F425669

General Info

Members Datasets Scaffolds Average Seq Length
371 207 742 244

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10097687|Ga0070681_100976871
Length 257
Sequence MGRTPLVAGNWKLHGSRASNRALLDELLGGLAGLPGVECAVCVPFPYLGEVAGQLRGTALAWGAQDVSRHARGAYTGEVAAPMLAEFGCRYVIVGHSERRQLHGESDTQVAGKFAAALDAKLVPILCVGETLEERDAGRTEKVVARQLDEVLTTTGIEAFAGAVVAYEPVWAIGTGRTATPEQAQAVHAFIRKKIFRETRILYGGSVKPDNAVAIFAMPDVDGGLIGGASLVGKDFLAIAGAASRAKAQAKEAAKAK

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
135 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
201 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
202 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
203 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
204 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
205 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
206 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
207 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.04
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10097687 3300005458 Bacteria 2884
2 Ga0070690_100081673 3300005330 Bacteria 2115
3 Ga0068869_100086595 3300005334 Bacteria 2348
4 Ga0070666_10004808 3300005335 Bacteria 8260
5 Ga0070680_100007040 3300005336 Bacteria 8573
6 Ga0070680_100019514 3300005336 Bacteria 5372
7 Ga0070682_100040719 3300005337 Bacteria 2860
8 Ga0070682_100203224 3300005337 Bacteria 1399
9 Ga0068868_100001746 3300005338 Bacteria 14903
10 Ga0068868_100197626 3300005338 Bacteria 1675
11 Ga0070689_100118638 3300005340 Bacteria 2111
12 Ga0070689_100140115 3300005340 Bacteria 1945
13 Ga0070689_100593502 3300005340 Bacteria 959
14 Ga0070691_10025774 3300005341 Bacteria 2739
15 Ga0070692_10045425 3300005345 Bacteria 2265
16 Ga0070692_10263502 3300005345 Bacteria 1037
17 Ga0070673_100184352 3300005364 Bacteria 1788
18 Ga0070667_100026957 3300005367 Bacteria 4780
19 Ga0070667_100044167 3300005367 Bacteria 3741
20 Ga0070703_10016549 3300005406 Bacteria 2117
21 Ga0070710_10079543 3300005437 Bacteria 1911
22 Ga0070701_10053757 3300005438 Bacteria 2097
23 Ga0070705_100014536 3300005440 Bacteria 4052
24 Ga0070705_100069170 3300005440 Bacteria 2128
25 Ga0070700_100002896 3300005441 Bacteria 8816
26 Ga0070700_100012283 3300005441 Bacteria 4772
27 Ga0070700_100044712 3300005441 Bacteria 2729
28 Ga0070700_100155932 3300005441 Bacteria 1567
29 Ga0070694_100025515 3300005444 Bacteria 3824
30 Ga0070694_100045441 3300005444 Bacteria 2943
31 Ga0070694_100549215 3300005444 Bacteria 925
32 Ga0070708_100061428 3300005445 Bacteria 3357
33 Ga0070663_100047503 3300005455 Bacteria 3041
34 Ga0070678_100022581 3300005456 Bacteria 4174
35 Ga0070681_10136486 3300005458 Bacteria 2383
36 Ga0068867_100017867 3300005459 Bacteria 5038
37 Ga0070699_100105821 3300005518 Bacteria 2468
38 Ga0070679_100025349 3300005530 Bacteria 5819
39 Ga0070697_100587991 3300005536 Bacteria 978
40 Ga0068853_100166705 3300005539 Bacteria 1991
41 Ga0070686_100001567 3300005544 Bacteria 12852
42 Ga0070686_100027804 3300005544 Bacteria 3425
43 Ga0070686_100076353 3300005544 Bacteria 2206
44 Ga0070686_100105512 3300005544 Bacteria 1911
45 Ga0070696_100021738 3300005546 Bacteria 4352
46 Ga0070696_100666100 3300005546 Bacteria 845
47 Ga0070693_100004327 3300005547 Bacteria 6701
48 Ga0070665_100033329 3300005548 Bacteria 5184
49 Ga0070665_100045158 3300005548 Bacteria 4424
50 Ga0070665_100271275 3300005548 Bacteria 1698
51 Ga0070665_100488329 3300005548 Bacteria 1242
52 Ga0070704_100145499 3300005549 Bacteria 1856
53 Ga0068855_100006293 3300005563 Bacteria 14471
54 Ga0068855_100132984 3300005563 Bacteria 2840
