F425744

General Info

Members Datasets Scaffolds Average Seq Length
371 197 742 93

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_11577294|Ga0163162_115772942
Length 109
Sequence MSIHPRGFDFLKDVDVRLSVELGRVDMKLKDVLSLGQESVVVLDRLTDELLDVLVNGKPIAKGEIVAQNGRFGLRIVELAGTQSAAPSTEIAPVDFTTLSGANLGGTLA

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
93 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
96 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
99 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
100 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
101 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
123 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
162 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
163 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
179 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
182 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
191 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
192 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
193 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
196 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
197 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.41
Nodule 1.35
Rhizoplane 9.43
Rhizosphere 59.84
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_11577294 3300013306 Bacteria 749
2 SwRhRL2b_contig_2708444 2162886007 Bacteria 5437
3 SwRhRL2b_contig_2733063 2162886007 Bacteria 890
4 JGI24034J26672_10060068 3300002239 Bacteria 666
5 JGI24034J26672_10122846 3300002239 Bacteria 503
6 JGI24751J29686_10022074 3300002459 Bacteria 1320
7 Ga0065704_10101297 3300005289 Bacteria 2242
8 Ga0065704_10170494 3300005289 Bacteria 1295
9 Ga0065704_10220956 3300005289 Bacteria 1074
10 Ga0065707_10184448 3300005295 Bacteria 1397
11 Ga0070658_10510671 3300005327 Bacteria 1039
12 Ga0070676_11334863 3300005328 Bacteria 548
13 Ga0070670_100076655 3300005331 Bacteria 2872
14 Ga0070666_10202876 3300005335 Bacteria 1395
15 Ga0070666_10309866 3300005335 Bacteria 1125
16 Ga0070689_100294551 3300005340 Bacteria 1349
17 Ga0070668_100001141 3300005347 Bacteria 18695
18 Ga0070668_100011613 3300005347 Bacteria 6557
19 Ga0070668_100016949 3300005347 Bacteria 5450
20 Ga0070668_100039879 3300005347 Bacteria 3592
21 Ga0070669_100000135 3300005353 Bacteria 66559
22 Ga0070669_100000148 3300005353 Bacteria 62879
23 Ga0070669_100000223 3300005353 Bacteria 47302
24 Ga0070671_100001494 3300005355 Bacteria 17479
25 Ga0070671_100036015 3300005355 Bacteria 4102
26 Ga0070667_100000866 3300005367 Bacteria 28098
27 Ga0070667_100011338 3300005367 Bacteria 7372
28 Ga0070667_100436476 3300005367 Unclassified 1195
29 Ga0070667_100721535 3300005367 Bacteria 923
30 Ga0070705_100116188 3300005440 Bacteria 1719
31 Ga0068853_102371967 3300005539 Bacteria 514
32 Ga0070672_100392881 3300005543 Bacteria 1188
33 Ga0070665_100000796 3300005548 Bacteria 41354
34 Ga0070665_100217789 3300005548 Bacteria 1910
35 Ga0070665_100461659 3300005548 Bacteria 1280
36 Ga0070665_101141007 3300005548 Bacteria 791
37 Ga0068855_100001063 3300005563 Bacteria 34041
38 Ga0068855_100016944 3300005563 Bacteria 8763
39 Ga0070664_101990786 3300005564 Bacteria 551
40 Ga0068856_101195416 3300005614 Bacteria 777
41 Ga0068852_100042042 3300005616 Bacteria 3867
42 Ga0068852_100161671 3300005616 Bacteria 2091
43 Ga0068852_100348727 3300005616 Bacteria 1445
44 Ga0068859_100189526 3300005617 Bacteria 2141
45 Ga0068859_101017288 3300005617 Bacteria 910
