F425668

General Info

Members Datasets Scaffolds Average Seq Length
371 173 371 528

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10004273|Ga0070681_1000427311
Length 594
Sequence MRRFIREWHGSRVLRSMDPHLLNASAVADQCPAVAFLTADSASKKGLEMNRPAKLLCHVITAAFLALAVGGFAAPVTLHAQGAISQPKGDPTGAATGTAADVPVKDAKSPTLAEVMETVGHNKIAINFVWTLLAGFLVMFMQAGFAMVETGFTRAKNAAHTMCMNFMIYPIGMLGYWICGYALQMGGVGAVAALGGTAPLNHEVTVNLFGHSFGLFGTQGFFLSGNTYDVGVFALFLFQMVFMDTAGTIPTGAMAERWKFSAFVVFGFFMSMVVYPIFANWVWGAGWLSQLGAQFGLGHGHVDFAGSSVVHMVGGVAALAGAIIIGPRIGKYTKTGEPVAIPGHDLPMAIAGTFILAFGWFGFNPGSTLAGGDLRIAVVATNTMLAGTGGAIAAMFYVWRRLGKPDPSMIVNGLLAGLVAITAPCAFVNSVSSVVIGAIAGILVVESVLFIERVLKLDDPVGAISVHGVCGAFGVLCVGIFADGSYGDGWNGVPGTVKGLLYGDASQFAAQCVGTLTCFVWVFVLFFAFFKLIEATMGNRVSAETELEGLDIPEMGALAYPDFVLGPGTPMGGMAAKPSKAQAAAPALTPVRVE

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 0.54
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2139811 2162886006 Bacteria 1831
2 JGI24746J21847_1002617 3300001977 Bacteria 2850
3 JGI25406J46586_10005490 3300003203 Bacteria 5878
4 Ga0065712_10069742 3300005290 Bacteria 6771
5 Ga0065715_10090281 3300005293 Bacteria 7285
6 Ga0065715_10126129 3300005293 Bacteria 2115
7 Ga0065707_10001611 3300005295 Bacteria 6002
8 Ga0065707_10008887 3300005295 Bacteria 3688
9 Ga0065707_10085889 3300005295 Bacteria 5812
10 Ga0065707_10090506 3300005295 Bacteria 4126
11 Ga0070658_10009227 3300005327 Bacteria 7930
12 Ga0070676_10002887 3300005328 Bacteria 8873
13 Ga0070690_100006934 3300005330 Bacteria 6448
14 Ga0070670_100000466 3300005331 Bacteria 32818
15 Ga0070670_100002940 3300005331 Bacteria 14107
16 Ga0070677_10020323 3300005333 Bacteria 2418
17 Ga0070677_10032779 3300005333 Bacteria 1996
18 Ga0068869_100004857 3300005334 Bacteria 8399
19 Ga0068869_100044296 3300005334 Bacteria 3199
20 Ga0068869_100131947 3300005334 Bacteria 1921
21 Ga0070666_10041805 3300005335 Bacteria 3064
22 Ga0070689_100000002 3300005340 Bacteria 695141
23 Ga0070689_100004705 3300005340 Bacteria 9257
24 Ga0070689_100067582 3300005340 Bacteria 2786
25 Ga0070689_100151867 3300005340 Bacteria 1868
26 Ga0070687_100000854 3300005343 Bacteria 10203
27 Ga0070661_100010156 3300005344 Bacteria 6539
28 Ga0070692_10053014 3300005345 Bacteria 2114
29 Ga0070668_100036866 3300005347 Bacteria 3732
30 Ga0070669_100001659 3300005353 Bacteria 16100
31 Ga0070675_100031053 3300005354 Bacteria 4317
32 Ga0070675_100038817 3300005354 Bacteria 3883
33 Ga0070675_100066868 3300005354 Bacteria 2973
34 Ga0070671_100043942 3300005355 Bacteria 3713
35 Ga0070674_100064536 3300005356 Bacteria 2566
36 Ga0070673_100007741 3300005364 Bacteria 7109
37 Ga0070673_100007748 3300005364 Bacteria 7107
38 Ga0070673_100026715 3300005364 Bacteria 4268
39 Ga0070688_100008139 3300005365 Bacteria 5681
40 Ga0070688_100015352 3300005365 Bacteria 4357
41 Ga0070667_100008255 3300005367 Bacteria 8630
42 Ga0070701_10033065 3300005438 Bacteria 2581
43 Ga0070701_10036188 3300005438 Bacteria 2486
44 Ga0070705_100009978 3300005440 Bacteria 4741
45 Ga0070705_100028756 3300005440 Bacteria 3048
46 Ga0070694_100001174 3300005444 Bacteria 15027
47 Ga0070694_100030296 3300005444 Bacteria 3538
48 Ga0070694_100060327 3300005444 Bacteria 2586
49 Ga0070694_100093754 3300005444 Bacteria 2111
50 Ga0070708_100028505 3300005445 Bacteria 4805
51 Ga0070678_100007566 3300005456 Bacteria 6453
52 Ga0070662_100001408 3300005457 Bacteria 14835
53 Ga0070681_10004273 3300005458 Bacteria 13558
54 Ga0070685_10015714 3300005466 Bacteria 4023
55 Ga0070706_100000137 3300005467 Bacteria 91778
56 Ga0070706_100120625 3300005467 Bacteria 2444
57 Ga0070707_100005237 3300005468 Bacteria 12134
58 Ga0070707_100139664 3300005468 Bacteria 2358
59 Ga0070707_100179638 3300005468 Bacteria 2063
60 Ga0070698_100004539 3300005471 Bacteria 15254
61 Ga0070698_100010984 3300005471 Bacteria 9632
62 Ga0070698_100092811 3300005471 Bacteria 2999
63 Ga0070699_100002027 3300005518 Bacteria 18299
64 Ga0070699_100002355 3300005518 Bacteria 16957
65 Ga0070699_100013575 3300005518 Bacteria 7012
66 Ga0070699_100032869 3300005518 Bacteria 4481
67 Ga0070679_100150733 3300005530 Bacteria 2302
68 Ga0070684_100130926 3300005535 Bacteria 2263
69 Ga0070697_100000934 3300005536 Bacteria 21968
70 Ga0070697_100001081 3300005536 Bacteria 20597
71 Ga0070697_100134707 3300005536 Bacteria 2074
72 Ga0070672_100037078 3300005543 Bacteria 3718
73 Ga0070686_100003119 3300005544 Bacteria 9086
74 Ga0070695_100000015 3300005545 Bacteria 67427
75 Ga0070695_100052857 3300005545 Bacteria 2611
76 Ga0070695_100073261 3300005545 Bacteria 2247
77 Ga0070696_100000033 3300005546 Bacteria 63922
78 Ga0070665_100016935 3300005548 Bacteria 7307
