F425967

General Info

Members Datasets Scaffolds Average Seq Length
372 243 744 370

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100123648|Ga0070713_1001236481
Length 411
Sequence MSQALRDLAAAGVAVWLDDLSRPRIRSGDLARSVERGEIVGITTNPTIFAKAIGAGSGYEDQVRDLALRGTAIGETLRLLTAWDVRAACDVLRPVFDRSGRRDGRVSIEVDPRLARDGDRTAAEARGLWWLVDRPNLFIKIPATLAGLPAITASVADGISVNVTLIFSVSRYEAVLDAYMAGLERRTARGDGLEGIESVASFFVSRVDTEVDRRLADIADRSGDEAVSAAAERLRGQAALANCRLAYRHYERVLASDRWKALAAKGARMQRLLWASTGVKDERFEDTRYVVELVAPDTVNTMPEATLRAVADHGEVRGDTIRGGYEEAQAVVDGLANLGVDLADVADGLEAQGIASFAASWDELIASVTRRVEQAGATVMPAGAVTPASGEGGQAAAPAXXAPRGTAGKAA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
113 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
128 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
149 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
150 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
220 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
221 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
222 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
223 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
224 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
225 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
226 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
227 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
228 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
229 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
230 2808606394 Promicromonospora sp. C35 Isolate Unclassified
231 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
232 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
233 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
234 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
235 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
236 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
237 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
238 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
239 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
240 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
241 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
242 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
243 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.98
Metatranscriptomes 4.03
Isolates 6.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 13.17
Rhizosphere 77.96
Stem 0
Stem Tuber 0.27
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100123648 3300005436 Bacteria 2272
2 JGI25404J52841_10021788 3300003659 Bacteria 1387
3 Ga0055540_1000036 3300003792 Bacteria 164285
4 Ga0058861_10084976 3300004800 Bacteria 1605
5 Ga0070658_10034957 3300005327 Bacteria 4046
6 Ga0070683_100053738 3300005329 Bacteria 3733
7 Ga0068869_100222424 3300005334 Bacteria 1497
8 Ga0070660_100065849 3300005339 Bacteria 2820
9 Ga0070689_100218492 3300005340 Bacteria 1562
10 Ga0070689_100260892 3300005340 Bacteria 1432
11 Ga0070661_100154029 3300005344 Bacteria 1738
12 Ga0070668_100313417 3300005347 Bacteria 1319
13 Ga0070671_100157610 3300005355 Bacteria 1918
14 Ga0070659_100122225 3300005366 Bacteria 2110
15 Ga0070667_100036552 3300005367 Bacteria 4117
16 Ga0070709_10083066 3300005434 Bacteria 2094
17 Ga0070714_100000517 3300005435 Bacteria 27999
18 Ga0070714_100208733 3300005435 Bacteria 1789
19 Ga0070713_100015009 3300005436 Bacteria 5771
20 Ga0070713_100042593 3300005436 Bacteria 3707
21 Ga0070713_100116815 3300005436 Bacteria 2334
22 Ga0070713_100129277 3300005436 Bacteria 2225
23 Ga0070713_100276982 3300005436 Bacteria 1538
24 Ga0070710_10000444 3300005437 Bacteria 19478
25 Ga0070701_10010524 3300005438 Bacteria 4093
26 Ga0070711_100314540 3300005439 Bacteria 1249
27 Ga0070708_100179403 3300005445 Bacteria 1979
