F425967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 372 | 243 | 744 | 370 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100123648|Ga0070713_1001236481 |
| Length | 411 |
| Sequence | MSQALRDLAAAGVAVWLDDLSRPRIRSGDLARSVERGEIVGITTNPTIFAKAIGAGSGYEDQVRDLALRGTAIGETLRLLTAWDVRAACDVLRPVFDRSGRRDGRVSIEVDPRLARDGDRTAAEARGLWWLVDRPNLFIKIPATLAGLPAITASVADGISVNVTLIFSVSRYEAVLDAYMAGLERRTARGDGLEGIESVASFFVSRVDTEVDRRLADIADRSGDEAVSAAAERLRGQAALANCRLAYRHYERVLASDRWKALAAKGARMQRLLWASTGVKDERFEDTRYVVELVAPDTVNTMPEATLRAVADHGEVRGDTIRGGYEEAQAVVDGLANLGVDLADVADGLEAQGIASFAASWDELIASVTRRVEQAGATVMPAGAVTPASGEGGQAAAPAXXAPRGTAGKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 111 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 113 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 114 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 128 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 129 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 130 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 139 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 147 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 148 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 149 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 150 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 151 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 152 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 153 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 154 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 155 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 156 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 157 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 201 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 214 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 215 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 220 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 221 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 222 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 223 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 224 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 225 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 226 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 227 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 228 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 229 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 230 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 231 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 232 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 233 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 234 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 235 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 236 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 237 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 238 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 239 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 240 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 241 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 242 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 243 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.98 |
| Metatranscriptomes | 4.03 |
| Isolates | 6.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.34 |
| Nodule | 0 |
| Rhizoplane | 13.17 |
| Rhizosphere | 77.96 |
| Stem | 0 |
| Stem Tuber | 0.27 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100123648 | 3300005436 | Bacteria | 2272 |
| 2 | JGI25404J52841_10021788 | 3300003659 | Bacteria | 1387 |
| 3 | Ga0055540_1000036 | 3300003792 | Bacteria | 164285 |
| 4 | Ga0058861_10084976 | 3300004800 | Bacteria | 1605 |
| 5 | Ga0070658_10034957 | 3300005327 | Bacteria | 4046 |
| 6 | Ga0070683_100053738 | 3300005329 | Bacteria | 3733 |
| 7 | Ga0068869_100222424 | 3300005334 | Bacteria | 1497 |
| 8 | Ga0070660_100065849 | 3300005339 | Bacteria | 2820 |
| 9 | Ga0070689_100218492 | 3300005340 | Bacteria | 1562 |
| 10 | Ga0070689_100260892 | 3300005340 | Bacteria | 1432 |
| 11 | Ga0070661_100154029 | 3300005344 | Bacteria | 1738 |
| 12 | Ga0070668_100313417 | 3300005347 | Bacteria | 1319 |
| 13 | Ga0070671_100157610 | 3300005355 | Bacteria | 1918 |
| 14 | Ga0070659_100122225 | 3300005366 | Bacteria | 2110 |
| 15 | Ga0070667_100036552 | 3300005367 | Bacteria | 4117 |
| 16 | Ga0070709_10083066 | 3300005434 | Bacteria | 2094 |
| 17 | Ga0070714_100000517 | 3300005435 | Bacteria | 27999 |
| 18 | Ga0070714_100208733 | 3300005435 | Bacteria | 1789 |
| 19 | Ga0070713_100015009 | 3300005436 | Bacteria | 5771 |
| 20 | Ga0070713_100042593 | 3300005436 | Bacteria | 3707 |
| 21 | Ga0070713_100116815 | 3300005436 | Bacteria | 2334 |
| 22 | Ga0070713_100129277 | 3300005436 | Bacteria | 2225 |
| 23 | Ga0070713_100276982 | 3300005436 | Bacteria | 1538 |
| 24 | Ga0070710_10000444 | 3300005437 | Bacteria | 19478 |