79 Ga0070664_100001768 3300005564 Bacteria 17327
80 Ga0070664_100003392 3300005564 Bacteria 12864
81 Ga0068857_100009188 3300005577 Bacteria 8580
82 Ga0068857_100119122 3300005577 Unclassified 2376
83 Ga0070702_100003703 3300005615 Bacteria 6889
84 Ga0068859_100012201 3300005617 Bacteria 8639
85 Ga0068859_100114240 3300005617 Unclassified 2764
86 Ga0068859_100170507 3300005617 Bacteria 2257
87 Ga0068864_100006048 3300005618 Bacteria 9933
88 Ga0068864_100011080 3300005618 Bacteria 7451
89 Ga0068864_100011340 3300005618 Bacteria 7364
90 Ga0068864_100021817 3300005618 Bacteria 5366
91 Ga0068864_100071158 3300005618 Bacteria 3028
92 Ga0068866_10007218 3300005718 Bacteria 4649
93 Ga0068861_100000740 3300005719 Bacteria 19590
94 Ga0068861_100017450 3300005719 Bacteria 5097
95 Ga0068861_100049506 3300005719 Unclassified 3182
96 Ga0068861_100077421 3300005719 Bacteria 2594
97 Ga0068870_10004140 3300005840 Bacteria 6213
98 Ga0068870_10005995 3300005840 Bacteria 5339
99 Ga0068870_10022149 3300005840 Bacteria 3119
100 Ga0068863_100014762 3300005841 Bacteria 7513
101 Ga0068858_100008652 3300005842 Bacteria 9774
102 Ga0068858_100024706 3300005842 Bacteria 5596
103 Ga0068858_100125390 3300005842 Bacteria 2404
104 Ga0068860_100003888 3300005843 Bacteria 15348
105 Ga0068860_100004343 3300005843 Bacteria 14481
106 Ga0068860_100005021 3300005843 Bacteria 13466
107 Ga0068860_100018522 3300005843 Bacteria 6772
108 Ga0068860_100043157 3300005843 Bacteria 4303
109 Ga0068862_100004788 3300005844 Bacteria 11391
110 Ga0081455_10017217 3300005937 Bacteria 6937
111 Ga0081539_10000142 3300005985 Bacteria 165444
112 Ga0075368_10004709 3300006042 Bacteria 4640
113 Ga0075364_10005697 3300006051 Bacteria 7264
114 Ga0075364_10087833 3300006051 Bacteria 2061
115 Ga0075367_10004535 3300006178 Bacteria 6793
116 Ga0097621_100077195 3300006237 Bacteria 2765
117 Ga0075370_10016241 3300006353 Bacteria 4003
118 Ga0068871_100003365 3300006358 Bacteria 10989
119 Ga0068871_100023753 3300006358 Bacteria 4746
120 Ga0075428_100023435 3300006844 Bacteria 6832
121 Ga0075428_100076805 3300006844 Bacteria 3646
122 Ga0075428_100128464 3300006844 Bacteria 2757
123 Ga0075430_100018946 3300006846 Bacteria 5856
124 Ga0075430_100094272 3300006846 Bacteria 2502
125 Ga0075431_100014119 3300006847 Bacteria 8073
126 Ga0075431_100019077 3300006847 Bacteria 6987
127 Ga0075431_100033269 3300006847 Bacteria 5314
128 Ga0075431_100034253 3300006847 Bacteria 5232
129 Ga0075431_100068824 3300006847 Bacteria 3653
130 Ga0075433_10001670 3300006852 Bacteria 16530
131 Ga0075433_10003094 3300006852 Bacteria 12796
132 Ga0075433_10008792 3300006852 Bacteria 8059
133 Ga0075433_10012459 3300006852 Bacteria 6873
134 Ga0075433_10015184 3300006852 Bacteria 6311
135 Ga0075433_10024847 3300006852 Bacteria 5061
136 Ga0075433_10048834 3300006852 Bacteria 3681
137 Ga0075433_10080923 3300006852 Bacteria 2863
138 Ga0075433_10112949 3300006852 Bacteria 2410
139 Ga0075434_100002005 3300006871 Bacteria 17674
140 Ga0075434_100002312 3300006871 Bacteria 16680
141 Ga0075434_100004047 3300006871 Bacteria 13149
142 Ga0075434_100005030 3300006871 Bacteria 12002
143 Ga0075434_100005747 3300006871 Bacteria 11326
144 Ga0075434_100027133 3300006871 Bacteria 5620
145 Ga0075434_100049228 3300006871 Bacteria 4184
146 Ga0075434_100090834 3300006871 Bacteria 3055
147 Ga0075434_100123839 3300006871 Bacteria 2602
148 Ga0075429_100015880 3300006880 Bacteria 6519
149 Ga0075429_100016225 3300006880 Bacteria 6454
150 Ga0075429_100061729 3300006880 Bacteria 3265
151 Ga0068865_100015676 3300006881 Bacteria 4836
152 Ga0075436_100008473 3300006914 Bacteria 7030
153 Ga0097620_100012201 3300006931 Bacteria 8639
154 Ga0097620_100114246 3300006931 Unclassified 2764
155 Ga0097620_100170505 3300006931 Bacteria 2257
156 Ga0075435_100007665 3300007076 Bacteria 7709
157 Ga0075435_100034317 3300007076 Bacteria 4019
158 Ga0075435_100053164 3300007076 Bacteria 3265
159 Ga0075435_100122175 3300007076 Bacteria 2174
160 Ga0105240_10024784 3300009093 Bacteria 7900
161 Ga0111539_10000235 3300009094 Bacteria 66044
162 Ga0111539_10030550 3300009094 Bacteria 6547
163 Ga0111539_10046398 3300009094 Bacteria 5197
164 Ga0111539_10052268 3300009094 Unclassified 4864
165 Ga0111539_10150852 3300009094 Bacteria 2720
166 Ga0105247_10001515 3300009101 Bacteria 16614
167 Ga0114129_10003354 3300009147 Bacteria 22490
168 Ga0114129_10007382 3300009147 Bacteria 15645
169 Ga0114129_10009655 3300009147 Bacteria 13770
170 Ga0114129_10014364 3300009147 Bacteria 11287
171 Ga0114129_10022173 3300009147 Bacteria 9015
172 Ga0114129_10024368 3300009147 Bacteria 8575
173 Ga0114129_10025792 3300009147 Bacteria 8325