28 Ga0070663_100018047 3300005455 Bacteria 4617
29 Ga0070678_100062081 3300005456 Bacteria 2757
30 Ga0070707_100002906 3300005468 Bacteria 16267
31 Ga0070707_100029155 3300005468 Bacteria 5254
32 Ga0070679_100059537 3300005530 Bacteria 3807
33 Ga0070679_100102226 3300005530 Bacteria 2852
34 Ga0070684_100187307 3300005535 Bacteria 1882
35 Ga0068853_100017341 3300005539 Bacteria 5945
36 Ga0070672_100085161 3300005543 Bacteria 2540
37 Ga0070686_100020393 3300005544 Bacteria 3921
38 Ga0070696_100016950 3300005546 Bacteria 4913
39 Ga0070665_100020680 3300005548 Bacteria 6612
40 Ga0070665_100066196 3300005548 Bacteria 3624
41 Ga0070664_100077315 3300005564 Bacteria 2861
42 Ga0068854_100031089 3300005578 Bacteria 3708
43 Ga0068856_100217958 3300005614 Bacteria 1923
44 Ga0068864_100005166 3300005618 Bacteria 10690
45 Ga0068851_10044040 3300005834 Bacteria 2251
46 Ga0068870_10064331 3300005840 Bacteria 1981
47 Ga0068863_100038071 3300005841 Bacteria 4577
48 Ga0068863_100178168 3300005841 Bacteria 2040
49 Ga0068858_100070428 3300005842 Bacteria 3242
50 Ga0068858_100352132 3300005842 Bacteria 1410
51 Ga0081455_10000462 3300005937 Bacteria 53037
52 Ga0081455_10004460 3300005937 Bacteria 15688
53 Ga0081455_10011037 3300005937 Bacteria 9098
54 Ga0081540_1000004 3300005983 Bacteria 231552
55 Ga0081540_1001276 3300005983 Bacteria 21966
56 Ga0070717_10136274 3300006028 Bacteria 2114
57 Ga0070717_10169689 3300006028 Bacteria 1897
58 Ga0075365_10038886 3300006038 Bacteria 3095
59 Ga0070716_100202519 3300006173 Bacteria 1320
60 Ga0075428_100000304 3300006844 Bacteria 48365
61 Ga0075428_100042741 3300006844 Bacteria 4982
62 Ga0075428_100084398 3300006844 Bacteria 3466
63 Ga0075430_100001144 3300006846 Bacteria 21152
64 Ga0075430_100008725 3300006846 Bacteria 8556
65 Ga0075430_100013369 3300006846 Bacteria 6994
66 Ga0075431_100000395 3300006847 Bacteria 35082
67 Ga0075429_100001175 3300006880 Bacteria 21152
68 Ga0075429_100001187 3300006880 Bacteria 21049
69 Ga0075429_100003147 3300006880 Bacteria 14017
70 Ga0075429_100005345 3300006880 Bacteria 11046
71 Ga0075429_100104512 3300006880 Bacteria 2474
72 Ga0075436_100166541 3300006914 Bacteria 1555
73 Ga0105250_10038602 3300009092 Bacteria 1915
74 Ga0111539_10082436 3300009094 Bacteria 3783
75 Ga0111539_10106491 3300009094 Bacteria 3289
76 Ga0111539_10312198 3300009094 Bacteria 1830
77 Ga0105245_10240415 3300009098 Bacteria 1755
78 Ga0114129_10000016 3300009147 Bacteria 127415
79 Ga0114129_10012574 3300009147 Bacteria 12052
80 Ga0114129_10022485 3300009147 Bacteria 8949
81 Ga0114129_10024763 3300009147 Bacteria 8508
82 Ga0114129_10084379 3300009147 Bacteria 4410
83 Ga0105242_10156762 3300009176 Bacteria 1989
84 Ga0105248_10021311 3300009177 Bacteria 7182
85 Ga0105248_10313898 3300009177 Bacteria 1765
86 Ga0105238_10291501 3300009551 Bacteria 1614
87 Ga0105249_10031594 3300009553 Bacteria 4789
88 Ga0105246_10020701 3300011119 Bacteria 4223
89 Ga0105246_10255402 3300011119 Bacteria 1393
90 Ga0157373_10050967 3300013100 Bacteria 2948
91 Ga0157371_10141269 3300013102 Bacteria 1715
92 Ga0157370_10144341 3300013104 Bacteria 2217
93 Ga0157369_10443413 3300013105 Bacteria 1344
94 Ga0157374_10313087 3300013296 Bacteria 1554
95 Ga0163162_10046027 3300013306 Bacteria 4373
96 Ga0157372_10321480 3300013307 Bacteria 1802
97 Ga0157375_10319799 3300013308 Bacteria 1716
98 Ga0163163_10027325 3300014325 Bacteria 5465
99 Ga0163163_10064414 3300014325 Bacteria 3637
100 Ga0157379_10042296 3300014968 Bacteria 4067
101 Ga0157379_10137131 3300014968 Bacteria 2205
102 Ga0197907_10956094 3300020069 Bacteria 6253
103 Ga0206356_10242923 3300020070 Bacteria 7947
104 Ga0206349_1214642 3300020075 Bacteria 1910
105 Ga0206349_1595098 3300020075 Bacteria 2562