46 Ga0068864_100029787 3300005618 Bacteria 4626
47 Ga0068864_100154653 3300005618 Bacteria 2081
48 Ga0068863_100005826 3300005841 Bacteria 12075
49 Ga0068863_100006065 3300005841 Bacteria 11861
50 Ga0068863_100574813 3300005841 Bacteria 1114
51 Ga0068858_100001179 3300005842 Bacteria 27095
52 Ga0068858_100016803 3300005842 Bacteria 6872
53 Ga0068858_100248787 3300005842 Bacteria 1688
54 Ga0068858_101610199 3300005842 Bacteria 641
55 Ga0068860_100020490 3300005843 Bacteria 6404
56 Ga0068860_100057757 3300005843 Bacteria 3689
57 Ga0068860_100071229 3300005843 Bacteria 3304
58 Ga0068860_100172112 3300005843 Bacteria 2092
59 Ga0068862_100009077 3300005844 Bacteria 8229
60 Ga0068862_100064798 3300005844 Bacteria 3146
61 Ga0075365_10035919 3300006038 Bacteria 3209
62 Ga0075368_10002518 3300006042 Bacteria 5993
63 Ga0075363_100022869 3300006048 Bacteria 3163
64 Ga0075363_100080325 3300006048 Bacteria 1783
65 Ga0075364_10001324 3300006051 Bacteria 13315
66 Ga0075364_10035995 3300006051 Bacteria 3200
67 Ga0075362_10000071 3300006177 Bacteria 28050
68 Ga0075362_10000260 3300006177 Bacteria 14749
69 Ga0075362_10030969 3300006177 Bacteria 2313
70 Ga0075367_10001068 3300006178 Bacteria 11313
71 Ga0075369_10000935 3300006186 Bacteria 9706
72 Ga0075369_10042086 3300006186 Bacteria 1957
73 Ga0075369_10611328 3300006186 Bacteria 522
74 Ga0075366_10000079 3300006195 Bacteria 37958
75 Ga0075366_10009156 3300006195 Bacteria 5522
76 Ga0075366_10020835 3300006195 Bacteria 3807
77 Ga0075366_10123063 3300006195 Bacteria 1564
78 Ga0075366_10167220 3300006195 Bacteria 1334
79 Ga0075370_10036281 3300006353 Bacteria 2769
80 Ga0075370_10040431 3300006353 Bacteria 2630
81 Ga0075370_10048163 3300006353 Bacteria 2414
82 Ga0097620_100189526 3300006931 Bacteria 2141
83 Ga0097620_101017285 3300006931 Bacteria 910
84 Ga0079104_1021017 3300006946 Bacteria 1785
85 Ga0079104_1027478 3300006946 Bacteria 1458
86 Ga0079104_1048841 3300006946 Unclassified 951
87 Ga0079104_1068093 3300006946 Bacteria 753
88 Ga0075435_101110628 3300007076 Bacteria 691
89 Ga0105251_10000622 3300009011 Bacteria 32588
90 Ga0105251_10040055 3300009011 Bacteria 2285
91 Ga0105251_10235297 3300009011 Bacteria 825
92 Ga0105251_10572010 3300009011 Bacteria 534
93 Ga0105250_10018786 3300009092 Bacteria 2797
94 Ga0105240_10446350 3300009093 Bacteria 1448
95 Ga0105240_10539971 3300009093 Bacteria 1291
96 Ga0111539_10259982 3300009094 Bacteria 2021
97 Ga0105247_10051619 3300009101 Bacteria 2533
98 Ga0105247_10090172 3300009101 Bacteria 1945
99 Ga0105247_10093507 3300009101 Bacteria 1911
100 Ga0105241_10363448 3300009174 Bacteria 1260
101 Ga0105248_10007413 3300009177 Bacteria 12038
102 Ga0105248_10122775 3300009177 Bacteria 2930
103 Ga0105248_11080768 3300009177 Bacteria 907
104 Ga0105248_11163776 3300009177 Unclassified 872
105 Ga0105248_11871736 3300009177 Bacteria 681
106 Ga0105248_12724100 3300009177 Bacteria 564
107 Ga0105237_11360205 3300009545 Bacteria 716
108 Ga0105249_10097932 3300009553 Bacteria 2754
109 Ga0163162_10008151 3300013306 Bacteria 10223
110 Ga0163162_10072132 3300013306 Bacteria 3507
111 Ga0163162_10142510 3300013306 Bacteria 2511
112 Ga0163163_12839323 3300014325 Bacteria 540
113 Ga0157379_11675207 3300014968 Bacteria 622
114 Ga0163161_10096720 3300017792 Bacteria 2192
115 Ga0207697_10243669 3300025315 Bacteria 794
116 Ga0207696_1008122 3300025711 Bacteria 4047
117 Ga0207713_1001095 3300025735 Bacteria 23209