| 25 | Ga0070701_10010524 | 3300005438 | Bacteria | 4093 |
| 26 | Ga0070711_100314540 | 3300005439 | Bacteria | 1249 |
| 27 | Ga0070708_100179403 | 3300005445 | Bacteria | 1979 |
| 28 | Ga0070663_100018047 | 3300005455 | Bacteria | 4617 |
| 29 | Ga0070678_100062081 | 3300005456 | Bacteria | 2757 |
| 30 | Ga0070707_100002906 | 3300005468 | Bacteria | 16267 |
| 31 | Ga0070707_100029155 | 3300005468 | Bacteria | 5254 |
| 32 | Ga0070679_100059537 | 3300005530 | Bacteria | 3807 |
| 33 | Ga0070679_100102226 | 3300005530 | Bacteria | 2852 |
| 34 | Ga0070684_100187307 | 3300005535 | Bacteria | 1882 |
| 35 | Ga0068853_100017341 | 3300005539 | Bacteria | 5945 |
| 36 | Ga0070672_100085161 | 3300005543 | Bacteria | 2540 |
| 37 | Ga0070686_100020393 | 3300005544 | Bacteria | 3921 |
| 38 | Ga0070696_100016950 | 3300005546 | Bacteria | 4913 |
| 39 | Ga0070665_100020680 | 3300005548 | Bacteria | 6612 |
| 40 | Ga0070665_100066196 | 3300005548 | Bacteria | 3624 |
| 41 | Ga0070664_100077315 | 3300005564 | Bacteria | 2861 |
| 42 | Ga0068854_100031089 | 3300005578 | Bacteria | 3708 |
| 43 | Ga0068856_100217958 | 3300005614 | Bacteria | 1923 |
| 44 | Ga0068864_100005166 | 3300005618 | Bacteria | 10690 |
| 45 | Ga0068851_10044040 | 3300005834 | Bacteria | 2251 |
| 46 | Ga0068870_10064331 | 3300005840 | Bacteria | 1981 |
| 47 | Ga0068863_100038071 | 3300005841 | Bacteria | 4577 |
| 48 | Ga0068863_100178168 | 3300005841 | Bacteria | 2040 |
| 49 | Ga0068858_100070428 | 3300005842 | Bacteria | 3242 |
| 50 | Ga0068858_100352132 | 3300005842 | Bacteria | 1410 |
| 51 | Ga0081455_10000462 | 3300005937 | Bacteria | 53037 |
| 52 | Ga0081455_10004460 | 3300005937 | Bacteria | 15688 |
| 53 | Ga0081455_10011037 | 3300005937 | Bacteria | 9098 |
| 54 | Ga0081540_1000004 | 3300005983 | Bacteria | 231552 |
| 55 | Ga0081540_1001276 | 3300005983 | Bacteria | 21966 |
| 56 | Ga0070717_10136274 | 3300006028 | Bacteria | 2114 |
| 57 | Ga0070717_10169689 | 3300006028 | Bacteria | 1897 |
| 58 | Ga0075365_10038886 | 3300006038 | Bacteria | 3095 |
| 59 | Ga0070716_100202519 | 3300006173 | Bacteria | 1320 |
| 60 | Ga0075428_100000304 | 3300006844 | Bacteria | 48365 |
| 61 | Ga0075428_100042741 | 3300006844 | Bacteria | 4982 |
| 62 | Ga0075428_100084398 | 3300006844 | Bacteria | 3466 |
| 63 | Ga0075430_100001144 | 3300006846 | Bacteria | 21152 |
| 64 | Ga0075430_100008725 | 3300006846 | Bacteria | 8556 |
| 65 | Ga0075430_100013369 | 3300006846 | Bacteria | 6994 |
| 66 | Ga0075431_100000395 | 3300006847 | Bacteria | 35082 |
| 67 | Ga0075429_100001175 | 3300006880 | Bacteria | 21152 |
| 68 | Ga0075429_100001187 | 3300006880 | Bacteria | 21049 |
| 69 | Ga0075429_100003147 | 3300006880 | Bacteria | 14017 |
| 70 | Ga0075429_100005345 | 3300006880 | Bacteria | 11046 |
| 71 | Ga0075429_100104512 | 3300006880 | Bacteria | 2474 |
| 72 | Ga0075436_100166541 | 3300006914 | Bacteria | 1555 |
| 73 | Ga0105250_10038602 | 3300009092 | Bacteria | 1915 |
| 74 | Ga0111539_10082436 | 3300009094 | Bacteria | 3783 |
| 75 | Ga0111539_10106491 | 3300009094 | Bacteria | 3289 |
| 76 | Ga0111539_10312198 | 3300009094 | Bacteria | 1830 |
| 77 | Ga0105245_10240415 | 3300009098 | Bacteria | 1755 |
| 78 | Ga0114129_10000016 | 3300009147 | Bacteria | 127415 |
| 79 | Ga0114129_10012574 | 3300009147 | Bacteria | 12052 |
| 80 | Ga0114129_10022485 | 3300009147 | Bacteria | 8949 |
| 81 | Ga0114129_10024763 | 3300009147 | Bacteria | 8508 |
| 82 | Ga0114129_10084379 | 3300009147 | Bacteria | 4410 |
| 83 | Ga0105242_10156762 | 3300009176 | Bacteria | 1989 |
| 84 | Ga0105248_10021311 | 3300009177 | Bacteria | 7182 |
| 85 | Ga0105248_10313898 | 3300009177 | Bacteria | 1765 |
| 86 | Ga0105238_10291501 | 3300009551 | Bacteria | 1614 |
| 87 | Ga0105249_10031594 | 3300009553 | Bacteria | 4789 |
| 88 | Ga0105246_10020701 | 3300011119 | Bacteria | 4223 |
| 89 | Ga0105246_10255402 | 3300011119 | Bacteria | 1393 |
| 90 | Ga0157373_10050967 | 3300013100 | Bacteria | 2948 |
| 91 | Ga0157371_10141269 | 3300013102 | Bacteria | 1715 |
| 92 | Ga0157370_10144341 | 3300013104 | Bacteria | 2217 |
| 93 | Ga0157369_10443413 | 3300013105 | Bacteria | 1344 |
| 94 | Ga0157374_10313087 | 3300013296 | Bacteria | 1554 |
| 95 | Ga0163162_10046027 | 3300013306 | Bacteria | 4373 |
| 96 | Ga0157372_10321480 | 3300013307 | Bacteria | 1802 |
| 97 | Ga0157375_10319799 | 3300013308 | Bacteria | 1716 |
| 98 | Ga0163163_10027325 | 3300014325 | Bacteria | 5465 |
| 99 | Ga0163163_10064414 | 3300014325 | Bacteria | 3637 |
| 100 | Ga0157379_10042296 | 3300014968 | Bacteria | 4067 |
| 101 | Ga0157379_10137131 | 3300014968 | Bacteria | 2205 |
| 102 | Ga0197907_10956094 | 3300020069 | Bacteria | 6253 |
| 103 | Ga0206356_10242923 | 3300020070 | Bacteria | 7947 |
| 104 | Ga0206349_1214642 | 3300020075 | Bacteria | 1910 |
| 105 | Ga0206349_1595098 | 3300020075 | Bacteria | 2562 |
| 106 | Ga0206352_10251955 | 3300020078 | Bacteria | 1395 |