106 Ga0206352_10251955 3300020078 Bacteria 1395
107 Ga0206352_10488303 3300020078 Bacteria 2758
108 Ga0206350_10151149 3300020080 Bacteria 7562
109 Ga0206354_10999462 3300020081 Bacteria 2095
110 Ga0206353_10975235 3300020082 Bacteria 8938
111 Ga0213876_10028408 3300021384 Bacteria 2949
112 Ga0213875_10000355 3300021388 Bacteria 42949
113 Ga0224712_10004485 3300022467 Bacteria 3775
114 Ga0207653_10003602 3300025885 Bacteria 4879
115 Ga0207692_10129496 3300025898 Bacteria 1423
116 Ga0207685_10043583 3300025905 Bacteria 1692
117 Ga0207699_10008276 3300025906 Bacteria 5124
118 Ga0207699_10041973 3300025906 Bacteria 2646
119 Ga0207705_10163396 3300025909 Bacteria 1674
120 Ga0207707_10090852 3300025912 Bacteria 2668
121 Ga0207707_10156853 3300025912 Bacteria 1991
122 Ga0207671_10064790 3300025914 Bacteria 2717
123 Ga0207663_10012338 3300025916 Bacteria 4618
124 Ga0207663_10063837 3300025916 Bacteria 2347
125 Ga0207660_10044086 3300025917 Bacteria 3137
126 Ga0207657_10001414 3300025919 Bacteria 25603
127 Ga0207646_10004017 3300025922 Bacteria 16278
128 Ga0207646_10066396 3300025922 Bacteria 3220
129 Ga0207650_10195155 3300025925 Bacteria 1619
130 Ga0207687_10258803 3300025927 Bacteria 1387
131 Ga0207700_10026414 3300025928 Bacteria 4047
132 Ga0207700_10044125 3300025928 Bacteria 3280
133 Ga0207700_10099841 3300025928 Bacteria 2312
134 Ga0207700_10123422 3300025928 Bacteria 2103
135 Ga0207664_10024381 3300025929 Bacteria 4546
136 Ga0207664_10035617 3300025929 Bacteria 3842
137 Ga0207690_10054863 3300025932 Bacteria 2681
138 Ga0207706_10037991 3300025933 Bacteria 4272
139 Ga0207691_10013032 3300025940 Bacteria 7962
140 Ga0207711_10063791 3300025941 Bacteria 3181
141 Ga0207711_10302965 3300025941 Bacteria 1474
142 Ga0207689_10003526 3300025942 Bacteria 14297
143 Ga0207689_10079577 3300025942 Bacteria 2693
144 Ga0207658_10031417 3300025986 Bacteria 3770
145 Ga0207678_10000633 3300026067 Bacteria 32241
146 Ga0207678_10003290 3300026067 Bacteria 14573
147 Ga0207708_10009590 3300026075 Bacteria 7177
148 Ga0207702_10014395 3300026078 Bacteria 6567
149 Ga0207702_10085675 3300026078 Bacteria 2746
150 Ga0207641_10033529 3300026088 Bacteria 4265
151 Ga0207641_10241440 3300026088 Bacteria 1683
152 Ga0207648_10146081 3300026089 Bacteria 2086
153 Ga0207676_10010939 3300026095 Bacteria 6476
154 Ga0207674_10006592 3300026116 Bacteria 13649
155 Ga0207674_10030561 3300026116 Bacteria 5661
156 Ga0207674_10183562 3300026116 Bacteria 2043
157 Ga0207683_10000499 3300026121 Bacteria 36301
158 Ga0207428_10005256 3300027907 Bacteria 12096
159 Ga0268266_10001638 3300028379 Bacteria 25983
160 Ga0268266_10140325 3300028379 Bacteria 2168
161 Ga0268264_10053677 3300028381 Bacteria 3363
162 Ga0307515_10230240 3300028794 Bacteria 1647
163 Ga0265338_10138887 3300028800 Bacteria 1906
164 Ga0316177_1124226 3300030731 Bacteria 7063
165 Ga0314311_1123364 3300030733 Bacteria 7417
166 Ga0265340_10000764 3300031247 Bacteria 18295
167 Ga0307408_100064108 3300031548 Bacteria 2690
168 Ga0307508_10066279 3300031616 Bacteria 3180
169 Ga0307405_10003637 3300031731 Bacteria 7135
170 Ga0307405_10004371 3300031731 Bacteria 6670
171 Ga0307405_10060282 3300031731 Bacteria 2394
172 Ga0307413_10006245 3300031824 Bacteria 5412
173 Ga0307413_10009393 3300031824 Bacteria 4677
174 Ga0307413_10045867 3300031824 Bacteria 2595
175 Ga0307410_10005446 3300031852 Bacteria 6740
176 Ga0307410_10024696 3300031852 Bacteria 3758
177 Ga0307410_10087619 3300031852 Bacteria 2202
178 Ga0307410_10092867 3300031852 Bacteria 2146
179 Ga0307406_10003033 3300031901 Bacteria 9139
180 Ga0307406_10071180 3300031901 Bacteria 2279
181 Ga0307407_10050315 3300031903 Bacteria 2383
182 Ga0307409_100082727 3300031995 Bacteria 2600
183 Ga0307409_100083500 3300031995 Bacteria 2590