118 Ga0207713_1014846 3300025735 Bacteria 4020
119 Ga0207713_1171067 3300025735 Bacteria 685
120 Ga0207710_10091982 3300025900 Bacteria 1421
121 Ga0207680_10174451 3300025903 Bacteria 1450
122 Ga0207680_10312139 3300025903 Bacteria 1098
123 Ga0207680_10388693 3300025903 Bacteria 985
124 Ga0207705_10459299 3300025909 Bacteria 988
125 Ga0207654_10318492 3300025911 Bacteria 1062
126 Ga0207695_10438682 3300025913 Bacteria 1189
127 Ga0207671_10997586 3300025914 Bacteria 660
128 Ga0207681_10000062 3300025923 Bacteria 99856
129 Ga0207681_10000160 3300025923 Bacteria 55315
130 Ga0207681_10000169 3300025923 Bacteria 54216
131 Ga0207650_10260647 3300025925 Bacteria 1406
132 Ga0207644_10002213 3300025931 Bacteria 12622
133 Ga0207644_10002245 3300025931 Bacteria 12531
134 Ga0207644_11340762 3300025931 Bacteria 601
135 Ga0207670_10366383 3300025936 Bacteria 1144
136 Ga0207711_10001696 3300025941 Bacteria 20277
137 Ga0207711_10386993 3300025941 Bacteria 1298
138 Ga0207711_10650703 3300025941 Bacteria 983
139 Ga0207711_10748600 3300025941 Unclassified 911
140 Ga0207667_10001114 3300025949 Bacteria 33871
141 Ga0207667_10135160 3300025949 Bacteria 2539
142 Ga0207712_10011122 3300025961 Bacteria 5727
143 Ga0207712_10922603 3300025961 Bacteria 772
144 Ga0207668_10003814 3300025972 Bacteria 8883
145 Ga0207668_10007483 3300025972 Bacteria 6496
146 Ga0207668_10008264 3300025972 Bacteria 6201
147 Ga0207668_10059062 3300025972 Bacteria 2685
148 Ga0207640_10299948 3300025981 Bacteria 1271
149 Ga0207658_10001390 3300025986 Bacteria 18855
150 Ga0207658_10006503 3300025986 Bacteria 7976
151 Ga0207658_10276363 3300025986 Unclassified 1438
152 Ga0207658_10980330 3300025986 Bacteria 771
153 Ga0207703_10008367 3300026035 Bacteria 8179
154 Ga0207703_10084623 3300026035 Bacteria 2653
155 Ga0207703_10167647 3300026035 Bacteria 1929
156 Ga0207639_12289752 3300026041 Bacteria 502
157 Ga0207678_11678717 3300026067 Bacteria 558
158 Ga0207702_10647127 3300026078 Bacteria 1039
159 Ga0207702_12294323 3300026078 Bacteria 528
160 Ga0207641_10001991 3300026088 Bacteria 19507
161 Ga0207641_10003020 3300026088 Bacteria 15165
162 Ga0207641_10459831 3300026088 Bacteria 1231
163 Ga0207676_10190253 3300026095 Bacteria 1805
164 Ga0207676_10237019 3300026095 Bacteria 1634
165 Ga0207674_10298185 3300026116 Bacteria 1561
166 Ga0207674_12061662 3300026116 Bacteria 535
167 Ga0207698_10213483 3300026142 Bacteria 1738
168 Ga0207698_10264498 3300026142 Bacteria 1582
169 Ga0209281_1030866 3300027111 Unclassified 959
170 Ga0209983_1009088 3300027665 Bacteria 2031
171 Ga0209813_10000128 3300027866 Bacteria 27561
172 Ga0209974_10064635 3300027876 Bacteria 1242
173 Ga0207428_10108095 3300027907 Bacteria 2142
174 Ga0268266_10000570 3300028379 Bacteria 50884
175 Ga0268266_10018275 3300028379 Bacteria 5977
176 Ga0268266_10056259 3300028379 Bacteria 3384
177 Ga0268265_10007214 3300028380 Bacteria 7511
178 Ga0268265_10009936 3300028380 Bacteria 6431
179 Ga0268265_10996263 3300028380 Bacteria 827
180 Ga0268265_12520025 3300028380 Bacteria 520
181 Ga0268264_10012741 3300028381 Bacteria 6920
182 Ga0268264_10056373 3300028381 Bacteria 3285
183 Ga0268264_10145924 3300028381 Bacteria 2116
184 Ga0268264_10806538 3300028381 Bacteria 938
185 Ga0268264_10919085 3300028381 Bacteria 879
186 Ga0268264_11007181 3300028381 Bacteria 840
187 Ga0307412_10220920 3300031911 Bacteria 1452
188 Ga0307415_100793417 3300032126 Bacteria 864
189 Ga0316584_0753438 3300036712 Bacteria 664