55 Ga0068855_100283348 3300005563 Bacteria 1839
56 Ga0068854_100006151 3300005578 Bacteria 7617
57 Ga0068854_100007297 3300005578 Bacteria 7061
58 Ga0068856_100004755 3300005614 Bacteria 13478
59 Ga0068859_100046451 3300005617 Bacteria 4361
60 Ga0068859_100147790 3300005617 Bacteria 2425
61 Ga0068866_10001128 3300005718 Bacteria 11730
62 Ga0068861_100041089 3300005719 Bacteria 3463
63 Ga0068861_100109913 3300005719 Bacteria 2207
64 Ga0068851_10037358 3300005834 Bacteria 2434
65 Ga0068870_10145458 3300005840 Bacteria 1391
66 Ga0068863_100006902 3300005841 Bacteria 11127
67 Ga0068858_100049238 3300005842 Bacteria 3902
68 Ga0068858_100106017 3300005842 Bacteria 2623
69 Ga0068860_100136994 3300005843 Bacteria 2351
70 Ga0068862_100039959 3300005844 Bacteria 3986
71 Ga0081540_1009293 3300005983 Bacteria 6782
72 Ga0070715_10287602 3300006163 Bacteria 874
73 Ga0070712_100437890 3300006175 Bacteria 1086
74 Ga0097621_100039893 3300006237 Bacteria 3772
75 Ga0097621_100057592 3300006237 Bacteria 3178
76 Ga0068871_100088876 3300006358 Bacteria 2571
77 Ga0075430_100043668 3300006846 Bacteria 3789
78 Ga0075434_100269943 3300006871 Bacteria 1720
79 Ga0075429_100059321 3300006880 Bacteria 3333
80 Ga0075429_100079145 3300006880 Bacteria 2865
81 Ga0068865_100006446 3300006881 Bacteria 7158
82 Ga0068865_100054811 3300006881 Bacteria 2772
83 Ga0097620_100046451 3300006931 Bacteria 4361
84 Ga0097620_100147801 3300006931 Bacteria 2425
85 Ga0099794_10158296 3300007265 Bacteria 1151
86 Ga0099794_10224098 3300007265 Bacteria 966
87 Ga0099795_10000064 3300007788 Bacteria 18756
88 Ga0105240_10006080 3300009093 Bacteria 17818
89 Ga0105240_10411081 3300009093 Bacteria 1522
90 Ga0111539_10001053 3300009094 Bacteria 36307
91 Ga0111539_10032407 3300009094 Bacteria 6345
92 Ga0105245_10000207 3300009098 Bacteria 55562
93 Ga0105245_10002185 3300009098 Bacteria 17735
94 Ga0105245_10022761 3300009098 Bacteria 5500
95 Ga0105243_10527296 3300009148 Bacteria 1124
96 Ga0105241_10107005 3300009174 Bacteria 2233
97 Ga0105241_10162781 3300009174 Bacteria 1836
98 Ga0105242_10003135 3300009176 Bacteria 12906
99 Ga0105248_10042282 3300009177 Bacteria 5110
100 Ga0105238_10002922 3300009551 Bacteria 17052
101 Ga0105238_10215915 3300009551 Bacteria 1894
102 Ga0105249_10004296 3300009553 Bacteria 12319
103 Ga0099796_10000064 3300010159 Bacteria 18870
104 Ga0105239_10276141 3300010375 Bacteria 1891
105 Ga0105246_10204994 3300011119 Bacteria 1536
106 Ga0105246_10212246 3300011119 Bacteria 1512
107 Ga0157374_10331973 3300013296 Bacteria 1508
108 Ga0157378_10012219 3300013297 Bacteria 7520
109 Ga0163162_10027699 3300013306 Bacteria 5605
110 Ga0163162_10270251 3300013306 Bacteria 1832
111 Ga0163163_10074012 3300014325 Bacteria 3397
112 Ga0163163_10189726 3300014325 Bacteria 2104
113 Ga0157379_10014584 3300014968 Bacteria 6893
114 Ga0182006_1008308 3300015261 Bacteria 4707
115 Ga0207653_10010212 3300025885 Bacteria 2929
116 Ga0207642_10001327 3300025899 Bacteria 7643
117 Ga0207680_10149063 3300025903 Bacteria 1558
118 Ga0207647_10124165 3300025904 Bacteria 1520
119 Ga0207645_10028250 3300025907 Bacteria 3622
120 Ga0207643_10109677 3300025908 Bacteria 1625
121 Ga0207654_10068726 3300025911 Bacteria 2097
122 Ga0207707_10302483 3300025912 Bacteria 1383
123 Ga0207695_10006378 3300025913 Bacteria 15351
124 Ga0207693_10387342 3300025915 Bacteria 1093
125 Ga0207663_10072122 3300025916 Bacteria 2231
126 Ga0207662_10019721 3300025918 Bacteria 3842
127 Ga0207652_10022637 3300025921 Bacteria 5201
128 Ga0207694_10002354 3300025924 Bacteria 15458