184 Ga0307409_100345601 3300031995 Bacteria 1402
185 Ga0307416_100009741 3300032002 Bacteria 6310
186 Ga0307416_100049048 3300032002 Bacteria 3354
187 Ga0307416_100405617 3300032002 Bacteria 1402
188 Ga0307414_10238675 3300032004 Bacteria 1503
189 Ga0307411_10066789 3300032005 Bacteria 2417
190 Ga0307415_100003973 3300032126 Bacteria 7611
191 Ga0307415_100023040 3300032126 Bacteria 3856
192 Ga0373930_0003319 3300034816 Bacteria 2544
193 Ga0373948_0005057 3300034817 Bacteria 2116
194 Ga0373926_0003865 3300035083 Bacteria 4890
195 Ga0373934_0029889 3300035086 Bacteria 2130
196 Ga0373949_0016016 3300035090 Bacteria 1679
197 Ga0373932_0027803 3300035112 Bacteria 1550
198 Ga0373936_0005951 3300035113 Bacteria 4592
199 Ga0373945_0000141 3300035116 Bacteria 18173
200 Ga0373943_0000354 3300035170 Bacteria 19381
201 Ga0373946_0000081 3300035171 Bacteria 26158
202 Ga0373955_0172518 3300035172 Bacteria 1281
203 Ga0373962_0024608 3300035242 Bacteria 1612
204 Ga0373935_0006311 3300035692 Bacteria 7064
205 Ga0373927_0001862 3300035695 Bacteria 15630
206 Ga0373927_0054208 3300035695 Bacteria 2594
207 Ga0373947_0000683 3300035725 Bacteria 20184
208 Ga0373937_0026448 3300036401 Bacteria 5244
209 Ga0373937_0041662 3300036401 Bacteria 4188
210 Ga0373937_0131249 3300036401 Bacteria 2340
211 Ga0373925_0076560 3300037068 Bacteria 2537
212 Ga0395900_0048931 3300037418 Bacteria 4354
213 Ga0395898_0281557 3300037466 Bacteria 1586
214 Ga0395905_0302161 3300037471 Bacteria 1488
215 Ga0436364_0050479 3300037853 Bacteria 121594
216 Ga0436364_1297258 3300037853 Bacteria 42934
217 Ga0400485_22276 3300038735 Bacteria 21860
218 Ga0400488_12363 3300038741 Bacteria 4563
219 Ga0400486_08312 3300038742 Bacteria 2358
220 Ga0436363_1698444 3300039450 Bacteria 4551
221 Ga0451797_1393608 3300041453 Bacteria 1919
222 Ga0439448_0005323 3300042005 Bacteria 3669
223 Ga0466969_0065895 3300044656 Bacteria 1750
224 Ga0466965_0015062 3300044683 Bacteria 3669
225 Ga0466961_0046395 3300044693 Bacteria 2779
226 Ga0466961_0182868 3300044693 Bacteria 1301
227 Ga0466963_0001256 3300044694 Bacteria 13435
228 Ga0466958_0008267 3300045836 Bacteria 5762
229 Ga0466967_0000484 3300045976 Bacteria 19321
230 Ga0466967_0127492 3300045976 Bacteria 2359
231 Ga0495641_0010489 3300046461 Bacteria 5364
232 Ga0495651_0023803 3300046462 Bacteria 4762
233 Ga0495653_0003464 3300046463 Bacteria 12691
234 Ga0495653_0010141 3300046463 Bacteria 7708
235 Ga0495639_0037316 3300046475 Bacteria 2178
236 Ga0495662_0026424 3300046476 Bacteria 2803
237 Ga0495664_0002120 3300046477 Bacteria 10591
238 Ga0495618_0032535 3300046514 Bacteria 3266
239 Ga0495648_0001466 3300046524 Bacteria 23072
240 Ga0495652_0116454 3300046529 Bacteria 2139
241 Ga0495640_0023419 3300046533 Bacteria 4498
242 Ga0495587_0017706 3300046536 Bacteria 4424
243 Ga0495645_0081087 3300046543 Bacteria 2328
244 Ga0495667_0013488 3300046559 Bacteria 5530
245 Ga0495667_0018173 3300046559 Bacteria 4748
246 Ga0495634_0062384 3300046642 Bacteria 2475
247 Ga0495635_0001118 3300046663 Bacteria 17838
248 Ga0495635_0049499 3300046663 Bacteria 2896
249 Ga0495657_0013774 3300046675 Bacteria 5954
250 Ga0495657_0019937 3300046675 Bacteria 4831
251 Ga0495657_0159283 3300046675 Bacteria 1397
252 Ga0495624_0002333 3300046690 Bacteria 14428
253 Ga0495674_0001126 3300047319 Bacteria 25719
254 Ga0495674_0281252 3300047319 Bacteria 1363
255 Ga0495672_0046153 3300047320 Bacteria 2600
256 Ga0495676_0010607 3300047321 Bacteria 8347
257 Ga0495680_0006580 3300047322 Bacteria 10781
258 Ga0495680_0010005 3300047322 Bacteria 8486
259 Ga0495673_0002107 3300047469 Bacteria 14477
260 Ga0495684_0004669 3300047471 Bacteria 10692
261 Ga0495684_0053031 3300047471 Bacteria 3094
262 Ga0495593_0019062 3300047673 Bacteria 3851