190 Ga0237816_05778 3300039145 Bacteria 822
191 Ga0451791_1284749 3300041451 Bacteria 567
192 Ga0451807_0253256 3300041486 Bacteria 747
193 Ga0451833_0872605 3300041491 Bacteria 700
194 Ga0451835_0667417 3300041492 Bacteria 784
195 Ga0451837_1866561 3300041494 Bacteria 925
196 Ga0451839_0113366 3300041496 Bacteria 601
197 Ga0451841_0370428 3300041498 Bacteria 589
198 Ga0451841_0880011 3300041498 Bacteria 823
199 Ga0451849_0864664 3300041505 Bacteria 667
200 Ga0451843_0711289 3300041509 Bacteria 562
201 Ga0451853_0145546 3300041512 Bacteria 556
202 Ga0450904_016001 3300042139 Bacteria 750
203 Ga0451576_1406269 3300045051 Bacteria 726
204 Ga0495627_074537 3300046453 Bacteria 988
205 Ga0495638_0106402 3300046460 Bacteria 1671
206 Ga0495650_0159141 3300046471 Bacteria 806
207 Ga0495639_0186176 3300046475 Bacteria 1012
208 Ga0495607_0055333 3300046501 Bacteria 2283
209 Ga0495607_0066389 3300046501 Bacteria 2030
210 Ga0495583_0013092 3300046506 Bacteria 4650
211 Ga0495606_0070145 3300046507 Bacteria 2211
212 Ga0495610_0000081 3300046512 Bacteria 113513
213 Ga0495632_0000885 3300046519 Bacteria 26294
214 Ga0495632_0014747 3300046519 Bacteria 4409
215 Ga0495632_0164715 3300046519 Bacteria 1020
216 Ga0495643_0000077 3300046522 Bacteria 163843
217 Ga0495643_0002357 3300046522 Bacteria 15139
218 Ga0495654_0034922 3300046530 Bacteria 2535
219 Ga0495654_0036814 3300046530 Bacteria 2457
220 Ga0495654_0140404 3300046530 Bacteria 1077
221 Ga0495609_0007086 3300046538 Bacteria 5641
222 Ga0495609_0172845 3300046538 Bacteria 912
223 Ga0495597_0244800 3300046542 Bacteria 706
224 Ga0495597_0327037 3300046542 Bacteria 591
225 Ga0495633_0192402 3300046558 Bacteria 938
226 Ga0495668_0022069 3300046616 Bacteria 3642
227 Ga0495668_0219199 3300046616 Bacteria 1042
228 Ga0495668_0277156 3300046616 Bacteria 919
229 Ga0495625_0003157 3300046660 Bacteria 16786
230 Ga0495625_0063881 3300046660 Bacteria 2599
231 Ga0495671_0184427 3300046692 Bacteria 1013
232 Ga0495671_0643786 3300046692 Bacteria 504
233 Ga0495681_0187834 3300047470 Bacteria 845
234 Ga0495615_0179903 3300048090 Bacteria 644
235 Ga0496100_0003466 3300048903 Bacteria 8229
236 Ga0496100_0007400 3300048903 Bacteria 6056
237 Ga0496101_0036608 3300048904 Bacteria 3476
238 Ga0496101_0394564 3300048904 Bacteria 1089
239 Ga0496102_0001248 3300048905 Bacteria 22945
240 Ga0496102_0038018 3300048905 Bacteria 4342
241 Ga0496102_0632441 3300048905 Bacteria 993
242 Ga0496103_0000204 3300048906 Bacteria 59139
243 Ga0496103_0017989 3300048906 Bacteria 4235
244 Ga0496104_0000236 3300048907 Bacteria 48825
245 Ga0496104_0119156 3300048907 Bacteria 2534
246 Ga0496105_0000219 3300048908 Bacteria 38483
247 Ga0496105_0527025 3300048908 Bacteria 925
248 Ga0496105_0570663 3300048908 Bacteria 881
249 Ga0496105_1099855 3300048908 Bacteria 590
250 Ga0496105_1399307 3300048908 Bacteria 507
251 Ga0496106_0000373 3300048909 Bacteria 31824
252 Ga0496107_0031804 3300048910 Bacteria 3768
253 Ga0496108_0142563 3300048911 Bacteria 2065
254 Ga0496108_0645287 3300048911 Bacteria 920
255 Ga0496109_0494515 3300048912 Bacteria 1154
256 Ga0496110_0040563 3300048913 Bacteria 4057
257 Ga0496110_0088951 3300048913 Bacteria 2759
258 Ga0496111_0122314 3300048914 Bacteria 1922
259 Ga0496111_0357466 3300048914 Bacteria 1081
260 Ga0496111_0361505 3300048914 Bacteria 1074
261 Ga0496112_0584258 3300048915 Bacteria 1049
262 Ga0496112_1258122 3300048915 Bacteria 656
263 Ga0496113_0001309 3300048916 Bacteria 13757