129 Ga0207687_10003224 3300025927 Bacteria 11047
130 Ga0207686_10105711 3300025934 Bacteria 1888
131 Ga0207709_10081461 3300025935 Bacteria 2087
132 Ga0207709_10347507 3300025935 Bacteria 1118
133 Ga0207670_10388831 3300025936 Bacteria 1113
134 Ga0207704_10015569 3300025938 Bacteria 3880
135 Ga0207704_10226108 3300025938 Bacteria 1388
136 Ga0207691_10322514 3300025940 Bacteria 1324
137 Ga0207711_10118774 3300025941 Bacteria 2359
138 Ga0207711_10204488 3300025941 Bacteria 1803
139 Ga0207689_10000808 3300025942 Bacteria 30211
140 Ga0207689_10460044 3300025942 Bacteria 1064
141 Ga0207667_10225460 3300025949 Bacteria 1920
142 Ga0207667_10273384 3300025949 Bacteria 1727
143 Ga0207667_10352661 3300025949 Bacteria 1500
144 Ga0207640_10018412 3300025981 Bacteria 4105
145 Ga0207640_10048484 3300025981 Bacteria 2746
146 Ga0207640_10089994 3300025981 Bacteria 2122
147 Ga0207658_10041475 3300025986 Bacteria 3333
148 Ga0207677_10007157 3300026023 Bacteria 6145
149 Ga0207703_10098326 3300026035 Bacteria 2475
150 Ga0207703_10226912 3300026035 Bacteria 1672
151 Ga0207708_10000156 3300026075 Bacteria 54425
152 Ga0207708_10022326 3300026075 Bacteria 4778
153 Ga0207708_10030791 3300026075 Bacteria 4070
154 Ga0207702_10010075 3300026078 Bacteria 7922
155 Ga0207702_10108599 3300026078 Bacteria 2462
156 Ga0207641_10937443 3300026088 Bacteria 861
157 Ga0207648_10005495 3300026089 Bacteria 12773
158 Ga0207648_10028324 3300026089 Bacteria 4968
159 Ga0207674_10232887 3300026116 Bacteria 1790
160 Ga0207675_100001916 3300026118 Bacteria 20757
161 Ga0207675_100032657 3300026118 Bacteria 4848
162 Ga0207683_10059056 3300026121 Bacteria 3368
163 Ga0207698_10481353 3300026142 Bacteria 1204
164 Ga0209967_1003373 3300027364 Bacteria 2104
165 Ga0209984_1004588 3300027424 Bacteria 1632
166 Ga0210000_1004586 3300027462 Bacteria 1993
167 Ga0210000_1006776 3300027462 Bacteria 1669
168 Ga0209995_1001508 3300027471 Bacteria 3598
169 Ga0209179_1000062 3300027512 Bacteria 19549
170 Ga0209999_1004405 3300027543 Bacteria 2533
171 Ga0209999_1025858 3300027543 Bacteria 1084
172 Ga0209983_1035858 3300027665 Bacteria 1065
173 Ga0209998_10010567 3300027717 Bacteria 1912
174 Ga0209974_10006144 3300027876 Bacteria 4208
175 Ga0209974_10012437 3300027876 Bacteria 2845
176 Ga0207428_10076760 3300027907 Bacteria 2616
177 Ga0268266_10192535 3300028379 Bacteria 1862
178 Ga0268266_10279196 3300028379 Bacteria 1553
179 Ga0268265_10087803 3300028380 Bacteria 2475
180 Ga0268264_10044140 3300028381 Bacteria 3697
181 Ga0307409_100871587 3300031995 Bacteria 912
182 Ga0307416_100208868 3300032002 Bacteria 1860
183 Ga0373930_0019612 3300034816 Bacteria 1310
184 Ga0373948_0069441 3300034817 Bacteria 787
185 Ga0373928_0004888 3300035084 Bacteria 2553
186 Ga0373952_0007726 3300035092 Bacteria 2024
187 Ga0373957_0168189 3300035120 Bacteria 905
188 Ga0373960_0001553 3300035121 Bacteria 5120
189 Ga0373960_0046303 3300035121 Bacteria 1276
190 Ga0373942_0002875 3300035207 Bacteria 4089
191 Ga0373931_0031809 3300035691 Bacteria 2726
192 Ga0373933_0130963 3300035724 Bacteria 1577
193 Ga0373937_0104678 3300036401 Bacteria 2629
194 Ga0373937_0116339 3300036401 Bacteria 2490
195 Ga0373937_0463040 3300036401 Bacteria 1204
196 Ga0450895_016630 3300042132 Bacteria 663
197 Ga0450916_017596 3300042530 Bacteria 956
198 Ga0451577_0421502 3300042876 Bacteria 1212
199 Ga0451576_0013427 3300045051 Bacteria 9164
200 Ga0451576_0127344 3300045051 Bacteria 2653
201 Ga0451576_0893250 3300045051 Bacteria 932
202 Ga0495651_0258140 3300046462 Bacteria 1187
203 Ga0495662_0079908 3300046476 Bacteria 1590