| 107 | Ga0206352_10488303 | 3300020078 | Bacteria | 2758 |
| 108 | Ga0206350_10151149 | 3300020080 | Bacteria | 7562 |
| 109 | Ga0206354_10999462 | 3300020081 | Bacteria | 2095 |
| 110 | Ga0206353_10975235 | 3300020082 | Bacteria | 8938 |
| 111 | Ga0213876_10028408 | 3300021384 | Bacteria | 2949 |
| 112 | Ga0213875_10000355 | 3300021388 | Bacteria | 42949 |
| 113 | Ga0224712_10004485 | 3300022467 | Bacteria | 3775 |
| 114 | Ga0207653_10003602 | 3300025885 | Bacteria | 4879 |
| 115 | Ga0207692_10129496 | 3300025898 | Bacteria | 1423 |
| 116 | Ga0207685_10043583 | 3300025905 | Bacteria | 1692 |
| 117 | Ga0207699_10008276 | 3300025906 | Bacteria | 5124 |
| 118 | Ga0207699_10041973 | 3300025906 | Bacteria | 2646 |
| 119 | Ga0207705_10163396 | 3300025909 | Bacteria | 1674 |
| 120 | Ga0207707_10090852 | 3300025912 | Bacteria | 2668 |
| 121 | Ga0207707_10156853 | 3300025912 | Bacteria | 1991 |
| 122 | Ga0207671_10064790 | 3300025914 | Bacteria | 2717 |
| 123 | Ga0207663_10012338 | 3300025916 | Bacteria | 4618 |
| 124 | Ga0207663_10063837 | 3300025916 | Bacteria | 2347 |
| 125 | Ga0207660_10044086 | 3300025917 | Bacteria | 3137 |
| 126 | Ga0207657_10001414 | 3300025919 | Bacteria | 25603 |
| 127 | Ga0207646_10004017 | 3300025922 | Bacteria | 16278 |
| 128 | Ga0207646_10066396 | 3300025922 | Bacteria | 3220 |
| 129 | Ga0207650_10195155 | 3300025925 | Bacteria | 1619 |
| 130 | Ga0207687_10258803 | 3300025927 | Bacteria | 1387 |
| 131 | Ga0207700_10026414 | 3300025928 | Bacteria | 4047 |
| 132 | Ga0207700_10044125 | 3300025928 | Bacteria | 3280 |
| 133 | Ga0207700_10099841 | 3300025928 | Bacteria | 2312 |
| 134 | Ga0207700_10123422 | 3300025928 | Bacteria | 2103 |
| 135 | Ga0207664_10024381 | 3300025929 | Bacteria | 4546 |
| 136 | Ga0207664_10035617 | 3300025929 | Bacteria | 3842 |
| 137 | Ga0207690_10054863 | 3300025932 | Bacteria | 2681 |
| 138 | Ga0207706_10037991 | 3300025933 | Bacteria | 4272 |
| 139 | Ga0207691_10013032 | 3300025940 | Bacteria | 7962 |
| 140 | Ga0207711_10063791 | 3300025941 | Bacteria | 3181 |
| 141 | Ga0207711_10302965 | 3300025941 | Bacteria | 1474 |
| 142 | Ga0207689_10003526 | 3300025942 | Bacteria | 14297 |
| 143 | Ga0207689_10079577 | 3300025942 | Bacteria | 2693 |
| 144 | Ga0207658_10031417 | 3300025986 | Bacteria | 3770 |
| 145 | Ga0207678_10000633 | 3300026067 | Bacteria | 32241 |
| 146 | Ga0207678_10003290 | 3300026067 | Bacteria | 14573 |
| 147 | Ga0207708_10009590 | 3300026075 | Bacteria | 7177 |
| 148 | Ga0207702_10014395 | 3300026078 | Bacteria | 6567 |
| 149 | Ga0207702_10085675 | 3300026078 | Bacteria | 2746 |
| 150 | Ga0207641_10033529 | 3300026088 | Bacteria | 4265 |
| 151 | Ga0207641_10241440 | 3300026088 | Bacteria | 1683 |
| 152 | Ga0207648_10146081 | 3300026089 | Bacteria | 2086 |
| 153 | Ga0207676_10010939 | 3300026095 | Bacteria | 6476 |
| 154 | Ga0207674_10006592 | 3300026116 | Bacteria | 13649 |
| 155 | Ga0207674_10030561 | 3300026116 | Bacteria | 5661 |
| 156 | Ga0207674_10183562 | 3300026116 | Bacteria | 2043 |
| 157 | Ga0207683_10000499 | 3300026121 | Bacteria | 36301 |
| 158 | Ga0207428_10005256 | 3300027907 | Bacteria | 12096 |
| 159 | Ga0268266_10001638 | 3300028379 | Bacteria | 25983 |
| 160 | Ga0268266_10140325 | 3300028379 | Bacteria | 2168 |
| 161 | Ga0268264_10053677 | 3300028381 | Bacteria | 3363 |
| 162 | Ga0307515_10230240 | 3300028794 | Bacteria | 1647 |
| 163 | Ga0265338_10138887 | 3300028800 | Bacteria | 1906 |
| 164 | Ga0316177_1124226 | 3300030731 | Bacteria | 7063 |
| 165 | Ga0314311_1123364 | 3300030733 | Bacteria | 7417 |
| 166 | Ga0265340_10000764 | 3300031247 | Bacteria | 18295 |
| 167 | Ga0307408_100064108 | 3300031548 | Bacteria | 2690 |
| 168 | Ga0307508_10066279 | 3300031616 | Bacteria | 3180 |
| 169 | Ga0307405_10003637 | 3300031731 | Bacteria | 7135 |
| 170 | Ga0307405_10004371 | 3300031731 | Bacteria | 6670 |
| 171 | Ga0307405_10060282 | 3300031731 | Bacteria | 2394 |
| 172 | Ga0307413_10006245 | 3300031824 | Bacteria | 5412 |
| 173 | Ga0307413_10009393 | 3300031824 | Bacteria | 4677 |
| 174 | Ga0307413_10045867 | 3300031824 | Bacteria | 2595 |
| 175 | Ga0307410_10005446 | 3300031852 | Bacteria | 6740 |
| 176 | Ga0307410_10024696 | 3300031852 | Bacteria | 3758 |
| 177 | Ga0307410_10087619 | 3300031852 | Bacteria | 2202 |
| 178 | Ga0307410_10092867 | 3300031852 | Bacteria | 2146 |
| 179 | Ga0307406_10003033 | 3300031901 | Bacteria | 9139 |
| 180 | Ga0307406_10071180 | 3300031901 | Bacteria | 2279 |
| 181 | Ga0307407_10050315 | 3300031903 | Bacteria | 2383 |
| 182 | Ga0307409_100082727 | 3300031995 | Bacteria | 2600 |
| 183 | Ga0307409_100083500 | 3300031995 | Bacteria | 2590 |
| 184 | Ga0307409_100345601 | 3300031995 | Bacteria | 1402 |
| 185 | Ga0307416_100009741 | 3300032002 | Bacteria | 6310 |
| 186 | Ga0307416_100049048 | 3300032002 | Bacteria | 3354 |
| 187 | Ga0307416_100405617 | 3300032002 | Bacteria | 1402 |
| 188 | Ga0307414_10238675 | 3300032004 | Bacteria | 1503 |