264 Ga0496113_0008955 3300048916 Bacteria 6553
265 Ga0496114_0035773 3300048917 Bacteria 4102
266 Ga0496114_1433265 3300048917 Bacteria 578
267 Ga0496115_0679924 3300048918 Bacteria 811
268 Ga0496116_0037623 3300048919 Bacteria 3372
269 Ga0496117_0000531 3300048920 Bacteria 62634
270 Ga0496117_0075331 3300048920 Bacteria 2242
271 Ga0496118_0003512 3300048921 Bacteria 19652
272 Ga0496118_0159924 3300048921 Bacteria 1394
273 Ga0496118_0330737 3300048921 Bacteria 822
274 Ga0496118_0339200 3300048921 Bacteria 806
275 Ga0496119_0000823 3300048922 Bacteria 41374
276 Ga0496119_0096137 3300048922 Bacteria 1672
277 Ga0496120_0001376 3300048923 Bacteria 29700
278 Ga0496120_0131377 3300048923 Bacteria 1282
279 Ga0496121_0000947 3300048924 Bacteria 52572
280 Ga0496121_0010615 3300048924 Bacteria 10347
281 Ga0496122_0135893 3300048925 Bacteria 1549
282 Ga0496123_0022265 3300048926 Bacteria 4890
283 Ga0496123_0099072 3300048926 Bacteria 1702
284 Ga0496124_0003527 3300048927 Bacteria 19050
285 Ga0496124_0132148 3300048927 Bacteria 1982
286 Ga0496125_0021358 3300048928 Bacteria 6040
287 Ga0496125_0157378 3300048928 Bacteria 1549
288 Ga0496125_0171826 3300048928 Bacteria 1456
289 Ga0496125_0199733 3300048928 Bacteria 1311
290 Ga0496126_0000202 3300048929 Bacteria 132786
291 Ga0496126_0004130 3300048929 Bacteria 17570
292 Ga0496126_0023930 3300048929 Bacteria 5906
293 Ga0496126_0048653 3300048929 Bacteria 3873
294 Ga0501031_0352200 3300049568 Bacteria 953
295 Ga0501033_0673265 3300049570 Bacteria 706
296 Ga0501034_0480990 3300049571 Bacteria 1157
297 Ga0501034_1516990 3300049571 Bacteria 544
298 Ga0501036_0397815 3300049572 Bacteria 1149
299 Ga0501037_0739523 3300049573 Bacteria 652
300 Ga0501037_1101455 3300049573 Bacteria 514
301 Ga0501042_0012906 3300049578 Bacteria 5675
302 Ga0501043_0272812 3300049579 Bacteria 1298
303 Ga0501047_0431349 3300049581 Bacteria 1149
304 Ga0501047_0703326 3300049581 Bacteria 828
305 Ga0501048_1250711 3300049582 Bacteria 534
306 Ga0501073_0227703 3300049589 Bacteria 1288
307 Ga0501224_041960 3300049664 Bacteria 692
308 Ga0501249_072599 3300049679 Bacteria 805
309 Ga0501253_193664 3300049683 Bacteria 534
310 Ga0501083_0867894 3300049744 Bacteria 587
311 Ga0501035_1006485 3300049822 Bacteria 655
312 Ga0501044_0000352 3300049823 Bacteria 57653
313 Ga0501044_0087684 3300049823 Bacteria 3143
314 Ga0501044_0531456 3300049823 Bacteria 1075
315 Ga0501044_0666532 3300049823 Bacteria 928
316 Ga0501044_0913391 3300049823 Bacteria 752
317 nmdc:mga03683_123780_c1 3300050489 Bacteria 1152
318 nmdc:mga03683_128_c1 3300050489 Bacteria 25378
319 nmdc:mga03683_2_c1 3300050489 Bacteria 289140
320 nmdc:mga03n38_34763_c1 3300050490 Bacteria 2155
321 nmdc:mga03n38_466_c1 3300050490 Bacteria 10108
322 nmdc:mga00v17_179240_c1 3300050491 Bacteria 1367
323 nmdc:mga00v17_297292_c1 3300050491 Bacteria 1049
324 nmdc:mga00v17_464_c2 3300050491 Bacteria 8178
325 nmdc:mga0yw44_170514_c1 3300050492 Bacteria 1429
326 nmdc:mga0k408_156589_c2 3300050493 Bacteria 962
327 nmdc:mga0k408_160908_c1 3300050493 Bacteria 1337
328 nmdc:mga0k408_287610_c1 3300050493 Bacteria 981
329 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
330 nmdc:mga0k408_42821_c1 3300050493 Bacteria 2608
331 nmdc:mga0k408_79461_c1 3300050493 Bacteria 1919
332 nmdc:mga06z11_1156_c1 3300050494 Bacteria 9661
333 nmdc:mga04h51_141_c1 3300050495 Bacteria 21073
334 nmdc:mga07m45_13094_c1 3300050496 Bacteria 4392
335 nmdc:mga07m45_279094_c1 3300050496 Bacteria 972