174 Ga0114129_10032920 3300009147 Bacteria 7325
175 Ga0114129_10046919 3300009147 Bacteria 6071
176 Ga0114129_10047985 3300009147 Bacteria 5999
177 Ga0114129_10048760 3300009147 Bacteria 5952
178 Ga0114129_10077496 3300009147 Bacteria 4623
179 Ga0114129_10120817 3300009147 Bacteria 3607
180 Ga0114129_10183893 3300009147 Bacteria 2842
181 Ga0114129_10196678 3300009147 Bacteria 2733
182 Ga0114129_10271720 3300009147 Bacteria 2268
183 Ga0105243_10002119 3300009148 Bacteria 16790
184 Ga0105243_10064542 3300009148 Bacteria 2939
185 Ga0105241_10137282 3300009174 Unclassified 1987
186 Ga0105242_10041706 3300009176 Bacteria 3703
187 Ga0105242_10070573 3300009176 Bacteria 2896
188 Ga0105248_10006640 3300009177 Bacteria 12687
189 Ga0105237_10001379 3300009545 Bacteria 32073
190 Ga0105238_10018461 3300009551 Bacteria 7098
191 Ga0105238_10020324 3300009551 Bacteria 6759
192 Ga0105249_10004714 3300009553 Bacteria 11772
193 Ga0163162_10015736 3300013306 Bacteria 7393
194 Ga0163162_10166726 3300013306 Unclassified 2327
195 Ga0157375_10025746 3300013308 Bacteria 5473
196 Ga0157375_10068848 3300013308 Bacteria 3543
197 Ga0163163_10003421 3300014325 Bacteria 13486
198 Ga0163163_10035980 3300014325 Bacteria 4806
199 Ga0163163_10064434 3300014325 Bacteria 3636
200 Ga0163163_10143867 3300014325 Bacteria 2427
201 Ga0163163_10215030 3300014325 Bacteria 1971
202 Ga0157380_10001061 3300014326 Bacteria 17614
203 Ga0157377_10002735 3300014745 Bacteria 7846
204 Ga0157377_10006365 3300014745 Bacteria 5626
205 Ga0157379_10009028 3300014968 Bacteria 8685
206 Ga0157376_10027870 3300014969 Bacteria 4483
207 Ga0157376_10041616 3300014969 Bacteria 3763
208 Ga0163161_10002269 3300017792 Bacteria 13791
209 Ga0207697_10002259 3300025315 Bacteria 10070
210 Ga0207682_10001089 3300025893 Bacteria 12553
211 Ga0207710_10000402 3300025900 Bacteria 28743
212 Ga0207688_10001460 3300025901 Bacteria 12387
213 Ga0207645_10000714 3300025907 Bacteria 27661
214 Ga0207643_10001288 3300025908 Bacteria 14613
215 Ga0207643_10073213 3300025908 Bacteria 1975
216 Ga0207684_10001486 3300025910 Bacteria 25217
217 Ga0207684_10038066 3300025910 Bacteria 4082
218 Ga0207707_10048317 3300025912 Bacteria 3706
219 Ga0207695_10001139 3300025913 Bacteria 46090
220 Ga0207671_10000195 3300025914 Bacteria 94152
221 Ga0207662_10001609 3300025918 Bacteria 11058
222 Ga0207649_10025661 3300025920 Bacteria 3438
223 Ga0207652_10022565 3300025921 Bacteria 5207
224 Ga0207646_10003508 3300025922 Bacteria 17671
225 Ga0207646_10007396 3300025922 Bacteria 11171
226 Ga0207646_10081751 3300025922 Bacteria 2889
227 Ga0207681_10021647 3300025923 Bacteria 4090
228 Ga0207694_10003208 3300025924 Bacteria 13038
229 Ga0207694_10016235 3300025924 Bacteria 5619
230 Ga0207694_10022892 3300025924 Bacteria 4740
231 Ga0207650_10007728 3300025925 Bacteria 7327
232 Ga0207650_10027297 3300025925 Bacteria 4085
233 Ga0207659_10002831 3300025926 Bacteria 10353
234 Ga0207659_10011751 3300025926 Bacteria 5542
235 Ga0207659_10018289 3300025926 Bacteria 4591
236 Ga0207659_10026260 3300025926 Bacteria 3928
237 Ga0207644_10029447 3300025931 Bacteria 3810
238 Ga0207706_10002685 3300025933 Bacteria 17343
239 Ga0207709_10004362 3300025935 Bacteria 8187
240 Ga0207670_10000001 3300025936 Bacteria 949312
241 Ga0207670_10026524 3300025936 Bacteria 3652
242 Ga0207670_10101481 3300025936 Bacteria 2056
243 Ga0207669_10098798 3300025937 Bacteria 1923
244 Ga0207704_10048015 3300025938 Bacteria 2557
245 Ga0207691_10009150 3300025940 Bacteria 9505
246 Ga0207691_10010406 3300025940 Bacteria 8923
247 Ga0207691_10012154 3300025940 Bacteria 8253
248 Ga0207691_10020413 3300025940 Bacteria 6263
249 Ga0207711_10064045 3300025941 Bacteria 3174
250 Ga0207689_10009815 3300025942 Bacteria 8250
251 Ga0207689_10023563 3300025942 Bacteria 5164
252 Ga0207689_10047051 3300025942 Bacteria 3563
253 Ga0207689_10108360 3300025942 Bacteria 2283
254 Ga0207679_10014699 3300025945 Bacteria 5153
255 Ga0207679_10048973 3300025945 Bacteria 3079
256 Ga0207679_10051246 3300025945 Bacteria 3021
257 Ga0207679_10151948 3300025945 Bacteria 1886
258 Ga0207651_10009784 3300025960 Bacteria 5272
259 Ga0207703_10017338 3300026035 Bacteria 5621
260 Ga0207703_10109622 3300026035 Bacteria 2353
261 Ga0207641_10028852 3300026088 Bacteria 4586
262 Ga0207641_10073190 3300026088 Bacteria 2953
263 Ga0207641_10092886 3300026088 Bacteria 2644
264 Ga0207648_10027190 3300026089 Bacteria 5081
265 Ga0207648_10043837 3300026089 Bacteria 3927
266 Ga0207676_10010817 3300026095 Bacteria 6507
267 Ga0207676_10017924 3300026095 Bacteria 5138
268 Ga0207674_10001956 3300026116 Bacteria 26100