| 189 | Ga0307411_10066789 | 3300032005 | Bacteria | 2417 |
| 190 | Ga0307415_100003973 | 3300032126 | Bacteria | 7611 |
| 191 | Ga0307415_100023040 | 3300032126 | Bacteria | 3856 |
| 192 | Ga0373930_0003319 | 3300034816 | Bacteria | 2544 |
| 193 | Ga0373948_0005057 | 3300034817 | Bacteria | 2116 |
| 194 | Ga0373926_0003865 | 3300035083 | Bacteria | 4890 |
| 195 | Ga0373934_0029889 | 3300035086 | Bacteria | 2130 |
| 196 | Ga0373949_0016016 | 3300035090 | Bacteria | 1679 |
| 197 | Ga0373932_0027803 | 3300035112 | Bacteria | 1550 |
| 198 | Ga0373936_0005951 | 3300035113 | Bacteria | 4592 |
| 199 | Ga0373945_0000141 | 3300035116 | Bacteria | 18173 |
| 200 | Ga0373943_0000354 | 3300035170 | Bacteria | 19381 |
| 201 | Ga0373946_0000081 | 3300035171 | Bacteria | 26158 |
| 202 | Ga0373955_0172518 | 3300035172 | Bacteria | 1281 |
| 203 | Ga0373962_0024608 | 3300035242 | Bacteria | 1612 |
| 204 | Ga0373935_0006311 | 3300035692 | Bacteria | 7064 |
| 205 | Ga0373927_0001862 | 3300035695 | Bacteria | 15630 |
| 206 | Ga0373927_0054208 | 3300035695 | Bacteria | 2594 |
| 207 | Ga0373947_0000683 | 3300035725 | Bacteria | 20184 |
| 208 | Ga0373937_0026448 | 3300036401 | Bacteria | 5244 |
| 209 | Ga0373937_0041662 | 3300036401 | Bacteria | 4188 |
| 210 | Ga0373937_0131249 | 3300036401 | Bacteria | 2340 |
| 211 | Ga0373925_0076560 | 3300037068 | Bacteria | 2537 |
| 212 | Ga0395900_0048931 | 3300037418 | Bacteria | 4354 |
| 213 | Ga0395898_0281557 | 3300037466 | Bacteria | 1586 |
| 214 | Ga0395905_0302161 | 3300037471 | Bacteria | 1488 |
| 215 | Ga0436364_0050479 | 3300037853 | Bacteria | 121594 |
| 216 | Ga0436364_1297258 | 3300037853 | Bacteria | 42934 |
| 217 | Ga0400485_22276 | 3300038735 | Bacteria | 21860 |
| 218 | Ga0400488_12363 | 3300038741 | Bacteria | 4563 |
| 219 | Ga0400486_08312 | 3300038742 | Bacteria | 2358 |
| 220 | Ga0436363_1698444 | 3300039450 | Bacteria | 4551 |
| 221 | Ga0451797_1393608 | 3300041453 | Bacteria | 1919 |
| 222 | Ga0439448_0005323 | 3300042005 | Bacteria | 3669 |
| 223 | Ga0466969_0065895 | 3300044656 | Bacteria | 1750 |
| 224 | Ga0466965_0015062 | 3300044683 | Bacteria | 3669 |
| 225 | Ga0466961_0046395 | 3300044693 | Bacteria | 2779 |
| 226 | Ga0466961_0182868 | 3300044693 | Bacteria | 1301 |
| 227 | Ga0466963_0001256 | 3300044694 | Bacteria | 13435 |
| 228 | Ga0466958_0008267 | 3300045836 | Bacteria | 5762 |
| 229 | Ga0466967_0000484 | 3300045976 | Bacteria | 19321 |
| 230 | Ga0466967_0127492 | 3300045976 | Bacteria | 2359 |
| 231 | Ga0495641_0010489 | 3300046461 | Bacteria | 5364 |
| 232 | Ga0495651_0023803 | 3300046462 | Bacteria | 4762 |
| 233 | Ga0495653_0003464 | 3300046463 | Bacteria | 12691 |
| 234 | Ga0495653_0010141 | 3300046463 | Bacteria | 7708 |
| 235 | Ga0495639_0037316 | 3300046475 | Bacteria | 2178 |
| 236 | Ga0495662_0026424 | 3300046476 | Bacteria | 2803 |
| 237 | Ga0495664_0002120 | 3300046477 | Bacteria | 10591 |
| 238 | Ga0495618_0032535 | 3300046514 | Bacteria | 3266 |
| 239 | Ga0495648_0001466 | 3300046524 | Bacteria | 23072 |
| 240 | Ga0495652_0116454 | 3300046529 | Bacteria | 2139 |
| 241 | Ga0495640_0023419 | 3300046533 | Bacteria | 4498 |
| 242 | Ga0495587_0017706 | 3300046536 | Bacteria | 4424 |
| 243 | Ga0495645_0081087 | 3300046543 | Bacteria | 2328 |
| 244 | Ga0495667_0013488 | 3300046559 | Bacteria | 5530 |
| 245 | Ga0495667_0018173 | 3300046559 | Bacteria | 4748 |
| 246 | Ga0495634_0062384 | 3300046642 | Bacteria | 2475 |
| 247 | Ga0495635_0001118 | 3300046663 | Bacteria | 17838 |
| 248 | Ga0495635_0049499 | 3300046663 | Bacteria | 2896 |
| 249 | Ga0495657_0013774 | 3300046675 | Bacteria | 5954 |
| 250 | Ga0495657_0019937 | 3300046675 | Bacteria | 4831 |
| 251 | Ga0495657_0159283 | 3300046675 | Bacteria | 1397 |
| 252 | Ga0495624_0002333 | 3300046690 | Bacteria | 14428 |
| 253 | Ga0495674_0001126 | 3300047319 | Bacteria | 25719 |
| 254 | Ga0495674_0281252 | 3300047319 | Bacteria | 1363 |
| 255 | Ga0495672_0046153 | 3300047320 | Bacteria | 2600 |
| 256 | Ga0495676_0010607 | 3300047321 | Bacteria | 8347 |
| 257 | Ga0495680_0006580 | 3300047322 | Bacteria | 10781 |
| 258 | Ga0495680_0010005 | 3300047322 | Bacteria | 8486 |
| 259 | Ga0495673_0002107 | 3300047469 | Bacteria | 14477 |
| 260 | Ga0495684_0004669 | 3300047471 | Bacteria | 10692 |
| 261 | Ga0495684_0053031 | 3300047471 | Bacteria | 3094 |
| 262 | Ga0495593_0019062 | 3300047673 | Bacteria | 3851 |
| 263 | Ga0495602_0152022 | 3300048088 | Bacteria | 1818 |
| 264 | Ga0496100_0244671 | 3300048903 | Bacteria | 1325 |
| 265 | Ga0496101_0036136 | 3300048904 | Bacteria | 3498 |
| 266 | Ga0496101_0251659 | 3300048904 | Bacteria | 1376 |
| 267 | Ga0496102_0007002 | 3300048905 | Bacteria | 9627 |
| 268 | Ga0496102_0060457 | 3300048905 | Bacteria | 3465 |
| 269 | Ga0496102_0156318 | 3300048905 | Bacteria | 2143 |
| 270 | Ga0496102_0158522 | 3300048905 | Bacteria | 2128 |
| 271 | Ga0496103_0088639 | 3300048906 | Bacteria | 1951 |