336 nmdc:mga07m45_29_c1 3300050496 Bacteria 85597
337 nmdc:mga07m45_704775_c1 3300050496 Bacteria 580
338 nmdc:mga07m45_9104_c1 3300050496 Bacteria 5129
339 nmdc:mga08y16_280478_c1 3300050511 Bacteria 1719
340 nmdc:mga0rr50_971540_c1 3300050513 Bacteria 724
341 nmdc:mga0sz30_125_c1 3300050516 Bacteria 28831
342 nmdc:mga0sz30_128_c1 3300050516 Bacteria 28101
343 nmdc:mga0sz30_548026_c1 3300050516 Bacteria 522
344 Ga0500643_008006 3300053087 Bacteria 4193
345 Ga0500643_011899 3300053087 Bacteria 3143
346 Ga0500643_139280 3300053087 Bacteria 652
347 Ga0500594_0007529 3300053118 Bacteria 2465
348 Ga0500595_048183 3300053119 Bacteria 1332
349 Ga0500607_000009 3300053121 Bacteria 125590
350 Ga0500607_000183 3300053121 Bacteria 55765
351 Ga0500608_000057 3300053122 Bacteria 48708
352 Ga0500618_027378 3300053125 Bacteria 1356
353 Ga0500559_0000353 3300053136 Bacteria 34519
354 Ga0500559_0044829 3300053136 Bacteria 1935
355 Ga0500559_0163745 3300053136 Bacteria 1045
356 Ga0500564_000444 3300053138 Bacteria 12017
357 Ga0500568_0110605 3300053139 Bacteria 1027
358 Ga0500568_0338842 3300053139 Bacteria 545
359 Ga0500590_000705 3300053148 Bacteria 12128
360 Ga0500604_0151132 3300053151 Bacteria 788
361 Ga0500604_0248185 3300053151 Bacteria 616
362 Ga0500622_0001387 3300053156 Bacteria 19516
363 Ga0500627_0360885 3300053158 Bacteria 625
364 Ga0500637_0034438 3300053178 Bacteria 2833
365 Ga0500567_000063 3300053723 Bacteria 23545
366 Ga0500625_000016 3300053729 Bacteria 102090
367 Ga0500645_000868 3300053730 Bacteria 17604
368 Ga0500645_020952 3300053730 Bacteria 2020
369 2848298344 2848297114 Bacteria 3608511
370 2882806776 2882806704 Bacteria 3007728
371 8054306298 8054302542 Bacteria 5698134
372 Ga0163162_11577294
373 SwRhRL2b_contig_2708444
374 SwRhRL2b_contig_2733063
375 JGI24034J26672_10060068
376 JGI24034J26672_10122846
377 JGI24751J29686_10022074
378 Ga0065704_10101297
379 Ga0065704_10170494
380 Ga0065704_10220956
381 Ga0065707_10184448
382 Ga0070658_10510671
383 Ga0070676_11334863
384 Ga0070670_100076655
385 Ga0070666_10202876
386 Ga0070666_10309866
387 Ga0070689_100294551
388 Ga0070668_100001141
389 Ga0070668_100011613
390 Ga0070668_100016949
391 Ga0070668_100039879
392 Ga0070669_100000135
393 Ga0070669_100000148
394 Ga0070669_100000223
395 Ga0070671_100001494
396 Ga0070671_100036015
397 Ga0070667_100000866
398 Ga0070667_100011338
399 Ga0070667_100436476
400 Ga0070667_100721535
401 Ga0070705_100116188
402 Ga0068853_102371967
403 Ga0070672_100392881
404 Ga0070665_100000796
405 Ga0070665_100217789
406 Ga0070665_100461659
407 Ga0070665_101141007
408 Ga0068855_100001063
409 Ga0068855_100016944
410 Ga0070664_101990786
411 Ga0068856_101195416
412 Ga0068852_100042042
413 Ga0068852_100161671
414 Ga0068852_100348727
415 Ga0068859_100189526
416 Ga0068859_101017288
417 Ga0068864_100029787
418 Ga0068864_100154653
419 Ga0068863_100005826
420 Ga0068863_100006065
421 Ga0068863_100574813
422 Ga0068858_100001179
423 Ga0068858_100016803
424 Ga0068858_100248787
425 Ga0068858_101610199
426 Ga0068860_100020490
427 Ga0068860_100057757
428 Ga0068860_100071229
429 Ga0068860_100172112
430 Ga0068862_100009077
431 Ga0068862_100064798
432 Ga0075365_10035919
433 Ga0075368_10002518
434 Ga0075363_100022869
435 Ga0075363_100080325
436 Ga0075364_10001324
437 Ga0075364_10035995
438 Ga0075362_10000071
439 Ga0075362_10000260
440 Ga0075362_10030969
441 Ga0075367_10001068
442 Ga0075369_10000935
443 Ga0075369_10042086