204 Ga0495630_0042874 3300046517 Bacteria 3379
205 Ga0495630_0588606 3300046517 Bacteria 853
206 Ga0495652_0160100 3300046529 Bacteria 1749
207 Ga0495640_0115695 3300046533 Bacteria 1747
208 Ga0495586_0014873 3300046535 Bacteria 4137
209 Ga0495581_0159842 3300047315 Bacteria 1317
210 Ga0495604_0369075 3300047317 Bacteria 950
211 Ga0496100_0147586 3300048903 Bacteria 1674
212 Ga0496101_0231700 3300048904 Bacteria 1436
213 Ga0496104_0023749 3300048907 Bacteria 5638
214 Ga0496104_0026317 3300048907 Bacteria 5369
215 Ga0496105_0003364 3300048908 Bacteria 11820
216 Ga0496105_0021670 3300048908 Bacteria 5201
217 Ga0496108_0185787 3300048911 Bacteria 1800
218 Ga0496109_0277447 3300048912 Bacteria 1579
219 Ga0496110_0010653 3300048913 Bacteria 7484
220 Ga0496111_0011111 3300048914 Bacteria 6061
221 Ga0496113_0139479 3300048916 Bacteria 1907
222 Ga0496114_0114323 3300048917 Bacteria 2314
223 Ga0496114_0165346 3300048917 Bacteria 1926
224 Ga0496115_0000065 3300048918 Bacteria 98148
225 Ga0496115_0010343 3300048918 Bacteria 6967
226 Ga0496126_0000185 3300048929 Bacteria 140051
227 Ga0501031_0218497 3300049568 Bacteria 1241
228 Ga0501032_0016305 3300049569 Bacteria 5228
229 Ga0501032_0039625 3300049569 Bacteria 3204
230 Ga0501032_0229655 3300049569 Bacteria 1207
231 Ga0501033_0000932 3300049570 Bacteria 26712
232 Ga0501033_0012536 3300049570 Bacteria 6468
233 Ga0501033_0062603 3300049570 Bacteria 2739
234 Ga0501033_0079624 3300049570 Bacteria 2404
235 Ga0501033_0279804 3300049570 Bacteria 1178
236 Ga0501034_0029587 3300049571 Bacteria 5569
237 Ga0501034_0118487 3300049571 Bacteria 2634
238 Ga0501036_0011786 3300049572 Bacteria 7244
239 Ga0501036_0013407 3300049572 Bacteria 6811
240 Ga0501036_0016284 3300049572 Bacteria 6211
241 Ga0501036_0065380 3300049572 Bacteria 3079
242 Ga0501036_0078884 3300049572 Bacteria 2785
243 Ga0501036_0126351 3300049572 Bacteria 2159
244 Ga0501036_0269236 3300049572 Bacteria 1426
245 Ga0501037_0018823 3300049573 Bacteria 5088
246 Ga0501037_0035810 3300049573 Bacteria 3658
247 Ga0501037_0055041 3300049573 Bacteria 2909
248 Ga0501037_0092833 3300049573 Bacteria 2183
249 Ga0501037_0140223 3300049573 Bacteria 1730
250 Ga0501038_0027250 3300049574 Bacteria 5086
251 Ga0501038_0077509 3300049574 Bacteria 2806
252 Ga0501038_0108060 3300049574 Bacteria 2307
253 Ga0501038_0139380 3300049574 Bacteria 1985
254 Ga0501038_0266630 3300049574 Bacteria 1351
255 Ga0501038_0468940 3300049574 Bacteria 966
256 Ga0501039_0006954 3300049575 Bacteria 8611
257 Ga0501039_0009720 3300049575 Bacteria 7330
258 Ga0501039_0010625 3300049575 Bacteria 7014
259 Ga0501039_0045722 3300049575 Bacteria 3382
260 Ga0501039_0049129 3300049575 Bacteria 3261
261 Ga0501039_0066988 3300049575 Bacteria 2788
262 Ga0501040_0004324 3300049576 Bacteria 9228
263 Ga0501040_0009844 3300049576 Bacteria 6242
264 Ga0501040_0185784 3300049576 Bacteria 1474
265 Ga0501040_0251592 3300049576 Bacteria 1260
266 Ga0501040_0426295 3300049576 Bacteria 954
267 Ga0501041_0001723 3300049577 Bacteria 12268
268 Ga0501041_0014338 3300049577 Bacteria 4705
269 Ga0501041_0280523 3300049577 Bacteria 1048
270 Ga0501042_0022230 3300049578 Bacteria 4431
271 Ga0501042_0057852 3300049578 Bacteria 2766
272 Ga0501042_0086419 3300049578 Bacteria 2249
273 Ga0501042_0087648 3300049578 Bacteria 2233
274 Ga0501042_0191900 3300049578 Bacteria 1473
275 Ga0501043_0017413 3300049579 Bacteria 5633
276 Ga0501043_0107732 3300049579 Bacteria 2188
277 Ga0501043_0123556 3300049579 Bacteria 2030
278 Ga0501043_0128720 3300049579 Bacteria 1984
279 Ga0501043_0476290 3300049579 Bacteria 935