| 272 | Ga0496104_0002850 | 3300048907 | Bacteria | 14907 |
| 273 | Ga0496104_0107127 | 3300048907 | Bacteria | 2678 |
| 274 | Ga0496104_0459751 | 3300048907 | Bacteria | 1184 |
| 275 | Ga0496105_0010401 | 3300048908 | Bacteria | 7317 |
| 276 | Ga0496105_0019473 | 3300048908 | Bacteria | 5474 |
| 277 | Ga0496105_0231507 | 3300048908 | Bacteria | 1501 |
| 278 | Ga0496107_0014049 | 3300048910 | Bacteria | 5605 |
| 279 | Ga0496107_0045553 | 3300048910 | Bacteria | 3155 |
| 280 | Ga0496108_0033093 | 3300048911 | Bacteria | 4294 |
| 281 | Ga0496108_0058383 | 3300048911 | Bacteria | 3243 |
| 282 | Ga0496108_0064162 | 3300048911 | Bacteria | 3094 |
| 283 | Ga0496108_0086029 | 3300048911 | Bacteria | 2669 |
| 284 | Ga0496109_0002018 | 3300048912 | Bacteria | 16838 |
| 285 | Ga0496109_0024791 | 3300048912 | Bacteria | 5336 |
| 286 | Ga0496109_0063195 | 3300048912 | Bacteria | 3386 |
| 287 | Ga0496109_0092869 | 3300048912 | Bacteria | 2791 |
| 288 | Ga0496109_0257836 | 3300048912 | Bacteria | 1642 |
| 289 | Ga0496109_0266095 | 3300048912 | Bacteria | 1615 |
| 290 | Ga0496109_0333071 | 3300048912 | Bacteria | 1433 |
| 291 | Ga0496110_0030273 | 3300048913 | Bacteria | 4665 |
| 292 | Ga0496110_0077909 | 3300048913 | Bacteria | 2950 |
| 293 | Ga0496110_0175694 | 3300048913 | Bacteria | 1944 |
| 294 | Ga0496110_0200553 | 3300048913 | Bacteria | 1813 |
| 295 | Ga0496111_0017290 | 3300048914 | Bacteria | 4984 |
| 296 | Ga0496112_0073055 | 3300048915 | Bacteria | 3391 |
| 297 | Ga0496112_0149779 | 3300048915 | Bacteria | 2300 |
| 298 | Ga0496112_0227845 | 3300048915 | Bacteria | 1818 |
| 299 | Ga0496113_0001477 | 3300048916 | Bacteria | 13122 |
| 300 | Ga0496113_0099055 | 3300048916 | Bacteria | 2257 |
| 301 | Ga0496113_0153535 | 3300048916 | Bacteria | 1817 |
| 302 | Ga0496113_0194303 | 3300048916 | Bacteria | 1611 |
| 303 | Ga0496114_0003667 | 3300048917 | Bacteria | 11812 |
| 304 | Ga0496114_0006541 | 3300048917 | Bacteria | 9185 |
| 305 | Ga0496114_0031895 | 3300048917 | Bacteria | 4334 |
| 306 | Ga0496114_0037013 | 3300048917 | Bacteria | 4035 |
| 307 | Ga0496114_0056521 | 3300048917 | Bacteria | 3275 |
| 308 | Ga0496114_0078846 | 3300048917 | Bacteria | 2779 |
| 309 | Ga0496115_0003056 | 3300048918 | Bacteria | 12019 |
| 310 | Ga0496115_0014104 | 3300048918 | Bacteria | 6049 |
| 311 | Ga0496115_0122073 | 3300048918 | Bacteria | 2144 |
| 312 | Ga0496126_0014857 | 3300048929 | Bacteria | 7854 |
| 313 | Ga0496126_0113192 | 3300048929 | Bacteria | 2362 |
| 314 | Ga0501031_0002833 | 3300049568 | Bacteria | 11077 |
| 315 | Ga0501032_0007939 | 3300049569 | Bacteria | 7730 |
| 316 | Ga0501039_0206759 | 3300049575 | Bacteria | 1543 |
| 317 | Ga0501039_0236375 | 3300049575 | Bacteria | 1437 |
| 318 | Ga0501048_0119291 | 3300049582 | Bacteria | 1864 |
| 319 | Ga0501044_0019289 | 3300049823 | Bacteria | 7297 |
| 320 | nmdc:mga05p37_155_c1 | 3300050507 | Bacteria | 65410 |
| 321 | nmdc:mga05p37_162_c1 | 3300050507 | Bacteria | 64436 |
| 322 | nmdc:mga05p37_187926_c1 | 3300050507 | Bacteria | 2511 |
| 323 | nmdc:mga05p37_27682_c1 | 3300050507 | Bacteria | 6905 |
| 324 | nmdc:mga09592_13791_c1 | 3300050508 | Bacteria | 6603 |
| 325 | nmdc:mga09592_165_c1 | 3300050508 | Bacteria | 46519 |
| 326 | nmdc:mga09592_1_c1 | 3300050508 | Bacteria | 201102 |
| 327 | nmdc:mga09592_259829_c1 | 3300050508 | Bacteria | 1506 |
| 328 | nmdc:mga0qj67_12_c1 | 3300050509 | Bacteria | 76377 |
| 329 | nmdc:mga0qj67_4009_c1 | 3300050509 | Bacteria | 10666 |
| 330 | nmdc:mga0qj67_6234_c1 | 3300050509 | Bacteria | 8757 |
| 331 | nmdc:mga06r32_265_c1 | 3300050510 | Bacteria | 43312 |
| 332 | nmdc:mga06r32_60863_c1 | 3300050510 | Bacteria | 3634 |
| 333 | nmdc:mga06r32_7_c1 | 3300050510 | Bacteria | 117700 |
| 334 | nmdc:mga08y16_48907_c1 | 3300050511 | Bacteria | 4425 |
| 335 | nmdc:mga08y16_6387_c1 | 3300050511 | Bacteria | 12361 |
| 336 | nmdc:mga0n895_177473_c1 | 3300050512 | Bacteria | 2161 |
| 337 | nmdc:mga0n895_535637_c1 | 3300050512 | Bacteria | 1178 |
| 338 | Ga0495619_0007020 | 3300053085 | Bacteria | 7126 |
| 339 | Ga0495619_0012840 | 3300053085 | Bacteria | 5276 |
| 340 | Ga0500559_0001172 | 3300053136 | Bacteria | 15712 |
| 341 | Ga0500568_0044553 | 3300053139 | Bacteria | 1769 |
| 342 | Ga0500568_0049298 | 3300053139 | Bacteria | 1662 |
| 343 | Ga0587073_0015113 | 3300059492 | Bacteria | 1386 |
| 344 | Ga0587069_005919 | 3300059642 | Bacteria | 1447 |
| 345 | Ga0587107_002750 | 3300059652 | Bacteria | 1631 |
| 346 | Ga0587114_006142 | 3300059655 | Bacteria | 1332 |
| 347 | 2644503989 | 2643221690 | Bacteria | 4654705 |
| 348 | 2644526952 | 2643221694 | Bacteria | 4392972 |
| 349 | 2644670315 | 2643221722 | Bacteria | 4247614 |
| 350 | 2676495918 | 2675903060 | Bacteria | 10051191 |
| 351 | 2738695950 | 2738541272 | Bacteria | 6848551 |
| 352 | 2739324770 | 2738543027 | Bacteria | 6409078 |
| 353 | 2739605570 | 2739367654 | Bacteria | 6049412 |