444 Ga0075369_10611328
445 Ga0075366_10000079
446 Ga0075366_10009156
447 Ga0075366_10020835
448 Ga0075366_10123063
449 Ga0075366_10167220
450 Ga0075370_10036281
451 Ga0075370_10040431
452 Ga0075370_10048163
453 Ga0097620_100189526
454 Ga0097620_101017285
455 Ga0079104_1021017
456 Ga0079104_1027478
457 Ga0079104_1048841
458 Ga0079104_1068093
459 Ga0075435_101110628
460 Ga0105251_10000622
461 Ga0105251_10040055
462 Ga0105251_10235297
463 Ga0105251_10572010
464 Ga0105250_10018786
465 Ga0105240_10446350
466 Ga0105240_10539971
467 Ga0111539_10259982
468 Ga0105247_10051619
469 Ga0105247_10090172
470 Ga0105247_10093507
471 Ga0105241_10363448
472 Ga0105248_10007413
473 Ga0105248_10122775
474 Ga0105248_11080768
475 Ga0105248_11163776
476 Ga0105248_11871736
477 Ga0105248_12724100
478 Ga0105237_11360205
479 Ga0105249_10097932
480 Ga0163162_10008151
481 Ga0163162_10072132
482 Ga0163162_10142510
483 Ga0163163_12839323
484 Ga0157379_11675207
485 Ga0163161_10096720
486 Ga0207697_10243669
487 Ga0207696_1008122
488 Ga0207713_1001095
489 Ga0207713_1014846
490 Ga0207713_1171067
491 Ga0207710_10091982
492 Ga0207680_10174451
493 Ga0207680_10312139
494 Ga0207680_10388693
495 Ga0207705_10459299
496 Ga0207654_10318492
497 Ga0207695_10438682
498 Ga0207671_10997586
499 Ga0207681_10000062
500 Ga0207681_10000160
501 Ga0207681_10000169
502 Ga0207650_10260647
503 Ga0207644_10002213
504 Ga0207644_10002245
505 Ga0207644_11340762
506 Ga0207670_10366383
507 Ga0207711_10001696
508 Ga0207711_10386993
509 Ga0207711_10650703
510 Ga0207711_10748600
511 Ga0207667_10001114
512 Ga0207667_10135160
513 Ga0207712_10011122
514 Ga0207712_10922603
515 Ga0207668_10003814
516 Ga0207668_10007483
517 Ga0207668_10008264
518 Ga0207668_10059062
519 Ga0207640_10299948
520 Ga0207658_10001390
521 Ga0207658_10006503
522 Ga0207658_10276363
523 Ga0207658_10980330
524 Ga0207703_10008367
525 Ga0207703_10084623
526 Ga0207703_10167647
527 Ga0207639_12289752
528 Ga0207678_11678717
529 Ga0207702_10647127
530 Ga0207702_12294323
531 Ga0207641_10001991
532 Ga0207641_10003020
533 Ga0207641_10459831
534 Ga0207676_10190253
535 Ga0207676_10237019
536 Ga0207674_10298185
537 Ga0207674_12061662
538 Ga0207698_10213483
539 Ga0207698_10264498
540 Ga0209281_1030866
541 Ga0209983_1009088
542 Ga0209813_10000128
543 Ga0209974_10064635
544 Ga0207428_10108095
545 Ga0268266_10000570
546 Ga0268266_10018275
547 Ga0268266_10056259
548 Ga0268265_10007214
549 Ga0268265_10009936
550 Ga0268265_10996263
551 Ga0268265_12520025
552 Ga0268264_10012741
553 Ga0268264_10056373
554 Ga0268264_10145924
555 Ga0268264_10806538
556 Ga0268264_10919085
557 Ga0268264_11007181
558 Ga0307412_10220920
559 Ga0307415_100793417
560 Ga0316584_0753438
561 Ga0237816_05778
562 Ga0451791_1284749
563 Ga0451807_0253256
564 Ga0451833_0872605
565 Ga0451835_0667417
566 Ga0451837_1866561
567 Ga0451839_0113366
568 Ga0451841_0370428
569 Ga0451841_0880011
570 Ga0451849_0864664
571 Ga0451843_0711289
572 Ga0451853_0145546
573 Ga0450904_016001
574 Ga0451576_1406269
575 Ga0495627_074537
576 Ga0495638_0106402
577 Ga0495650_0159141
578 Ga0495639_0186176
579 Ga0495607_0055333
580 Ga0495607_0066389
581 Ga0495583_0013092
582 Ga0495606_0070145
583 Ga0495610_0000081
584 Ga0495632_0000885
585 Ga0495632_0014747
586 Ga0495632_0164715
587 Ga0495643_0000077
588 Ga0495643_0002357
589 Ga0495654_0034922
590 Ga0495654_0036814
591 Ga0495654_0140404
592 Ga0495609_0007086
593 Ga0495609_0172845
594 Ga0495597_0244800
595 Ga0495597_0327037