280 Ga0501046_0013983 3300049580 Bacteria 6780
281 Ga0501046_0016394 3300049580 Bacteria 6207
282 Ga0501046_0035196 3300049580 Bacteria 4036
283 Ga0501046_0045841 3300049580 Bacteria 3471
284 Ga0501046_0233550 3300049580 Bacteria 1358
285 Ga0501047_0140002 3300049581 Bacteria 2298
286 Ga0501047_0388314 3300049581 Bacteria 1229
287 Ga0501048_0012339 3300049582 Bacteria 6357
288 Ga0501048_0341675 3300049582 Bacteria 1067
289 Ga0501067_0123900 3300049583 Bacteria 1438
290 Ga0501069_0031658 3300049585 Bacteria 2910
291 Ga0501069_0044794 3300049585 Bacteria 2450
292 Ga0501070_0018821 3300049586 Bacteria 5793
293 Ga0501070_0140840 3300049586 Bacteria 1991
294 Ga0501070_0328777 3300049586 Bacteria 1243
295 Ga0501071_0007738 3300049587 Bacteria 7084
296 Ga0501071_0013644 3300049587 Bacteria 5540
297 Ga0501071_0427396 3300049587 Bacteria 1012
298 Ga0501072_0004225 3300049588 Bacteria 10894
299 Ga0501072_0012854 3300049588 Bacteria 6403
300 Ga0501072_0073484 3300049588 Bacteria 2703
301 Ga0501073_0085397 3300049589 Bacteria 2196
302 Ga0501073_0167974 3300049589 Bacteria 1519
303 Ga0501073_0379835 3300049589 Bacteria 976
304 Ga0501074_0013343 3300049590 Bacteria 5975
305 Ga0501074_0142878 3300049590 Bacteria 1711
306 Ga0501075_0000258 3300049591 Bacteria 28848
307 Ga0501075_0004004 3300049591 Bacteria 9937
308 Ga0501076_0001619 3300049592 Bacteria 15188
309 Ga0501076_0019102 3300049592 Bacteria 5231
310 Ga0501076_0038673 3300049592 Bacteria 3745
311 Ga0501077_0020533 3300049593 Bacteria 4181
312 Ga0501079_0004210 3300049741 Bacteria 10672
313 Ga0501079_0010825 3300049741 Bacteria 6947
314 Ga0501079_0011222 3300049741 Bacteria 6835
315 Ga0501079_0064360 3300049741 Bacteria 2828
316 Ga0501079_0206717 3300049741 Bacteria 1533
317 Ga0501079_0505085 3300049741 Bacteria 950
318 Ga0501080_0003309 3300049742 Bacteria 14235
319 Ga0501080_0009967 3300049742 Bacteria 8683
320 Ga0501080_0026118 3300049742 Bacteria 5425
321 Ga0501080_0324366 3300049742 Bacteria 1393
322 Ga0501081_0000465 3300049743 Bacteria 22458
323 Ga0501081_0093295 3300049743 Bacteria 2119
324 Ga0501081_0159186 3300049743 Bacteria 1626
325 Ga0501081_0218858 3300049743 Bacteria 1384
326 Ga0501081_0246148 3300049743 Bacteria 1304
327 Ga0501083_0030446 3300049744 Bacteria 3708
328 Ga0501083_0048093 3300049744 Bacteria 2880
329 Ga0501083_0128723 3300049744 Bacteria 1659
330 Ga0501035_0041970 3300049822 Bacteria 4128
331 Ga0501035_0063286 3300049822 Bacteria 3290
332 Ga0501035_0071238 3300049822 Bacteria 3078
333 Ga0501035_0323449 3300049822 Bacteria 1295
334 Ga0501044_0044973 3300049823 Bacteria 4578
335 Ga0501044_0048136 3300049823 Bacteria 4405
336 Ga0501044_0220384 3300049823 Bacteria 1848
337 Ga0501045_0003148 3300049824 Bacteria 11283
338 Ga0501045_0005706 3300049824 Bacteria 8614
339 Ga0501045_0115225 3300049824 Bacteria 1993
340 Ga0501045_0141455 3300049824 Bacteria 1789
341 nmdc:mga09592_148576_c1 3300050508 Bacteria 2021
342 nmdc:mga09592_58669_c1 3300050508 Bacteria 3254
343 nmdc:mga0qj67_17061_c1 3300050509 Bacteria 5516
344 nmdc:mga0qj67_71667_c1 3300050509 Bacteria 2766
345 nmdc:mga06r32_663093_c1 3300050510 Bacteria 1011
346 nmdc:mga08y16_3419_c1 3300050511 Bacteria 16470
347 nmdc:mga08y16_75778_c1 3300050511 Bacteria 3506
348 nmdc:mga0rr50_218999_c1 3300050513 Bacteria 1571
349 Ga0495619_0194494 3300053085 Bacteria 1404
350 Ga0500568_0001533 3300053139 Bacteria 14697
351 Ga0501084_0010302 3300054114 Bacteria 7735
352 Ga0501084_0026287 3300054114 Bacteria 4855
353 Ga0501084_0031410 3300054114 Bacteria 4440
354 Ga0501084_0123426 3300054114 Bacteria 2178
