

453

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h4p-assembly1.cif.gz_A crystal structure of ferredoxin reductase, bpha4 e175q/q177k mutant (oxidized form) 0.9234 205 239
2gr3-assembly1.cif.gz_A-2 crystal structure of ferredoxin reductase, bpha4 (oxidized form) 0.9209 205 239
8pxk-assembly1.cif.gz_A structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a 0.8377 205 240
4xgi-assembly1.cif.gz_F crystal structure of glutamate dehydrogenase from burkholderia thailandensis 0.7906 3 407
1bxg-assembly1.cif.gz_B phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate 0.7756 13 406
ID Description Score Start End Superfamily
af_Q0JA75_27_278_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8943 205 237 3.90.180.10
3k8zD03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8555 185 347 3.40.50.720
3k8zE03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8512 185 347 3.40.50.720
3aoeE03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8504 185 347 3.40.50.720
3k8zD03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8304 185 347 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Y7U6A5-F1-model_v4 Amino acid dehydrogenase 0.9953 155 380 GO:0004352
GO:0006538
AF-A0A848TYK7-F1-model_v4 Amino acid dehydrogenase 0.9915 163 408 GO:0004352
GO:0006538
AF-A0A519MPW0-F1-model_v4 Amino acid dehydrogenase 0.9909 96 408 GO:0004352
GO:0006538
AF-A0A3C0F833-F1-model_v4 deleted 0.9905 207 408
AF-A0A349QUN7-F1-model_v4 Amino acid dehydrogenase 0.9886 1 146 GO:0006520
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.52 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map