263 Ga0495602_0152022 3300048088 Bacteria 1818
264 Ga0496100_0244671 3300048903 Bacteria 1325
265 Ga0496101_0036136 3300048904 Bacteria 3498
266 Ga0496101_0251659 3300048904 Bacteria 1376
267 Ga0496102_0007002 3300048905 Bacteria 9627
268 Ga0496102_0060457 3300048905 Bacteria 3465
269 Ga0496102_0156318 3300048905 Bacteria 2143
270 Ga0496102_0158522 3300048905 Bacteria 2128
271 Ga0496103_0088639 3300048906 Bacteria 1951
272 Ga0496104_0002850 3300048907 Bacteria 14907
273 Ga0496104_0107127 3300048907 Bacteria 2678
274 Ga0496104_0459751 3300048907 Bacteria 1184
275 Ga0496105_0010401 3300048908 Bacteria 7317
276 Ga0496105_0019473 3300048908 Bacteria 5474
277 Ga0496105_0231507 3300048908 Bacteria 1501
278 Ga0496107_0014049 3300048910 Bacteria 5605
279 Ga0496107_0045553 3300048910 Bacteria 3155
280 Ga0496108_0033093 3300048911 Bacteria 4294
281 Ga0496108_0058383 3300048911 Bacteria 3243
282 Ga0496108_0064162 3300048911 Bacteria 3094
283 Ga0496108_0086029 3300048911 Bacteria 2669
284 Ga0496109_0002018 3300048912 Bacteria 16838
285 Ga0496109_0024791 3300048912 Bacteria 5336
286 Ga0496109_0063195 3300048912 Bacteria 3386
287 Ga0496109_0092869 3300048912 Bacteria 2791
288 Ga0496109_0257836 3300048912 Bacteria 1642
289 Ga0496109_0266095 3300048912 Bacteria 1615
290 Ga0496109_0333071 3300048912 Bacteria 1433
291 Ga0496110_0030273 3300048913 Bacteria 4665
292 Ga0496110_0077909 3300048913 Bacteria 2950
293 Ga0496110_0175694 3300048913 Bacteria 1944
294 Ga0496110_0200553 3300048913 Bacteria 1813
295 Ga0496111_0017290 3300048914 Bacteria 4984
296 Ga0496112_0073055 3300048915 Bacteria 3391
297 Ga0496112_0149779 3300048915 Bacteria 2300
298 Ga0496112_0227845 3300048915 Bacteria 1818
299 Ga0496113_0001477 3300048916 Bacteria 13122
300 Ga0496113_0099055 3300048916 Bacteria 2257
301 Ga0496113_0153535 3300048916 Bacteria 1817
302 Ga0496113_0194303 3300048916 Bacteria 1611
303 Ga0496114_0003667 3300048917 Bacteria 11812
304 Ga0496114_0006541 3300048917 Bacteria 9185
305 Ga0496114_0031895 3300048917 Bacteria 4334
306 Ga0496114_0037013 3300048917 Bacteria 4035
307 Ga0496114_0056521 3300048917 Bacteria 3275
308 Ga0496114_0078846 3300048917 Bacteria 2779
309 Ga0496115_0003056 3300048918 Bacteria 12019
310 Ga0496115_0014104 3300048918 Bacteria 6049
311 Ga0496115_0122073 3300048918 Bacteria 2144
312 Ga0496126_0014857 3300048929 Bacteria 7854
313 Ga0496126_0113192 3300048929 Bacteria 2362
314 Ga0501031_0002833 3300049568 Bacteria 11077
315 Ga0501032_0007939 3300049569 Bacteria 7730
316 Ga0501039_0206759 3300049575 Bacteria 1543
317 Ga0501039_0236375 3300049575 Bacteria 1437
318 Ga0501048_0119291 3300049582 Bacteria 1864
319 Ga0501044_0019289 3300049823 Bacteria 7297
320 nmdc:mga05p37_155_c1 3300050507 Bacteria 65410
321 nmdc:mga05p37_162_c1 3300050507 Bacteria 64436
322 nmdc:mga05p37_187926_c1 3300050507 Bacteria 2511
323 nmdc:mga05p37_27682_c1 3300050507 Bacteria 6905
324 nmdc:mga09592_13791_c1 3300050508 Bacteria 6603
325 nmdc:mga09592_165_c1 3300050508 Bacteria 46519
326 nmdc:mga09592_1_c1 3300050508 Bacteria 201102
327 nmdc:mga09592_259829_c1 3300050508 Bacteria 1506
328 nmdc:mga0qj67_12_c1 3300050509 Bacteria 76377
329 nmdc:mga0qj67_4009_c1 3300050509 Bacteria 10666
330 nmdc:mga0qj67_6234_c1 3300050509 Bacteria 8757
331 nmdc:mga06r32_265_c1 3300050510 Bacteria 43312
332 nmdc:mga06r32_60863_c1 3300050510 Bacteria 3634
333 nmdc:mga06r32_7_c1 3300050510 Bacteria 117700
334 nmdc:mga08y16_48907_c1 3300050511 Bacteria 4425
335 nmdc:mga08y16_6387_c1 3300050511 Bacteria 12361
336 nmdc:mga0n895_177473_c1 3300050512 Bacteria 2161
337 nmdc:mga0n895_535637_c1 3300050512 Bacteria 1178
338 Ga0495619_0007020 3300053085 Bacteria 7126
339 Ga0495619_0012840 3300053085 Bacteria 5276
340 Ga0500559_0001172 3300053136 Bacteria 15712