269 Ga0207683_10009639 3300026121 Bacteria 8230
270 Ga0207683_10030931 3300026121 Bacteria 4643
271 Ga0207683_10047958 3300026121 Bacteria 3740
272 Ga0207698_10140796 3300026142 Bacteria 2078
273 Ga0209813_10003405 3300027866 Bacteria 3721
274 Ga0207428_10022313 3300027907 Bacteria 5345
275 Ga0207428_10064046 3300027907 Unclassified 2903
276 Ga0207428_10086020 3300027907 Bacteria 2447
277 Ga0268265_10009565 3300028380 Bacteria 6546
278 Ga0268264_10003010 3300028381 Bacteria 14615
279 Ga0268264_10014453 3300028381 Bacteria 6487
280 Ga0268264_10095443 3300028381 Bacteria 2573
281 Ga0265318_10000166 3300028577 Bacteria 58208
282 Ga0265338_10091680 3300028800 Unclassified 2509
283 Ga0265330_10000136 3300031235 Bacteria 59231
284 Ga0265332_10001705 3300031238 Bacteria 11977
285 Ga0265320_10000052 3300031240 Bacteria 113701
286 Ga0265329_10006320 3300031242 Bacteria 4708
287 Ga0265331_10000001 3300031250 Bacteria 798836
288 Ga0265316_10000842 3300031344 Bacteria 33947
289 Ga0265316_10007189 3300031344 Bacteria 10519
290 Ga0265316_10031279 3300031344 Bacteria 4354
291 Ga0265313_10002511 3300031595 Bacteria 15784
292 Ga0265313_10018080 3300031595 Bacteria 3973
293 Ga0265314_10000305 3300031711 Bacteria 70153
294 Ga0265342_10023854 3300031712 Bacteria 3866
295 Ga0395900_0048174 3300037418 Bacteria 4390
296 Ga0395898_0048707 3300037466 Bacteria 4154
297 Ga0395898_0059991 3300037466 Bacteria 3699
298 Ga0395905_0009855 3300037471 Bacteria 9313
299 Ga0395905_0062130 3300037471 Bacteria 3494
300 Ga0395901_0058337 3300038443 Bacteria 4015
301 Ga0451577_0005929 3300042876 Bacteria 12319
302 Ga0451577_0020135 3300042876 Bacteria 6126
303 Ga0451577_0022759 3300042876 Bacteria 5721
304 Ga0451576_0008171 3300045051 Bacteria 12319
305 Ga0451576_0023101 3300045051 Bacteria 6737
306 Ga0451576_0103097 3300045051 Unclassified 2968
307 Ga0451576_0162820 3300045051 Bacteria 2328
308 Ga0495638_0014116 3300046460 Bacteria 5410
309 Ga0495628_0036197 3300046516 Bacteria 3963
310 Ga0495630_0041666 3300046517 Bacteria 3429
311 Ga0495621_0010321 3300046539 Bacteria 2853
312 Ga0495634_0022559 3300046642 Bacteria 4435
313 Ga0495659_0019135 3300046664 Bacteria 2289
314 Ga0495676_0031086 3300047321 Bacteria 4521
315 Ga0495680_0038183 3300047322 Bacteria 3840
316 Ga0496109_0046109 3300048912 Bacteria 3958
317 Ga0496113_0063005 3300048916 Bacteria 2802
318 Ga0501038_0025377 3300049574 Bacteria 5284
319 nmdc:mga00v17_38153_c1 3300050491 Bacteria 2872
320 nmdc:mga04h51_1262_c1 3300050495 Bacteria 5854
321 nmdc:mga05p37_130898_c1 3300050507 Bacteria 3078
322 nmdc:mga05p37_132413_c1 3300050507 Bacteria 3059
323 nmdc:mga05p37_196770_c1 3300050507 Unclassified 2444
324 nmdc:mga05p37_205151_c1 3300050507 Bacteria 2385
325 nmdc:mga05p37_29799_c1 3300050507 Bacteria 6659
326 nmdc:mga05p37_333024_c1 3300050507 Bacteria 1792
327 nmdc:mga05p37_36999_c1 3300050507 Bacteria 5987
328 nmdc:mga05p37_38049_c1 3300050507 Bacteria 5901
329 nmdc:mga05p37_42919_c1 3300050507 Bacteria 5560
330 nmdc:mga05p37_50459_c1 3300050507 Bacteria 5117
331 nmdc:mga05p37_64123_c1 3300050507 Bacteria 4521
332 nmdc:mga05p37_7592_c1 3300050507 Bacteria 12792
333 nmdc:mga05p37_8801_c1 3300050507 Bacteria 11926
334 nmdc:mga05p37_99248_c2 3300050507 Bacteria 2996
335 nmdc:mga09592_155919_c1 3300050508 Bacteria 1971
336 nmdc:mga09592_1929_c1 3300050508 Bacteria 16676
337 nmdc:mga09592_21703_c1 3300050508 Bacteria 5294
338 nmdc:mga09592_26097_c2 3300050508 Bacteria 4462
339 nmdc:mga09592_79351_c1 3300050508 Bacteria 2794
340 nmdc:mga0qj67_56719_c1 3300050509 Bacteria 3105
341 nmdc:mga06r32_1511_c1 3300050510 Bacteria 20906
342 nmdc:mga06r32_179561_c1 3300050510 Bacteria 2102
343 nmdc:mga06r32_24658_c1 3300050510 Bacteria 5587
344 nmdc:mga06r32_7459_c1 3300050510 Bacteria 9841
345 nmdc:mga08y16_26593_c1 3300050511 Bacteria 6100
346 nmdc:mga08y16_35699_c1 3300050511 Bacteria 5221
347 nmdc:mga08y16_384_c1 3300050511 Bacteria 40430
348 nmdc:mga08y16_3947_c1 3300050511 Bacteria 15444
349 nmdc:mga08y16_62538_c1 3300050511 Bacteria 3888
350 nmdc:mga0n895_11315_c1 3300050512 Bacteria 7952
351 nmdc:mga0n895_11458_c1 3300050512 Bacteria 7911
352 nmdc:mga0n895_12349_c1 3300050512 Bacteria 7657
353 nmdc:mga0n895_1312_c1 3300050512 Bacteria 18408
354 nmdc:mga0n895_14896_c1 3300050512 Bacteria 7079
355 nmdc:mga0n895_165668_c1 3300050512 Bacteria 2242
356 nmdc:mga0n895_24429_c1 3300050512 Bacteria 5696
357 nmdc:mga0n895_78807_c1 3300050512 Unclassified 3279
358 nmdc:mga0n895_87367_c1 3300050512 Bacteria 3115
359 nmdc:mga0rr50_48684_c1 3300050513 Bacteria 3134
360 nmdc:mga0rr50_7937_c1 3300050513 Bacteria 6585
361 nmdc:mga0rr50_83745_c1 3300050513 Bacteria 2467