355 Ga0501084_0173082 3300054114 Bacteria 1822
356 Ga0501082_0000606 3300060353 Bacteria 31610
357 Ga0501082_0004016 3300060353 Bacteria 12841
358 Ga0501082_0007945 3300060353 Bacteria 9162
359 Ga0501082_0048686 3300060353 Bacteria 3653
360 Ga0501082_0139334 3300060353 Bacteria 2105
361 Ga0530510_0000170 3300061734 Bacteria 39521
362 Ga0530510_0018695 3300061734 Bacteria 4914
363 Ga0530510_0282691 3300061734 Bacteria 1240
364 2526211201 2526164512 Bacteria 4025691
365 2819615148 2818991449 Bacteria 5518009
366 2904441541 2904439833 Bacteria 5931679
367 2904531529 2904530477 Bacteria 5876334
368 2904586834 2904584206 Bacteria 6028872
369 2904593133 2904589729 Bacteria 6113573
370 2904603021 2904601388 Bacteria 5884906
371 2919083958 2919079590 Bacteria 5946433
372 Ga0070681_10097687
373 Ga0070690_100081673
374 Ga0068869_100086595
375 Ga0070666_10004808
376 Ga0070680_100007040
377 Ga0070680_100019514
378 Ga0070682_100040719
379 Ga0070682_100203224
380 Ga0068868_100001746
381 Ga0068868_100197626
382 Ga0070689_100118638
383 Ga0070689_100140115
384 Ga0070689_100593502
385 Ga0070691_10025774
386 Ga0070692_10045425
387 Ga0070692_10263502
388 Ga0070673_100184352
389 Ga0070667_100026957
390 Ga0070667_100044167
391 Ga0070703_10016549
392 Ga0070710_10079543
393 Ga0070701_10053757
394 Ga0070705_100014536
395 Ga0070705_100069170
396 Ga0070700_100002896
397 Ga0070700_100012283
398 Ga0070700_100044712
399 Ga0070700_100155932
400 Ga0070694_100025515
401 Ga0070694_100045441
402 Ga0070694_100549215
403 Ga0070708_100061428
404 Ga0070663_100047503
405 Ga0070678_100022581
406 Ga0070681_10136486
407 Ga0068867_100017867
408 Ga0070699_100105821
409 Ga0070679_100025349
410 Ga0070697_100587991
411 Ga0068853_100166705
412 Ga0070686_100001567
413 Ga0070686_100027804
414 Ga0070686_100076353
415 Ga0070686_100105512
416 Ga0070696_100021738
417 Ga0070696_100666100
418 Ga0070693_100004327
419 Ga0070665_100033329
420 Ga0070665_100045158
421 Ga0070665_100271275
422 Ga0070665_100488329
423 Ga0070704_100145499
424 Ga0068855_100006293
425 Ga0068855_100132984
426 Ga0068855_100283348
427 Ga0068854_100006151
428 Ga0068854_100007297
429 Ga0068856_100004755
430 Ga0068859_100046451
431 Ga0068859_100147790
432 Ga0068866_10001128
433 Ga0068861_100041089
434 Ga0068861_100109913
435 Ga0068851_10037358
436 Ga0068870_10145458
437 Ga0068863_100006902
438 Ga0068858_100049238
439 Ga0068858_100106017
440 Ga0068860_100136994
441 Ga0068862_100039959
442 Ga0081540_1009293
443 Ga0070715_10287602
444 Ga0070712_100437890
445 Ga0097621_100039893
446 Ga0097621_100057592
447 Ga0068871_100088876
448 Ga0075430_100043668
449 Ga0075434_100269943
450 Ga0075429_100059321
451 Ga0075429_100079145
452 Ga0068865_100006446
453 Ga0068865_100054811
454 Ga0097620_100046451
455 Ga0097620_100147801
456 Ga0099794_10158296
457 Ga0099794_10224098
458 Ga0099795_10000064
459 Ga0105240_10006080
460 Ga0105240_10411081
461 Ga0111539_10001053
462 Ga0111539_10032407
463 Ga0105245_10000207
464 Ga0105245_10002185
465 Ga0105245_10022761
466 Ga0105243_10527296
467 Ga0105241_10107005
468 Ga0105241_10162781
469 Ga0105242_10003135
470 Ga0105248_10042282
471 Ga0105238_10002922
472 Ga0105238_10215915
473 Ga0105249_10004296
474 Ga0099796_10000064
475 Ga0105239_10276141
476 Ga0105246_10204994
477 Ga0105246_10212246
478 Ga0157374_10331973
479 Ga0157378_10012219
480 Ga0163162_10027699
481 Ga0163162_10270251
482 Ga0163163_10074012
483 Ga0163163_10189726
484 Ga0157379_10014584
485 Ga0182006_1008308
486 Ga0207653_10010212
487 Ga0207642_10001327
488 Ga0207680_10149063
489 Ga0207647_10124165
490 Ga0207645_10028250