341 Ga0500568_0044553 3300053139 Bacteria 1769
342 Ga0500568_0049298 3300053139 Bacteria 1662
343 Ga0587073_0015113 3300059492 Bacteria 1386
344 Ga0587069_005919 3300059642 Bacteria 1447
345 Ga0587107_002750 3300059652 Bacteria 1631
346 Ga0587114_006142 3300059655 Bacteria 1332
347 2644503989 2643221690 Bacteria 4654705
348 2644526952 2643221694 Bacteria 4392972
349 2644670315 2643221722 Bacteria 4247614
350 2676495918 2675903060 Bacteria 10051191
351 2738695950 2738541272 Bacteria 6848551
352 2739324770 2738543027 Bacteria 6409078
353 2739605570 2739367654 Bacteria 6049412
354 2744954505 2744054611 Bacteria 5611514
355 2760307595 2758568522 Bacteria 5953541
356 2760623896 2758568621 Bacteria 5967089
357 2791909921 2791354901 Bacteria 8322202
358 2809028811 2808606394 Bacteria 6248540
359 2812332684 2811994874 Bacteria 5367947
360 2812365098 2811994880 Bacteria 4147780
361 2835189978 2835188231 Bacteria 3476928
362 2842889423 2842888712 Bacteria 4279094
363 2861523797 2861520306 Bacteria 8348283
364 2884995413 2884994152 Bacteria 4492978
365 2899370139 2899370129 Bacteria 6781179
366 2932431788 2932431166 Bacteria 4215299
367 2947225074 2947224130 Bacteria 9938529
368 2947232016 2947224130 Bacteria 9938529
369 2956940185 2956939328 Bacteria 3474458
370 2995464889 2995463766 Bacteria 8577691
371 3001121604 3001119090 Bacteria 3449530
372 8057572207 8057568493 Bacteria 7221719
373 Ga0070713_100123648
374 JGI25404J52841_10021788
375 Ga0055540_1000036
376 Ga0058861_10084976
377 Ga0070658_10034957
378 Ga0070683_100053738
379 Ga0068869_100222424
380 Ga0070660_100065849
381 Ga0070689_100218492
382 Ga0070689_100260892
383 Ga0070661_100154029
384 Ga0070668_100313417
385 Ga0070671_100157610
386 Ga0070659_100122225
387 Ga0070667_100036552
388 Ga0070709_10083066
389 Ga0070714_100000517
390 Ga0070714_100208733
391 Ga0070713_100015009
392 Ga0070713_100042593
393 Ga0070713_100116815
394 Ga0070713_100129277
395 Ga0070713_100276982
396 Ga0070710_10000444
397 Ga0070701_10010524
398 Ga0070711_100314540
399 Ga0070708_100179403
400 Ga0070663_100018047
401 Ga0070678_100062081
402 Ga0070707_100002906
403 Ga0070707_100029155
404 Ga0070679_100059537
405 Ga0070679_100102226
406 Ga0070684_100187307
407 Ga0068853_100017341
408 Ga0070672_100085161
409 Ga0070686_100020393
410 Ga0070696_100016950
411 Ga0070665_100020680
412 Ga0070665_100066196
413 Ga0070664_100077315
414 Ga0068854_100031089
415 Ga0068856_100217958
416 Ga0068864_100005166
417 Ga0068851_10044040
418 Ga0068870_10064331
419 Ga0068863_100038071
420 Ga0068863_100178168
421 Ga0068858_100070428
422 Ga0068858_100352132
423 Ga0081455_10000462
424 Ga0081455_10004460
425 Ga0081455_10011037
426 Ga0081540_1000004
427 Ga0081540_1001276
428 Ga0070717_10136274
429 Ga0070717_10169689
430 Ga0075365_10038886
431 Ga0070716_100202519
432 Ga0075428_100000304
433 Ga0075428_100042741
434 Ga0075428_100084398
435 Ga0075430_100001144
436 Ga0075430_100008725
437 Ga0075430_100013369
438 Ga0075431_100000395
439 Ga0075429_100001175
440 Ga0075429_100001187
441 Ga0075429_100003147
442 Ga0075429_100005345
443 Ga0075429_100104512
444 Ga0075436_100166541
445 Ga0105250_10038602
446 Ga0111539_10082436
447 Ga0111539_10106491
448 Ga0111539_10312198
449 Ga0105245_10240415
450 Ga0114129_10000016
451 Ga0114129_10012574
452 Ga0114129_10022485
453 Ga0114129_10024763
454 Ga0114129_10084379
455 Ga0105242_10156762
456 Ga0105248_10021311
457 Ga0105248_10313898
458 Ga0105238_10291501
459 Ga0105249_10031594
460 Ga0105246_10020701
461 Ga0105246_10255402
462 Ga0157373_10050967
463 Ga0157371_10141269
464 Ga0157370_10144341
465 Ga0157369_10443413
466 Ga0157374_10313087
467 Ga0163162_10046027
468 Ga0157372_10321480
469 Ga0157375_10319799
470 Ga0163163_10027325
471 Ga0163163_10064414