362 nmdc:mga08x19_3642_c2 3300050514 Bacteria 3134
363 nmdc:mga0a205_10479_c1 3300050515 Bacteria 5666
364 nmdc:mga0a205_20334_c1 3300050515 Bacteria 6261
365 nmdc:mga0a205_2043_c1 3300050515 Bacteria 17631
366 nmdc:mga0a205_233_c1 3300050515 Bacteria 39247
367 nmdc:mga0a205_41020_c1 3300050515 Bacteria 4457
368 nmdc:mga0a205_5859_c1 3300050515 Bacteria 11069
369 nmdc:mga0a205_9043_c1 3300050515 Bacteria 9083
370 nmdc:mga0a205_98477_c1 3300050515 Bacteria 2823
371 nmdc:mga0a205_9906_c1 3300050515 Bacteria 8740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10035980 Ga0163163_100359804 453
2 3300006051 Ga0075364_10087833 Ga0075364_100878332 460
3 3300006880 Ga0075429_100016225 Ga0075429_1000162253 465
4 3300009147 Ga0114129_10003354 Ga0114129_100033547 465
5 3300050508 nmdc:mga09592_1929_c1 nmdc:mga09592_1929_c1_1996_3681 465
6 3300042876 Ga0451577_0020135 Ga0451577_0020135_1037_2674 467
7 3300009545 Ga0105237_10001379 Ga0105237_100013799 471
8 3300025914 Ga0207671_10000195 Ga0207671_1000019572 471
9 3300009551 Ga0105238_10018461 Ga0105238_100184612 473
10 3300025924 Ga0207694_10003208 Ga0207694_100032088 473
11 3300045051 Ga0451576_0103097 Ga0451576_0103097_888_2399 475
12 3300028577 Ga0265318_10000166 Ga0265318_1000016643 479
13 3300031235 Ga0265330_10000136 Ga0265330_1000013645 479
14 3300031238 Ga0265332_10001705 Ga0265332_100017052 479
15 3300031240 Ga0265320_10000052 Ga0265320_1000005284 479
16 3300031242 Ga0265329_10006320 Ga0265329_100063205 479
17 3300031250 Ga0265331_10000001 Ga0265331_100000012 479
18 3300031344 Ga0265316_10031279 Ga0265316_100312791 479
19 3300031595 Ga0265313_10002511 Ga0265313_1000251111 479
20 3300031711 Ga0265314_10000305 Ga0265314_100003052 479
21 3300031712 Ga0265342_10023854 Ga0265342_100238542 479
22 3300050509 nmdc:mga0qj67_56719_c1 nmdc:mga0qj67_56719_c1_601_2235 479
23 3300050510 nmdc:mga06r32_179561_c1 nmdc:mga06r32_179561_c1_130_1764 479
24 3300005340 Ga0070689_100000002 Ga0070689_100000002241 480
25 3300025936 Ga0207670_10000001 Ga0207670_10000001455 480
26 3300005518 Ga0070699_100002027 Ga0070699_10000202711 481
27 3300005327 Ga0070658_10009227 Ga0070658_100092276 482
28 3300005530 Ga0070679_100150733 Ga0070679_1001507332 482
29 3300009093 Ga0105240_10024784 Ga0105240_100247845 482
30 3300025913 Ga0207695_10001139 Ga0207695_1000113914 482
31 3300025921 Ga0207652_10022565 Ga0207652_100225653 482
32 3300025924 Ga0207694_10022892 Ga0207694_100228924 482
33 3300031595 Ga0265313_10018080 Ga0265313_100180802 482
34 3300042876 Ga0451577_0022759 Ga0451577_0022759_486_2042 482
35 3300006846 Ga0075430_100094272 Ga0075430_1000942721 483
36 3300006847 Ga0075431_100033269 Ga0075431_1000332692 483
37 3300048916 Ga0496113_0063005 Ga0496113_0063005_1022_2569 483
38 3300005843 Ga0068860_100018522 Ga0068860_1000185223 486
39 3300028381 Ga0268264_10003010 Ga0268264_100030106 486
40 3300031344 Ga0265316_10000842 Ga0265316_100008421 486
41 3300005718 Ga0068866_10007218 Ga0068866_100072182 487
42 3300005719 Ga0068861_100077421 Ga0068861_1000774211 487
43 3300009101 Ga0105247_10001515 Ga0105247_100015152 487
44 3300009176 Ga0105242_10070573 Ga0105242_100705732 487
45 3300025900 Ga0207710_10000402 Ga0207710_100004024 487
46 3300005843 Ga0068860_100005021 Ga0068860_1000050216 489
47 3300028381 Ga0268264_10014453 Ga0268264_100144533 489
48 3300049574 Ga0501038_0025377 Ga0501038_0025377_39_1604 489
49 3300025922 Ga0207646_10003508 Ga0207646_100035086 490
50 3300025942 Ga0207689_10108360 Ga0207689_101083602 491
51 3300005293 Ga0065715_10126129 Ga0065715_101261291 492
52 3300042876 Ga0451577_0005929 Ga0451577_0005929_8356_9882 492
53 3300026142 Ga0207698_10140796 Ga0207698_101407961 495
54 3300028800 Ga0265338_10091680 Ga0265338_100916802 495
55 3300037466 Ga0395898_0059991 Ga0395898_0059991_1708_3288 495
56 3300038443 Ga0395901_0058337 Ga0395901_0058337_2388_3986 496
57 3300050515 nmdc:mga0a205_98477_c1 nmdc:mga0a205_98477_c1_18_1568 496
58 3300005331 Ga0070670_100002940 Ga0070670_10000294011 497
59 3300005333 Ga0070677_10032779 Ga0070677_100327791 497
60 3300005334 Ga0068869_100044296 Ga0068869_1000442963 497
61 3300005354 Ga0070675_100066868 Ga0070675_1000668681 497
62 3300005438 Ga0070701_10036188 Ga0070701_100361882 497
63 3300005467 Ga0070706_100000137 Ga0070706_10000013760 497
64 3300005618 Ga0068864_100071158 Ga0068864_1000711583 497
65 3300009094 Ga0111539_10150852 Ga0111539_101508522 497
66 3300009148 Ga0105243_10064542 Ga0105243_100645423 497
67 3300013308 Ga0157375_10068848 Ga0157375_100688483 497
68 3300025912 Ga0207707_10048317 Ga0207707_100483171 497
69 3300025925 Ga0207650_10027297 Ga0207650_100272972 497