491 Ga0207643_10109677
492 Ga0207654_10068726
493 Ga0207707_10302483
494 Ga0207695_10006378
495 Ga0207693_10387342
496 Ga0207663_10072122
497 Ga0207662_10019721
498 Ga0207652_10022637
499 Ga0207694_10002354
500 Ga0207687_10003224
501 Ga0207686_10105711
502 Ga0207709_10081461
503 Ga0207709_10347507
504 Ga0207670_10388831
505 Ga0207704_10015569
506 Ga0207704_10226108
507 Ga0207691_10322514
508 Ga0207711_10118774
509 Ga0207711_10204488
510 Ga0207689_10000808
511 Ga0207689_10460044
512 Ga0207667_10225460
513 Ga0207667_10273384
514 Ga0207667_10352661
515 Ga0207640_10018412
516 Ga0207640_10048484
517 Ga0207640_10089994
518 Ga0207658_10041475
519 Ga0207677_10007157
520 Ga0207703_10098326
521 Ga0207703_10226912
522 Ga0207708_10000156
523 Ga0207708_10022326
524 Ga0207708_10030791
525 Ga0207702_10010075
526 Ga0207702_10108599
527 Ga0207641_10937443
528 Ga0207648_10005495
529 Ga0207648_10028324
530 Ga0207674_10232887
531 Ga0207675_100001916
532 Ga0207675_100032657
533 Ga0207683_10059056
534 Ga0207698_10481353
535 Ga0209967_1003373
536 Ga0209984_1004588
537 Ga0210000_1004586
538 Ga0210000_1006776
539 Ga0209995_1001508
540 Ga0209179_1000062
541 Ga0209999_1004405
542 Ga0209999_1025858
543 Ga0209983_1035858
544 Ga0209998_10010567
545 Ga0209974_10006144
546 Ga0209974_10012437
547 Ga0207428_10076760
548 Ga0268266_10192535
549 Ga0268266_10279196
550 Ga0268265_10087803
551 Ga0268264_10044140
552 Ga0307409_100871587
553 Ga0307416_100208868
554 Ga0373930_0019612
555 Ga0373948_0069441
556 Ga0373928_0004888
557 Ga0373952_0007726
558 Ga0373957_0168189
559 Ga0373960_0001553
560 Ga0373960_0046303
561 Ga0373942_0002875
562 Ga0373931_0031809
563 Ga0373933_0130963
564 Ga0373937_0104678
565 Ga0373937_0116339
566 Ga0373937_0463040
567 Ga0450895_016630
568 Ga0450916_017596
569 Ga0451577_0421502
570 Ga0451576_0013427
571 Ga0451576_0127344
572 Ga0451576_0893250
573 Ga0495651_0258140
574 Ga0495662_0079908
575 Ga0495630_0042874
576 Ga0495630_0588606
577 Ga0495652_0160100
578 Ga0495640_0115695
579 Ga0495586_0014873
580 Ga0495581_0159842
581 Ga0495604_0369075
582 Ga0496100_0147586
583 Ga0496101_0231700
584 Ga0496104_0023749
585 Ga0496104_0026317
586 Ga0496105_0003364
587 Ga0496105_0021670
588 Ga0496108_0185787
589 Ga0496109_0277447
590 Ga0496110_0010653
591 Ga0496111_0011111
592 Ga0496113_0139479
593 Ga0496114_0114323
594 Ga0496114_0165346
595 Ga0496115_0000065
596 Ga0496115_0010343
597 Ga0496126_0000185
598 Ga0501031_0218497
599 Ga0501032_0016305
600 Ga0501032_0039625
601 Ga0501032_0229655
602 Ga0501033_0000932
603 Ga0501033_0012536
604 Ga0501033_0062603
605 Ga0501033_0079624
606 Ga0501033_0279804
607 Ga0501034_0029587
608 Ga0501034_0118487
609 Ga0501036_0011786
610 Ga0501036_0013407
611 Ga0501036_0016284
612 Ga0501036_0065380
613 Ga0501036_0078884
614 Ga0501036_0126351
615 Ga0501036_0269236
616 Ga0501037_0018823
617 Ga0501037_0035810
618 Ga0501037_0055041
619 Ga0501037_0092833
620 Ga0501037_0140223
621 Ga0501038_0027250
622 Ga0501038_0077509
623 Ga0501038_0108060
624 Ga0501038_0139380
625 Ga0501038_0266630
626 Ga0501038_0468940
627 Ga0501039_0006954
628 Ga0501039_0009720
629 Ga0501039_0010625
630 Ga0501039_0045722
631 Ga0501039_0049129
632 Ga0501039_0066988
633 Ga0501040_0004324
634 Ga0501040_0009844
635 Ga0501040_0185784
636 Ga0501040_0251592
637 Ga0501040_0426295
638 Ga0501041_0001723
639 Ga0501041_0014338
640 Ga0501041_0280523
641 Ga0501042_0022230
642 Ga0501042_0057852
643 Ga0501042_0086419
644 Ga0501042_0087648
645 Ga0501042_0191900
646 Ga0501043_0017413
647 Ga0501043_0107732
648 Ga0501043_0123556
649 Ga0501043_0128720
650 Ga0501043_0476290