472 Ga0157379_10042296
473 Ga0157379_10137131
474 Ga0197907_10956094
475 Ga0206356_10242923
476 Ga0206349_1214642
477 Ga0206349_1595098
478 Ga0206352_10251955
479 Ga0206352_10488303
480 Ga0206350_10151149
481 Ga0206354_10999462
482 Ga0206353_10975235
483 Ga0213876_10028408
484 Ga0213875_10000355
485 Ga0224712_10004485
486 Ga0207653_10003602
487 Ga0207692_10129496
488 Ga0207685_10043583
489 Ga0207699_10008276
490 Ga0207699_10041973
491 Ga0207705_10163396
492 Ga0207707_10090852
493 Ga0207707_10156853
494 Ga0207671_10064790
495 Ga0207663_10012338
496 Ga0207663_10063837
497 Ga0207660_10044086
498 Ga0207657_10001414
499 Ga0207646_10004017
500 Ga0207646_10066396
501 Ga0207650_10195155
502 Ga0207687_10258803
503 Ga0207700_10026414
504 Ga0207700_10044125
505 Ga0207700_10099841
506 Ga0207700_10123422
507 Ga0207664_10024381
508 Ga0207664_10035617
509 Ga0207690_10054863
510 Ga0207706_10037991
511 Ga0207691_10013032
512 Ga0207711_10063791
513 Ga0207711_10302965
514 Ga0207689_10003526
515 Ga0207689_10079577
516 Ga0207658_10031417
517 Ga0207678_10000633
518 Ga0207678_10003290
519 Ga0207708_10009590
520 Ga0207702_10014395
521 Ga0207702_10085675
522 Ga0207641_10033529
523 Ga0207641_10241440
524 Ga0207648_10146081
525 Ga0207676_10010939
526 Ga0207674_10006592
527 Ga0207674_10030561
528 Ga0207674_10183562
529 Ga0207683_10000499
530 Ga0207428_10005256
531 Ga0268266_10001638
532 Ga0268266_10140325
533 Ga0268264_10053677
534 Ga0307515_10230240
535 Ga0265338_10138887
536 Ga0316177_1124226
537 Ga0314311_1123364
538 Ga0265340_10000764
539 Ga0307408_100064108
540 Ga0307508_10066279
541 Ga0307405_10003637
542 Ga0307405_10004371
543 Ga0307405_10060282
544 Ga0307413_10006245
545 Ga0307413_10009393
546 Ga0307413_10045867
547 Ga0307410_10005446
548 Ga0307410_10024696
549 Ga0307410_10087619
550 Ga0307410_10092867
551 Ga0307406_10003033
552 Ga0307406_10071180
553 Ga0307407_10050315
554 Ga0307409_100082727
555 Ga0307409_100083500
556 Ga0307409_100345601
557 Ga0307416_100009741
558 Ga0307416_100049048
559 Ga0307416_100405617
560 Ga0307414_10238675
561 Ga0307411_10066789
562 Ga0307415_100003973
563 Ga0307415_100023040
564 Ga0373930_0003319
565 Ga0373948_0005057
566 Ga0373926_0003865
567 Ga0373934_0029889
568 Ga0373949_0016016
569 Ga0373932_0027803
570 Ga0373936_0005951
571 Ga0373945_0000141
572 Ga0373943_0000354
573 Ga0373946_0000081
574 Ga0373955_0172518
575 Ga0373962_0024608
576 Ga0373935_0006311
577 Ga0373927_0001862
578 Ga0373927_0054208
579 Ga0373947_0000683
580 Ga0373937_0026448
581 Ga0373937_0041662
582 Ga0373937_0131249
583 Ga0373925_0076560
584 Ga0395900_0048931
585 Ga0395898_0281557
586 Ga0395905_0302161
587 Ga0436364_0050479
588 Ga0436364_1297258
589 Ga0400485_22276
590 Ga0400488_12363
591 Ga0400486_08312
592 Ga0436363_1698444
593 Ga0451797_1393608
594 Ga0439448_0005323
595 Ga0466969_0065895
596 Ga0466965_0015062
597 Ga0466961_0046395
598 Ga0466961_0182868
599 Ga0466963_0001256
600 Ga0466958_0008267
601 Ga0466967_0000484
602 Ga0466967_0127492
603 Ga0495641_0010489
604 Ga0495651_0023803
605 Ga0495653_0003464
606 Ga0495653_0010141
607 Ga0495639_0037316
608 Ga0495662_0026424
609 Ga0495664_0002120
610 Ga0495618_0032535
611 Ga0495648_0001466
612 Ga0495652_0116454
613 Ga0495640_0023419
614 Ga0495587_0017706
615 Ga0495645_0081087
616 Ga0495667_0013488
617 Ga0495667_0018173
618 Ga0495634_0062384
619 Ga0495635_0001118
620 Ga0495635_0049499
621 Ga0495657_0013774
622 Ga0495657_0019937
623 Ga0495657_0159283
624 Ga0495624_0002333
625 Ga0495674_0001126
626 Ga0495674_0281252
627 Ga0495672_0046153
628 Ga0495676_0010607
629 Ga0495680_0006580
630 Ga0495680_0010005
631 Ga0495673_0002107
632 Ga0495684_0004669
633 Ga0495684_0053031
634 Ga0495593_0019062
635 Ga0495602_0152022
636 Ga0496100_0244671
637 Ga0496101_0036136