70 3300025936 Ga0207670_10101481 Ga0207670_101014811 497
71 3300025942 Ga0207689_10023563 Ga0207689_100235633 497
72 3300026089 Ga0207648_10043837 Ga0207648_100438375 497
73 3300026121 Ga0207683_10047958 Ga0207683_100479583 497
74 3300046517 Ga0495630_0041666 Ga0495630_0041666_1868_3418 497
75 3300050512 nmdc:mga0n895_165668_c1 nmdc:mga0n895_165668_c1_38_1714 497
76 3300009147 Ga0114129_10047985 Ga0114129_100479851 498
77 3300031344 Ga0265316_10007189 Ga0265316_100071899 498
78 3300050508 nmdc:mga09592_155919_c1 nmdc:mga09592_155919_c1_255_1844 498
79 3300009147 Ga0114129_10025792 Ga0114129_100257928 499
80 3300050491 nmdc:mga00v17_38153_c1 nmdc:mga00v17_38153_c1_513_2057 499
81 3300050495 nmdc:mga04h51_1262_c1 nmdc:mga04h51_1262_c1_2990_4534 499
82 3300005471 Ga0070698_100092811 Ga0070698_1000928112 500
83 3300006852 Ga0075433_10015184 Ga0075433_100151846 500
84 3300006871 Ga0075434_100002312 Ga0075434_1000023129 500
85 3300014969 Ga0157376_10027870 Ga0157376_100278702 500
86 3300050515 nmdc:mga0a205_233_c1 nmdc:mga0a205_233_c1_17816_19462 500
87 3300005617 Ga0068859_100170507 Ga0068859_1001705071 501
88 3300006931 Ga0097620_100170505 Ga0097620_1001705051 501
89 3300013306 Ga0163162_10166726 Ga0163162_101667261 501
90 3300014325 Ga0163163_10064434 Ga0163163_100644343 501
91 3300050507 nmdc:mga05p37_36999_c1 nmdc:mga05p37_36999_c1_696_2315 501
92 3300005445 Ga0070708_100028505 Ga0070708_1000285052 502
93 3300005467 Ga0070706_100120625 Ga0070706_1001206252 502
94 3300005937 Ga0081455_10017217 Ga0081455_100172175 502
95 3300006847 Ga0075431_100014119 Ga0075431_1000141195 502
96 3300006871 Ga0075434_100027133 Ga0075434_1000271333 502
97 3300007076 Ga0075435_100007665 Ga0075435_1000076657 502
98 3300009147 Ga0114129_10022173 Ga0114129_100221733 502
99 3300009147 Ga0114129_10077496 Ga0114129_100774962 502
100 3300013306 Ga0163162_10015736 Ga0163162_100157363 502
101 3300014745 Ga0157377_10002735 Ga0157377_100027353 502
102 3300014969 Ga0157376_10041616 Ga0157376_100416162 502
103 3300025910 Ga0207684_10038066 Ga0207684_100380662 502
104 3300025940 Ga0207691_10020413 Ga0207691_100204131 502
105 3300046516 Ga0495628_0036197 Ga0495628_0036197_197_1813 502
106 3300046642 Ga0495634_0022559 Ga0495634_0022559_1445_3061 502
107 3300047322 Ga0495680_0038183 Ga0495680_0038183_119_1735 502
108 3300050510 nmdc:mga06r32_1511_c1 nmdc:mga06r32_1511_c1_3787_5469 502
109 3300050512 nmdc:mga0n895_24429_c1 nmdc:mga0n895_24429_c1_3049_4758 502
110 3300050513 nmdc:mga0rr50_7937_c1 nmdc:mga0rr50_7937_c1_1828_3537 502
111 3300050515 nmdc:mga0a205_5859_c1 nmdc:mga0a205_5859_c1_4809_6518 502
112 3300050515 nmdc:mga0a205_9906_c1 nmdc:mga0a205_9906_c1_343_1974 502
113 3300005444 Ga0070694_100060327 Ga0070694_1000603272 503
114 3300005545 Ga0070695_100073261 Ga0070695_1000732611 503
115 3300006042 Ga0075368_10004709 Ga0075368_100047095 503
116 3300006051 Ga0075364_10005697 Ga0075364_100056977 503
117 3300006178 Ga0075367_10004535 Ga0075367_100045354 503
118 3300006353 Ga0075370_10016241 Ga0075370_100162414 503
119 3300027866 Ga0209813_10003405 Ga0209813_100034053 503
120 3300037418 Ga0395900_0048174 Ga0395900_0048174_1370_3001 503
121 3300037471 Ga0395905_0062130 Ga0395905_0062130_1828_3459 503
122 3300006852 Ga0075433_10003094 Ga0075433_100030949 505
123 3300009147 Ga0114129_10009655 Ga0114129_100096553 505
124 3300050507 nmdc:mga05p37_38049_c1 nmdc:mga05p37_38049_c1_1770_3329 505
125 3300050512 nmdc:mga0n895_11458_c1 nmdc:mga0n895_11458_c1_417_1976 505
126 3300050515 nmdc:mga0a205_20334_c1 nmdc:mga0a205_20334_c1_4433_5992 505
127 3300005335 Ga0070666_10041805 Ga0070666_100418053 506
128 3300005340 Ga0070689_100004705 Ga0070689_1000047056 506
129 3300005347 Ga0070668_100036866 Ga0070668_1000368662 506
130 3300005457 Ga0070662_100001408 Ga0070662_1000014084 506
131 3300005535 Ga0070684_100130926 Ga0070684_1001309262 506
132 3300005719 Ga0068861_100017450 Ga0068861_1000174503 506
133 3300005842 Ga0068858_100008652 Ga0068858_1000086525 506
134 3300005844 Ga0068862_100004788 Ga0068862_10000478810 506
135 3300006358 Ga0068871_100023753 Ga0068871_1000237536 506
136 3300006852 Ga0075433_10008792 Ga0075433_100087926 506
137 3300006871 Ga0075434_100123839 Ga0075434_1001238392 506
138 3300006881 Ga0068865_100015676 Ga0068865_1000156765 506
139 3300009094 Ga0111539_10030550 Ga0111539_100305503 506
140 3300009147 Ga0114129_10014364 Ga0114129_100143644 506
141 3300025926 Ga0207659_10002831 Ga0207659_100028315 506
142 3300025933 Ga0207706_10002685 Ga0207706_100026859 506
143 3300025938 Ga0207704_10048015 Ga0207704_100480153 506
144 3300025942 Ga0207689_10009815 Ga0207689_100098155 506