596 Ga0495633_0192402
597 Ga0495668_0022069
598 Ga0495668_0219199
599 Ga0495668_0277156
600 Ga0495625_0003157
601 Ga0495625_0063881
602 Ga0495671_0184427
603 Ga0495671_0643786
604 Ga0495681_0187834
605 Ga0495615_0179903
606 Ga0496100_0003466
607 Ga0496100_0007400
608 Ga0496101_0036608
609 Ga0496101_0394564
610 Ga0496102_0001248
611 Ga0496102_0038018
612 Ga0496102_0632441
613 Ga0496103_0000204
614 Ga0496103_0017989
615 Ga0496104_0000236
616 Ga0496104_0119156
617 Ga0496105_0000219
618 Ga0496105_0527025
619 Ga0496105_0570663
620 Ga0496105_1099855
621 Ga0496105_1399307
622 Ga0496106_0000373
623 Ga0496107_0031804
624 Ga0496108_0142563
625 Ga0496108_0645287
626 Ga0496109_0494515
627 Ga0496110_0040563
628 Ga0496110_0088951
629 Ga0496111_0122314
630 Ga0496111_0357466
631 Ga0496111_0361505
632 Ga0496112_0584258
633 Ga0496112_1258122
634 Ga0496113_0001309
635 Ga0496113_0008955
636 Ga0496114_0035773
637 Ga0496114_1433265
638 Ga0496115_0679924
639 Ga0496116_0037623
640 Ga0496117_0000531
641 Ga0496117_0075331
642 Ga0496118_0003512
643 Ga0496118_0159924
644 Ga0496118_0330737
645 Ga0496118_0339200
646 Ga0496119_0000823
647 Ga0496119_0096137
648 Ga0496120_0001376
649 Ga0496120_0131377
650 Ga0496121_0000947
651 Ga0496121_0010615
652 Ga0496122_0135893
653 Ga0496123_0022265
654 Ga0496123_0099072
655 Ga0496124_0003527
656 Ga0496124_0132148
657 Ga0496125_0021358
658 Ga0496125_0157378
659 Ga0496125_0171826
660 Ga0496125_0199733
661 Ga0496126_0000202
662 Ga0496126_0004130
663 Ga0496126_0023930
664 Ga0496126_0048653
665 Ga0501031_0352200
666 Ga0501033_0673265
667 Ga0501034_0480990
668 Ga0501034_1516990
669 Ga0501036_0397815
670 Ga0501037_0739523
671 Ga0501037_1101455
672 Ga0501042_0012906
673 Ga0501043_0272812
674 Ga0501047_0431349
675 Ga0501047_0703326
676 Ga0501048_1250711
677 Ga0501073_0227703
678 Ga0501224_041960
679 Ga0501249_072599
680 Ga0501253_193664
681 Ga0501083_0867894
682 Ga0501035_1006485
683 Ga0501044_0000352
684 Ga0501044_0087684
685 Ga0501044_0531456
686 Ga0501044_0666532
687 Ga0501044_0913391
688 nmdc:mga03683_123780_c1
689 nmdc:mga03683_128_c1
690 nmdc:mga03683_2_c1
691 nmdc:mga03n38_34763_c1
692 nmdc:mga03n38_466_c1
693 nmdc:mga00v17_179240_c1
694 nmdc:mga00v17_297292_c1
695 nmdc:mga00v17_464_c2
696 nmdc:mga0yw44_170514_c1
697 nmdc:mga0k408_156589_c2
698 nmdc:mga0k408_160908_c1
699 nmdc:mga0k408_287610_c1
700 nmdc:mga0k408_2_c1
701 nmdc:mga0k408_42821_c1
702 nmdc:mga0k408_79461_c1
703 nmdc:mga06z11_1156_c1
704 nmdc:mga04h51_141_c1
705 nmdc:mga07m45_13094_c1
706 nmdc:mga07m45_279094_c1
707 nmdc:mga07m45_29_c1
708 nmdc:mga07m45_704775_c1
709 nmdc:mga07m45_9104_c1
710 nmdc:mga08y16_280478_c1
711 nmdc:mga0rr50_971540_c1
712 nmdc:mga0sz30_125_c1
713 nmdc:mga0sz30_128_c1
714 nmdc:mga0sz30_548026_c1
715 Ga0500643_008006
716 Ga0500643_011899
717 Ga0500643_139280
718 Ga0500594_0007529
719 Ga0500595_048183
720 Ga0500607_000009
721 Ga0500607_000183
722 Ga0500608_000057
723 Ga0500618_027378
724 Ga0500559_0000353
725 Ga0500559_0044829
726 Ga0500559_0163745
727 Ga0500564_000444
728 Ga0500568_0110605
729 Ga0500568_0338842
730 Ga0500590_000705
731 Ga0500604_0151132
732 Ga0500604_0248185
733 Ga0500622_0001387
734 Ga0500627_0360885
735 Ga0500637_0034438
736 Ga0500567_000063
737 Ga0500625_000016
738 Ga0500645_000868
739 Ga0500645_020952
740 2848298344
741 2882806776
742 8054306298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01052

FliMN_C

Type III flagellar switch regulator (C-ring) FliN C-term

9

81

0.97

Map