638 Ga0496101_0251659
639 Ga0496102_0007002
640 Ga0496102_0060457
641 Ga0496102_0156318
642 Ga0496102_0158522
643 Ga0496103_0088639
644 Ga0496104_0002850
645 Ga0496104_0107127
646 Ga0496104_0459751
647 Ga0496105_0010401
648 Ga0496105_0019473
649 Ga0496105_0231507
650 Ga0496107_0014049
651 Ga0496107_0045553
652 Ga0496108_0033093
653 Ga0496108_0058383
654 Ga0496108_0064162
655 Ga0496108_0086029
656 Ga0496109_0002018
657 Ga0496109_0024791
658 Ga0496109_0063195
659 Ga0496109_0092869
660 Ga0496109_0257836
661 Ga0496109_0266095
662 Ga0496109_0333071
663 Ga0496110_0030273
664 Ga0496110_0077909
665 Ga0496110_0175694
666 Ga0496110_0200553
667 Ga0496111_0017290
668 Ga0496112_0073055
669 Ga0496112_0149779
670 Ga0496112_0227845
671 Ga0496113_0001477
672 Ga0496113_0099055
673 Ga0496113_0153535
674 Ga0496113_0194303
675 Ga0496114_0003667
676 Ga0496114_0006541
677 Ga0496114_0031895
678 Ga0496114_0037013
679 Ga0496114_0056521
680 Ga0496114_0078846
681 Ga0496115_0003056
682 Ga0496115_0014104
683 Ga0496115_0122073
684 Ga0496126_0014857
685 Ga0496126_0113192
686 Ga0501031_0002833
687 Ga0501032_0007939
688 Ga0501039_0206759
689 Ga0501039_0236375
690 Ga0501048_0119291
691 Ga0501044_0019289
692 nmdc:mga05p37_155_c1
693 nmdc:mga05p37_162_c1
694 nmdc:mga05p37_187926_c1
695 nmdc:mga05p37_27682_c1
696 nmdc:mga09592_13791_c1
697 nmdc:mga09592_165_c1
698 nmdc:mga09592_1_c1
699 nmdc:mga09592_259829_c1
700 nmdc:mga0qj67_12_c1
701 nmdc:mga0qj67_4009_c1
702 nmdc:mga0qj67_6234_c1
703 nmdc:mga06r32_265_c1
704 nmdc:mga06r32_60863_c1
705 nmdc:mga06r32_7_c1
706 nmdc:mga08y16_48907_c1
707 nmdc:mga08y16_6387_c1
708 nmdc:mga0n895_177473_c1
709 nmdc:mga0n895_535637_c1
710 Ga0495619_0007020
711 Ga0495619_0012840
712 Ga0500559_0001172
713 Ga0500568_0044553
714 Ga0500568_0049298
715 Ga0587073_0015113
716 Ga0587069_005919
717 Ga0587107_002750
718 Ga0587114_006142
719 2644503989
720 2644526952
721 2644670315
722 2676495918
723 2738695950
724 2739324770
725 2739605570
726 2744954505
727 2760307595
728 2760623896
729 2791909921
730 2809028811
731 2812332684
732 2812365098
733 2835189978
734 2842889423
735 2861523797
736 2884995413
737 2899370139
738 2932431788
739 2947225074
740 2947232016
741 2956940185
742 2995464889
743 3001121604
744 8057572207

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

15

368

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.969 4 358
7bbw-assembly2.cif.gz_B neisseria gonorrhoeae transaldolase, variant c38s 0.9669 5 358
7bbx-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase, variant k8a 0.9655 4 358
7odq-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase at 5.4 mgy dose 0.9646 4 358
3r5e-assembly1.cif.gz_A transaldolase from corynebacterium glutamicum 0.9632 1 362
ID Description Score Start End Superfamily
af_B4FRC9_66_421_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.968 5 361 3.20.20.70
3r5eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9632 1 362 3.20.20.70
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.961 2 358 3.20.20.70
af_I1JM01_1_306_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9607 65 361 3.20.20.70
3r5eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9579 1 362 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6G3XGD8-F1-model_v4 transaldolase (EC 2.2.1.2) 1.003 93 171 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A2W6E122-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9988 160 366 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A2S9G7Y1-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9987 78 157 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-E2FSJ1-F1-model_v4 Putative transaldolase 0.9983 84 176 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A4Y8YCC9-F1-model_v4 deleted 0.9979 113 233

Map