| 354 | 2744954505 | 2744054611 | Bacteria | 5611514 |
| 355 | 2760307595 | 2758568522 | Bacteria | 5953541 |
| 356 | 2760623896 | 2758568621 | Bacteria | 5967089 |
| 357 | 2791909921 | 2791354901 | Bacteria | 8322202 |
| 358 | 2809028811 | 2808606394 | Bacteria | 6248540 |
| 359 | 2812332684 | 2811994874 | Bacteria | 5367947 |
| 360 | 2812365098 | 2811994880 | Bacteria | 4147780 |
| 361 | 2835189978 | 2835188231 | Bacteria | 3476928 |
| 362 | 2842889423 | 2842888712 | Bacteria | 4279094 |
| 363 | 2861523797 | 2861520306 | Bacteria | 8348283 |
| 364 | 2884995413 | 2884994152 | Bacteria | 4492978 |
| 365 | 2899370139 | 2899370129 | Bacteria | 6781179 |
| 366 | 2932431788 | 2932431166 | Bacteria | 4215299 |
| 367 | 2947225074 | 2947224130 | Bacteria | 9938529 |
| 368 | 2947232016 | 2947224130 | Bacteria | 9938529 |
| 369 | 2956940185 | 2956939328 | Bacteria | 3474458 |
| 370 | 2995464889 | 2995463766 | Bacteria | 8577691 |
| 371 | 3001121604 | 3001119090 | Bacteria | 3449530 |
| 372 | 8057572207 | 8057568493 | Bacteria | 7221719 |
| 373 | Ga0070713_100123648 | |||
| 374 | JGI25404J52841_10021788 | |||
| 375 | Ga0055540_1000036 | |||
| 376 | Ga0058861_10084976 | |||
| 377 | Ga0070658_10034957 | |||
| 378 | Ga0070683_100053738 | |||
| 379 | Ga0068869_100222424 | |||
| 380 | Ga0070660_100065849 | |||
| 381 | Ga0070689_100218492 | |||
| 382 | Ga0070689_100260892 | |||
| 383 | Ga0070661_100154029 | |||
| 384 | Ga0070668_100313417 | |||
| 385 | Ga0070671_100157610 | |||
| 386 | Ga0070659_100122225 | |||
| 387 | Ga0070667_100036552 | |||
| 388 | Ga0070709_10083066 | |||
| 389 | Ga0070714_100000517 | |||
| 390 | Ga0070714_100208733 | |||
| 391 | Ga0070713_100015009 | |||
| 392 | Ga0070713_100042593 | |||
| 393 | Ga0070713_100116815 | |||
| 394 | Ga0070713_100129277 | |||
| 395 | Ga0070713_100276982 | |||
| 396 | Ga0070710_10000444 | |||
| 397 | Ga0070701_10010524 | |||
| 398 | Ga0070711_100314540 | |||
| 399 | Ga0070708_100179403 | |||
| 400 | Ga0070663_100018047 | |||
| 401 | Ga0070678_100062081 | |||
| 402 | Ga0070707_100002906 | |||
| 403 | Ga0070707_100029155 | |||
| 404 | Ga0070679_100059537 | |||
| 405 | Ga0070679_100102226 | |||
| 406 | Ga0070684_100187307 | |||
| 407 | Ga0068853_100017341 | |||
| 408 | Ga0070672_100085161 | |||
| 409 | Ga0070686_100020393 | |||
| 410 | Ga0070696_100016950 | |||
| 411 | Ga0070665_100020680 | |||
| 412 | Ga0070665_100066196 | |||
| 413 | Ga0070664_100077315 | |||
| 414 | Ga0068854_100031089 | |||
| 415 | Ga0068856_100217958 | |||
| 416 | Ga0068864_100005166 | |||
| 417 | Ga0068851_10044040 | |||
| 418 | Ga0068870_10064331 | |||
| 419 | Ga0068863_100038071 | |||
| 420 | Ga0068863_100178168 | |||
| 421 | Ga0068858_100070428 | |||
| 422 | Ga0068858_100352132 | |||
| 423 | Ga0081455_10000462 | |||
| 424 | Ga0081455_10004460 | |||
| 425 | Ga0081455_10011037 | |||
| 426 | Ga0081540_1000004 | |||
| 427 | Ga0081540_1001276 | |||
| 428 | Ga0070717_10136274 | |||
| 429 | Ga0070717_10169689 | |||
| 430 | Ga0075365_10038886 | |||
| 431 | Ga0070716_100202519 | |||
| 432 | Ga0075428_100000304 | |||
| 433 | Ga0075428_100042741 | |||
| 434 | Ga0075428_100084398 | |||
| 435 | Ga0075430_100001144 | |||
| 436 | Ga0075430_100008725 | |||
| 437 | Ga0075430_100013369 | |||
| 438 | Ga0075431_100000395 | |||
| 439 | Ga0075429_100001175 | |||
| 440 | Ga0075429_100001187 | |||
| 441 | Ga0075429_100003147 | |||
| 442 | Ga0075429_100005345 | |||
| 443 | Ga0075429_100104512 | |||
| 444 | Ga0075436_100166541 | |||
| 445 | Ga0105250_10038602 | |||
| 446 | Ga0111539_10082436 | |||
| 447 | Ga0111539_10106491 | |||
| 448 | Ga0111539_10312198 | |||
| 449 | Ga0105245_10240415 | |||
| 450 | Ga0114129_10000016 | |||
| 451 | Ga0114129_10012574 | |||
| 452 | Ga0114129_10022485 | |||
| 453 | Ga0114129_10024763 | |||
| 454 | Ga0114129_10084379 | |||
| 455 | Ga0105242_10156762 | |||
| 456 | Ga0105248_10021311 | |||
| 457 | Ga0105248_10313898 | |||
| 458 | Ga0105238_10291501 | |||
| 459 | Ga0105249_10031594 | |||
| 460 | Ga0105246_10020701 | |||
| 461 | Ga0105246_10255402 | |||
| 462 | Ga0157373_10050967 | |||
| 463 | Ga0157371_10141269 | |||
| 464 | Ga0157370_10144341 | |||
| 465 | Ga0157369_10443413 | |||
| 466 | Ga0157374_10313087 | |||
| 467 | Ga0163162_10046027 | |||
| 468 | Ga0157372_10321480 | |||
| 469 | Ga0157375_10319799 | |||
| 470 | Ga0163163_10027325 | |||
| 471 | Ga0163163_10064414 | |||
| 472 | Ga0157379_10042296 | |||
| 473 | Ga0157379_10137131 | |||
| 474 | Ga0197907_10956094 | |||
| 475 | Ga0206356_10242923 | |||
| 476 | Ga0206349_1214642 | |||
| 477 | Ga0206349_1595098 | |||
| 478 | Ga0206352_10251955 | |||
| 479 | Ga0206352_10488303 | |||
| 480 | Ga0206350_10151149 | |||
| 481 | Ga0206354_10999462 | |||
| 482 | Ga0206353_10975235 | |||
| 483 | Ga0213876_10028408 | |||
| 484 | Ga0213875_10000355 | |||
| 485 | Ga0224712_10004485 | |||
| 486 | Ga0207653_10003602 | |||
| 487 | Ga0207692_10129496 | |||
| 488 | Ga0207685_10043583 | |||