651 Ga0501046_0013983
652 Ga0501046_0016394
653 Ga0501046_0035196
654 Ga0501046_0045841
655 Ga0501046_0233550
656 Ga0501047_0140002
657 Ga0501047_0388314
658 Ga0501048_0012339
659 Ga0501048_0341675
660 Ga0501067_0123900
661 Ga0501069_0031658
662 Ga0501069_0044794
663 Ga0501070_0018821
664 Ga0501070_0140840
665 Ga0501070_0328777
666 Ga0501071_0007738
667 Ga0501071_0013644
668 Ga0501071_0427396
669 Ga0501072_0004225
670 Ga0501072_0012854
671 Ga0501072_0073484
672 Ga0501073_0085397
673 Ga0501073_0167974
674 Ga0501073_0379835
675 Ga0501074_0013343
676 Ga0501074_0142878
677 Ga0501075_0000258
678 Ga0501075_0004004
679 Ga0501076_0001619
680 Ga0501076_0019102
681 Ga0501076_0038673
682 Ga0501077_0020533
683 Ga0501079_0004210
684 Ga0501079_0010825
685 Ga0501079_0011222
686 Ga0501079_0064360
687 Ga0501079_0206717
688 Ga0501079_0505085
689 Ga0501080_0003309
690 Ga0501080_0009967
691 Ga0501080_0026118
692 Ga0501080_0324366
693 Ga0501081_0000465
694 Ga0501081_0093295
695 Ga0501081_0159186
696 Ga0501081_0218858
697 Ga0501081_0246148
698 Ga0501083_0030446
699 Ga0501083_0048093
700 Ga0501083_0128723
701 Ga0501035_0041970
702 Ga0501035_0063286
703 Ga0501035_0071238
704 Ga0501035_0323449
705 Ga0501044_0044973
706 Ga0501044_0048136
707 Ga0501044_0220384
708 Ga0501045_0003148
709 Ga0501045_0005706
710 Ga0501045_0115225
711 Ga0501045_0141455
712 nmdc:mga09592_148576_c1
713 nmdc:mga09592_58669_c1
714 nmdc:mga0qj67_17061_c1
715 nmdc:mga0qj67_71667_c1
716 nmdc:mga06r32_663093_c1
717 nmdc:mga08y16_3419_c1
718 nmdc:mga08y16_75778_c1
719 nmdc:mga0rr50_218999_c1
720 Ga0495619_0194494
721 Ga0500568_0001533
722 Ga0501084_0010302
723 Ga0501084_0026287
724 Ga0501084_0031410
725 Ga0501084_0123426
726 Ga0501084_0173082
727 Ga0501082_0000606
728 Ga0501082_0004016
729 Ga0501082_0007945
730 Ga0501082_0048686
731 Ga0501082_0139334
732 Ga0530510_0000170
733 Ga0530510_0018695
734 Ga0530510_0282691
735 2526211201
736 2819615148
737 2904441541
738 2904531529
739 2904586834
740 2904593133
741 2904603021
742 2919083958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

5

243

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1k-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from burkholderia thailandensis 0.9457 1 229
4g1k-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from burkholderia thailandensis 0.9417 1 229
7rgc-assembly1.cif.gz_B-3 crystal structure of triosephosphate isomerase from candidatus absconditabacteria (sr1) bacterium 0.9408 1 228
6w4u-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from stenotrophomonas maltophilia k279a 0.9381 1 228
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9377 1 227
ID Description Score Start End Superfamily
4g1kC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9457 1 229 3.20.20.70
4g1kC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9417 1 229 3.20.20.70
1m6jA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.936 2 228 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9346 1 228 3.20.20.70
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9309 1 227 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6L5DAW1-F1-model_v4 deleted 0.9617 1 141
AF-A0A383A3U4-F1-model_v4 Triosephosphate isomerase 0.9603 1 141 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-M1WXY7-F1-model_v4 deleted 0.9566 29 226
AF-A0A5C6QDZ9-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9552 1 226 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A258UQU0-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9535 1 135 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map