145 3300025945 Ga0207679_10151948 Ga0207679_101519481 506
146 3300025960 Ga0207651_10009784 Ga0207651_100097843 506
147 3300026035 Ga0207703_10109622 Ga0207703_101096221 506
148 3300027907 Ga0207428_10086020 Ga0207428_100860202 506
149 3300028380 Ga0268265_10009565 Ga0268265_100095655 506
150 3300050507 nmdc:mga05p37_8801_c1 nmdc:mga05p37_8801_c1_8031_9698 506
151 3300050511 nmdc:mga08y16_35699_c1 nmdc:mga08y16_35699_c1_3361_5004 506
152 3300005295 Ga0065707_10090506 Ga0065707_100905063 507
153 3300050507 nmdc:mga05p37_130898_c1 nmdc:mga05p37_130898_c1_173_1807 507
154 3300005468 Ga0070707_100005237 Ga0070707_1000052375 508
155 3300005518 Ga0070699_100032869 Ga0070699_1000328693 508
156 3300006852 Ga0075433_10012459 Ga0075433_100124595 508
157 3300006852 Ga0075433_10080923 Ga0075433_100809233 508
158 3300006871 Ga0075434_100090834 Ga0075434_1000908343 508
159 3300009094 Ga0111539_10046398 Ga0111539_100463981 508
160 3300009177 Ga0105248_10006640 Ga0105248_100066403 508
161 3300009553 Ga0105249_10004714 Ga0105249_100047149 508
162 3300013308 Ga0157375_10025746 Ga0157375_100257464 508
163 3300014326 Ga0157380_10001061 Ga0157380_1000106111 508
164 3300014968 Ga0157379_10009028 Ga0157379_100090286 508
165 3300025922 Ga0207646_10007396 Ga0207646_100073967 508
166 3300050511 nmdc:mga08y16_62538_c1 nmdc:mga08y16_62538_c1_1876_3507 508
167 3300050512 nmdc:mga0n895_12349_c1 nmdc:mga0n895_12349_c1_2091_3722 508
168 3300050515 nmdc:mga0a205_41020_c1 nmdc:mga0a205_41020_c1_443_2092 508
169 3300005536 Ga0070697_100134707 Ga0070697_1001347071 509
170 3300007076 Ga0075435_100034317 Ga0075435_1000343173 509
171 3300009147 Ga0114129_10048760 Ga0114129_100487603 509
172 3300045051 Ga0451576_0023101 Ga0451576_0023101_4023_5666 509
173 3300046460 Ga0495638_0014116 Ga0495638_0014116_1839_3461 509
174 3300050507 nmdc:mga05p37_29799_c1 nmdc:mga05p37_29799_c1_2885_4519 509
175 3300050507 nmdc:mga05p37_50459_c1 nmdc:mga05p37_50459_c1_3177_4826 509
176 3300050508 nmdc:mga09592_21703_c1 nmdc:mga09592_21703_c1_1647_3281 509
177 3300050510 nmdc:mga06r32_24658_c1 nmdc:mga06r32_24658_c1_1750_3384 509
178 3300050512 nmdc:mga0n895_14896_c1 nmdc:mga0n895_14896_c1_4107_5756 509
179 3300050513 nmdc:mga0rr50_83745_c1 nmdc:mga0rr50_83745_c1_456_2135 509
180 3300006844 Ga0075428_100128464 Ga0075428_1001284643 510
181 3300006852 Ga0075433_10001670 Ga0075433_1000167011 510
182 3300006871 Ga0075434_100005030 Ga0075434_1000050306 510
183 3300006880 Ga0075429_100061729 Ga0075429_1000617292 510
184 3300050512 nmdc:mga0n895_11315_c1 nmdc:mga0n895_11315_c1_3188_4849 510
185 3300050515 nmdc:mga0a205_9043_c1 nmdc:mga0a205_9043_c1_3186_4847 510
186 3300003203 JGI25406J46586_10005490 JGI25406J46586_100054902 511
187 3300005985 Ga0081539_10000142 Ga0081539_1000014277 511
188 3300006847 Ga0075431_100068824 Ga0075431_1000688244 511
189 3300009147 Ga0114129_10120817 Ga0114129_101208172 511
190 3300001977 JGI24746J21847_1002617 JGI24746J21847_10026171 512
191 3300005293 Ga0065715_10090281 Ga0065715_100902815 512
192 3300005328 Ga0070676_10002887 Ga0070676_100028877 512
193 3300005330 Ga0070690_100006934 Ga0070690_1000069343 512
194 3300005333 Ga0070677_10020323 Ga0070677_100203232 512
195 3300005334 Ga0068869_100004857 Ga0068869_1000048579 512
196 3300005343 Ga0070687_100000854 Ga0070687_1000008548 512
197 3300005344 Ga0070661_100010156 Ga0070661_1000101564 512
198 3300005345 Ga0070692_10053014 Ga0070692_100530142 512
199 3300005353 Ga0070669_100001659 Ga0070669_10000165911 512
200 3300005355 Ga0070671_100043942 Ga0070671_1000439423 512
201 3300005364 Ga0070673_100007741 Ga0070673_1000077415 512
202 3300005365 Ga0070688_100008139 Ga0070688_1000081394 512
203 3300005367 Ga0070667_100008255 Ga0070667_1000082553 512
204 3300005438 Ga0070701_10033065 Ga0070701_100330651 512
205 3300005440 Ga0070705_100028756 Ga0070705_1000287562 512
206 3300005456 Ga0070678_100007566 Ga0070678_1000075663 512
207 3300005466 Ga0070685_10015714 Ga0070685_100157143 512
208 3300005543 Ga0070672_100037078 Ga0070672_1000370783 512
209 3300005544 Ga0070686_100003119 Ga0070686_1000031194 512
210 3300005548 Ga0070665_100016935 Ga0070665_1000169353 512
211 3300005564 Ga0070664_100001768 Ga0070664_1000017689 512
212 3300005618 Ga0068864_100021817 Ga0068864_1000218175 512
213 3300005840 Ga0068870_10004140 Ga0068870_100041408 512
214 3300005841 Ga0068863_100014762 Ga0068863_1000147624 512
215 3300005843 Ga0068860_100004343 Ga0068860_1000043436 512
216 3300006847 Ga0075431_100019077 Ga0075431_1000190773 512
217 3300006871 Ga0075434_100004047 Ga0075434_1000040479 512
218 3300009147 Ga0114129_10024368 Ga0114129_100243682 512