| 489 | Ga0207699_10008276 | |||
| 490 | Ga0207699_10041973 | |||
| 491 | Ga0207705_10163396 | |||
| 492 | Ga0207707_10090852 | |||
| 493 | Ga0207707_10156853 | |||
| 494 | Ga0207671_10064790 | |||
| 495 | Ga0207663_10012338 | |||
| 496 | Ga0207663_10063837 | |||
| 497 | Ga0207660_10044086 | |||
| 498 | Ga0207657_10001414 | |||
| 499 | Ga0207646_10004017 | |||
| 500 | Ga0207646_10066396 | |||
| 501 | Ga0207650_10195155 | |||
| 502 | Ga0207687_10258803 | |||
| 503 | Ga0207700_10026414 | |||
| 504 | Ga0207700_10044125 | |||
| 505 | Ga0207700_10099841 | |||
| 506 | Ga0207700_10123422 | |||
| 507 | Ga0207664_10024381 | |||
| 508 | Ga0207664_10035617 | |||
| 509 | Ga0207690_10054863 | |||
| 510 | Ga0207706_10037991 | |||
| 511 | Ga0207691_10013032 | |||
| 512 | Ga0207711_10063791 | |||
| 513 | Ga0207711_10302965 | |||
| 514 | Ga0207689_10003526 | |||
| 515 | Ga0207689_10079577 | |||
| 516 | Ga0207658_10031417 | |||
| 517 | Ga0207678_10000633 | |||
| 518 | Ga0207678_10003290 | |||
| 519 | Ga0207708_10009590 | |||
| 520 | Ga0207702_10014395 | |||
| 521 | Ga0207702_10085675 | |||
| 522 | Ga0207641_10033529 | |||
| 523 | Ga0207641_10241440 | |||
| 524 | Ga0207648_10146081 | |||
| 525 | Ga0207676_10010939 | |||
| 526 | Ga0207674_10006592 | |||
| 527 | Ga0207674_10030561 | |||
| 528 | Ga0207674_10183562 | |||
| 529 | Ga0207683_10000499 | |||
| 530 | Ga0207428_10005256 | |||
| 531 | Ga0268266_10001638 | |||
| 532 | Ga0268266_10140325 | |||
| 533 | Ga0268264_10053677 | |||
| 534 | Ga0307515_10230240 | |||
| 535 | Ga0265338_10138887 | |||
| 536 | Ga0316177_1124226 | |||
| 537 | Ga0314311_1123364 | |||
| 538 | Ga0265340_10000764 | |||
| 539 | Ga0307408_100064108 | |||
| 540 | Ga0307508_10066279 | |||
| 541 | Ga0307405_10003637 | |||
| 542 | Ga0307405_10004371 | |||
| 543 | Ga0307405_10060282 | |||
| 544 | Ga0307413_10006245 | |||
| 545 | Ga0307413_10009393 | |||
| 546 | Ga0307413_10045867 | |||
| 547 | Ga0307410_10005446 | |||
| 548 | Ga0307410_10024696 | |||
| 549 | Ga0307410_10087619 | |||
| 550 | Ga0307410_10092867 | |||
| 551 | Ga0307406_10003033 | |||
| 552 | Ga0307406_10071180 | |||
| 553 | Ga0307407_10050315 | |||
| 554 | Ga0307409_100082727 | |||
| 555 | Ga0307409_100083500 | |||
| 556 | Ga0307409_100345601 | |||
| 557 | Ga0307416_100009741 | |||
| 558 | Ga0307416_100049048 | |||
| 559 | Ga0307416_100405617 | |||
| 560 | Ga0307414_10238675 | |||
| 561 | Ga0307411_10066789 | |||
| 562 | Ga0307415_100003973 | |||
| 563 | Ga0307415_100023040 | |||
| 564 | Ga0373930_0003319 | |||
| 565 | Ga0373948_0005057 | |||
| 566 | Ga0373926_0003865 | |||
| 567 | Ga0373934_0029889 | |||
| 568 | Ga0373949_0016016 | |||
| 569 | Ga0373932_0027803 | |||
| 570 | Ga0373936_0005951 | |||
| 571 | Ga0373945_0000141 | |||
| 572 | Ga0373943_0000354 | |||
| 573 | Ga0373946_0000081 | |||
| 574 | Ga0373955_0172518 | |||
| 575 | Ga0373962_0024608 | |||
| 576 | Ga0373935_0006311 | |||
| 577 | Ga0373927_0001862 | |||
| 578 | Ga0373927_0054208 | |||
| 579 | Ga0373947_0000683 | |||
| 580 | Ga0373937_0026448 | |||
| 581 | Ga0373937_0041662 | |||
| 582 | Ga0373937_0131249 | |||
| 583 | Ga0373925_0076560 | |||
| 584 | Ga0395900_0048931 | |||
| 585 | Ga0395898_0281557 | |||
| 586 | Ga0395905_0302161 | |||
| 587 | Ga0436364_0050479 | |||
| 588 | Ga0436364_1297258 | |||
| 589 | Ga0400485_22276 | |||
| 590 | Ga0400488_12363 | |||
| 591 | Ga0400486_08312 | |||
| 592 | Ga0436363_1698444 | |||
| 593 | Ga0451797_1393608 | |||
| 594 | Ga0439448_0005323 | |||
| 595 | Ga0466969_0065895 | |||
| 596 | Ga0466965_0015062 | |||
| 597 | Ga0466961_0046395 | |||
| 598 | Ga0466961_0182868 | |||
| 599 | Ga0466963_0001256 | |||
| 600 | Ga0466958_0008267 | |||
| 601 | Ga0466967_0000484 | |||
| 602 | Ga0466967_0127492 | |||
| 603 | Ga0495641_0010489 | |||
| 604 | Ga0495651_0023803 | |||
| 605 | Ga0495653_0003464 | |||
| 606 | Ga0495653_0010141 | |||
| 607 | Ga0495639_0037316 | |||
| 608 | Ga0495662_0026424 | |||
| 609 | Ga0495664_0002120 | |||
| 610 | Ga0495618_0032535 | |||
| 611 | Ga0495648_0001466 | |||
| 612 | Ga0495652_0116454 | |||
| 613 | Ga0495640_0023419 | |||
| 614 | Ga0495587_0017706 | |||
| 615 | Ga0495645_0081087 | |||
| 616 | Ga0495667_0013488 | |||
| 617 | Ga0495667_0018173 | |||
| 618 | Ga0495634_0062384 | |||
| 619 | Ga0495635_0001118 | |||
| 620 | Ga0495635_0049499 | |||
| 621 | Ga0495657_0013774 | |||
| 622 | Ga0495657_0019937 | |||
| 623 | Ga0495657_0159283 | |||
| 624 | Ga0495624_0002333 | |||
| 625 | Ga0495674_0001126 | |||
| 626 | Ga0495674_0281252 | |||
| 627 | Ga0495672_0046153 | |||
| 628 | Ga0495676_0010607 | |||
| 629 | Ga0495680_0006580 | |||
| 630 | Ga0495680_0010005 | |||
| 631 | Ga0495673_0002107 | |||
| 632 | Ga0495684_0004669 | |||
| 633 | Ga0495684_0053031 | |||
| 634 | Ga0495593_0019062 | |||
| 635 | Ga0495602_0152022 | |||
| 636 | Ga0496100_0244671 | |||
| 637 | Ga0496101_0036136 | |||
| 638 | Ga0496101_0251659 | |||
| 639 | Ga0496102_0007002 | |||
| 640 | Ga0496102_0060457 | |||
| 641 | Ga0496102_0156318 | |||
| 642 | Ga0496102_0158522 | |||
| 643 | Ga0496103_0088639 | |||
| 644 | Ga0496104_0002850 | |||
| 645 | Ga0496104_0107127 | |||
| 646 | Ga0496104_0459751 | |||
| 647 | Ga0496105_0010401 | |||
| 648 | Ga0496105_0019473 | |||
| 649 | Ga0496105_0231507 | |||
| 650 | Ga0496107_0014049 | |||
| 651 | Ga0496107_0045553 | |||
| 652 | Ga0496108_0033093 | |||
| 653 | Ga0496108_0058383 | |||
| 654 | Ga0496108_0064162 | |||
| 655 | Ga0496108_0086029 | |||
| 656 | Ga0496109_0002018 | |||
| 657 | Ga0496109_0024791 | |||
| 658 | Ga0496109_0063195 | |||
| 659 | Ga0496109_0092869 | |||
| 660 | Ga0496109_0257836 | |||
| 661 | Ga0496109_0266095 | |||
| 662 | Ga0496109_0333071 | |||
| 663 | Ga0496110_0030273 | |||
| 664 | Ga0496110_0077909 | |||
| 665 | Ga0496110_0175694 | |||
| 666 | Ga0496110_0200553 | |||
| 667 | Ga0496111_0017290 | |||
| 668 | Ga0496112_0073055 | |||
| 669 | Ga0496112_0149779 | |||
| 670 | Ga0496112_0227845 | |||
| 671 | Ga0496113_0001477 | |||
| 672 | Ga0496113_0099055 | |||
| 673 | Ga0496113_0153535 | |||
| 674 | Ga0496113_0194303 | |||
| 675 | Ga0496114_0003667 | |||
| 676 | Ga0496114_0006541 | |||
| 677 | Ga0496114_0031895 | |||
| 678 | Ga0496114_0037013 | |||
| 679 | Ga0496114_0056521 | |||
| 680 | Ga0496114_0078846 | |||
| 681 | Ga0496115_0003056 | |||
| 682 | Ga0496115_0014104 | |||
| 683 | Ga0496115_0122073 | |||
| 684 | Ga0496126_0014857 | |||
| 685 | Ga0496126_0113192 | |||
| 686 | Ga0501031_0002833 | |||
| 687 | Ga0501032_0007939 | |||
| 688 | Ga0501039_0206759 | |||
| 689 | Ga0501039_0236375 | |||
| 690 | Ga0501048_0119291 | |||
| 691 | Ga0501044_0019289 | |||
| 692 | nmdc:mga05p37_155_c1 | |||
| 693 | nmdc:mga05p37_162_c1 | |||
| 694 | nmdc:mga05p37_187926_c1 | |||
| 695 | nmdc:mga05p37_27682_c1 | |||
| 696 | nmdc:mga09592_13791_c1 | |||
| 697 | nmdc:mga09592_165_c1 | |||
| 698 | nmdc:mga09592_1_c1 | |||
| 699 | nmdc:mga09592_259829_c1 | |||
| 700 | nmdc:mga0qj67_12_c1 | |||
| 701 | nmdc:mga0qj67_4009_c1 | |||
| 702 | nmdc:mga0qj67_6234_c1 | |||
| 703 | nmdc:mga06r32_265_c1 | |||
| 704 | nmdc:mga06r32_60863_c1 | |||
| 705 | nmdc:mga06r32_7_c1 | |||
| 706 | nmdc:mga08y16_48907_c1 | |||
| 707 | nmdc:mga08y16_6387_c1 | |||
| 708 | nmdc:mga0n895_177473_c1 | |||
| 709 | nmdc:mga0n895_535637_c1 | |||
| 710 | Ga0495619_0007020 | |||
| 711 | Ga0495619_0012840 | |||
| 712 | Ga0500559_0001172 | |||
| 713 | Ga0500568_0044553 | |||
| 714 | Ga0500568_0049298 | |||
| 715 | Ga0587073_0015113 | |||
| 716 | Ga0587069_005919 | |||
| 717 | Ga0587107_002750 | |||
| 718 | Ga0587114_006142 | |||
| 719 | 2644503989 | |||
| 720 | 2644526952 | |||
| 721 | 2644670315 | |||
| 722 | 2676495918 | |||
| 723 | 2738695950 | |||
| 724 | 2739324770 | |||
| 725 | 2739605570 | |||
| 726 | 2744954505 | |||
| 727 | 2760307595 | |||
| 728 | 2760623896 | |||
| 729 | 2791909921 | |||
| 730 | 2809028811 | |||
| 731 | 2812332684 | |||
| 732 | 2812365098 | |||
| 733 | 2835189978 | |||
| 734 | 2842889423 | |||
| 735 | 2861523797 | |||
| 736 | 2884995413 | |||
| 737 | 2899370139 | |||
| 738 | 2932431788 | |||
| 739 | 2947225074 | |||
| 740 | 2947232016 | |||
| 741 | 2956940185 | |||
| 742 | 2995464889 | |||
| 743 | 3001121604 | |||
| 744 | 8057572207 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oey-assembly1.cif.gz_B | neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution | 0.969 | 4 | 358 |
| 7bbw-assembly2.cif.gz_B | neisseria gonorrhoeae transaldolase, variant c38s | 0.9669 | 5 | 358 |
| 7bbx-assembly1.cif.gz_A | neisseria gonorrhoeae transaldolase, variant k8a | 0.9655 | 4 | 358 |
| 7odq-assembly1.cif.gz_A | neisseria gonorrhoeae transaldolase at 5.4 mgy dose | 0.9646 | 4 | 358 |
| 3r5e-assembly1.cif.gz_A | transaldolase from corynebacterium glutamicum | 0.9632 | 1 | 362 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FRC9_66_421_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.968 | 5 | 361 | 3.20.20.70 |
| 3r5eA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9632 | 1 | 362 | 3.20.20.70 |
| 3clmA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.961 | 2 | 358 | 3.20.20.70 |
| af_I1JM01_1_306_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9607 | 65 | 361 | 3.20.20.70 |
| 3r5eA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9579 | 1 | 362 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3XGD8-F1-model_v4 | transaldolase (EC 2.2.1.2) | 1.003 | 93 | 171 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A2W6E122-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 0.9988 | 160 | 366 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A2S9G7Y1-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 0.9987 | 78 | 157 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-E2FSJ1-F1-model_v4 | Putative transaldolase | 0.9983 | 84 | 176 |
GO:0004801
GO:0005737 GO:0005975 GO:0006098 |
| AF-A0A4Y8YCC9-F1-model_v4 | deleted | 0.9979 | 113 | 233 |
|