219 3300009147 Ga0114129_10032920 Ga0114129_100329203 512
220 3300017792 Ga0163161_10002269 Ga0163161_100022698 512
221 3300025315 Ga0207697_10002259 Ga0207697_100022596 512
222 3300025893 Ga0207682_10001089 Ga0207682_100010899 512
223 3300025901 Ga0207688_10001460 Ga0207688_100014606 512
224 3300025907 Ga0207645_10000714 Ga0207645_1000071414 512
225 3300025918 Ga0207662_10001609 Ga0207662_100016096 512
226 3300025920 Ga0207649_10025661 Ga0207649_100256612 512
227 3300025923 Ga0207681_10021647 Ga0207681_100216473 512
228 3300025931 Ga0207644_10029447 Ga0207644_100294473 512
229 3300025940 Ga0207691_10012154 Ga0207691_100121546 512
230 3300025941 Ga0207711_10064045 Ga0207711_100640453 512
231 3300025945 Ga0207679_10014699 Ga0207679_100146993 512
232 3300026088 Ga0207641_10028852 Ga0207641_100288523 512
233 3300026121 Ga0207683_10009639 Ga0207683_100096394 512
234 3300027907 Ga0207428_10022313 Ga0207428_100223133 512
235 3300028381 Ga0268264_10095443 Ga0268264_100954433 512
236 3300045051 Ga0451576_0162820 Ga0451576_0162820_109_1719 512
237 3300050507 nmdc:mga05p37_132413_c1 nmdc:mga05p37_132413_c1_947_2608 512
238 3300050507 nmdc:mga05p37_99248_c2 nmdc:mga05p37_99248_c2_197_1924 512
239 3300050510 nmdc:mga06r32_7459_c1 nmdc:mga06r32_7459_c1_1644_3263 512
240 3300005364 Ga0070673_100007748 Ga0070673_1000077486 513
241 3300005518 Ga0070699_100002355 Ga0070699_10000235510 513
242 3300005536 Ga0070697_100000934 Ga0070697_10000093413 513
243 3300005577 Ga0068857_100119122 Ga0068857_1001191222 513
244 3300006844 Ga0075428_100076805 Ga0075428_1000768053 513
245 3300006846 Ga0075430_100018946 Ga0075430_1000189465 513
246 3300006847 Ga0075431_100034253 Ga0075431_1000342536 513
247 3300006852 Ga0075433_10048834 Ga0075433_100488342 513
248 3300006871 Ga0075434_100049228 Ga0075434_1000492282 513
249 3300006880 Ga0075429_100015880 Ga0075429_1000158806 513
250 3300009147 Ga0114129_10007382 Ga0114129_100073826 513
251 3300009147 Ga0114129_10183893 Ga0114129_101838933 513
252 3300025908 Ga0207643_10001288 Ga0207643_100012889 513
253 3300025910 Ga0207684_10001486 Ga0207684_1000148623 513
254 3300025926 Ga0207659_10018289 Ga0207659_100182893 513
255 3300025940 Ga0207691_10010406 Ga0207691_100104063 513
256 3300037466 Ga0395898_0048707 Ga0395898_0048707_2092_3708 513
257 3300046539 Ga0495621_0010321 Ga0495621_0010321_1086_2825 513
258 3300050507 nmdc:mga05p37_42919_c1 nmdc:mga05p37_42919_c1_563_2143 513
259 3300050507 nmdc:mga05p37_64123_c1 nmdc:mga05p37_64123_c1_2903_4483 513
260 3300050507 nmdc:mga05p37_7592_c1 nmdc:mga05p37_7592_c1_5607_7247 513
261 3300050508 nmdc:mga09592_26097_c2 nmdc:mga09592_26097_c2_1529_3109 513
262 3300050512 nmdc:mga0n895_78807_c1 nmdc:mga0n895_78807_c1_784_2364 513
263 3300050512 nmdc:mga0n895_87367_c1 nmdc:mga0n895_87367_c1_433_2013 513
264 3300050515 nmdc:mga0a205_10479_c1 nmdc:mga0a205_10479_c1_2825_4465 513
265 3300005444 Ga0070694_100093754 Ga0070694_1000937541 514
266 3300006844 Ga0075428_100023435 Ga0075428_1000234351 514
267 3300006852 Ga0075433_10024847 Ga0075433_100248472 514
268 3300006871 Ga0075434_100005747 Ga0075434_1000057476 514
269 3300007076 Ga0075435_100122175 Ga0075435_1001221752 514
270 3300025942 Ga0207689_10047051 Ga0207689_100470511 514
271 3300026088 Ga0207641_10092886 Ga0207641_100928862 514
272 3300047321 Ga0495676_0031086 Ga0495676_0031086_162_1811 514
273 3300050507 nmdc:mga05p37_333024_c1 nmdc:mga05p37_333024_c1_58_1698 514
274 3300005290 Ga0065712_10069742 Ga0065712_100697424 515
275 3300005340 Ga0070689_100151867 Ga0070689_1001518671 515
276 3300005354 Ga0070675_100031053 Ga0070675_1000310535 515
277 3300005365 Ga0070688_100015352 Ga0070688_1000153523 515
278 3300005840 Ga0068870_10022149 Ga0068870_100221495 515
279 3300006852 Ga0075433_10112949 Ga0075433_101129492 515
280 3300009094 Ga0111539_10052268 Ga0111539_100522682 515
281 3300014745 Ga0157377_10006365 Ga0157377_100063654 515
282 3300025908 Ga0207643_10073213 Ga0207643_100732132 515
283 3300025926 Ga0207659_10026260 Ga0207659_100262603 515
284 3300027907 Ga0207428_10064046 Ga0207428_100640462 515
285 3300048912 Ga0496109_0046109 Ga0496109_0046109_1960_3606 515
286 3300050511 nmdc:mga08y16_26593_c1 nmdc:mga08y16_26593_c1_2272_3858 515
287 3300006871 Ga0075434_100002005 Ga0075434_10000200512 516
288 3300037471 Ga0395905_0009855 Ga0395905_0009855_6380_8119 516
289 3300050512 nmdc:mga0n895_1312_c1 nmdc:mga0n895_1312_c1_15713_17356 516
290 3300005719 Ga0068861_100049506 Ga0068861_1000495062 518
291 3300050508 nmdc:mga09592_79351_c1 nmdc:mga09592_79351_c1_199_1836 519
292 3300009147 Ga0114129_10271720 Ga0114129_102717201 520
293 3300005334 Ga0068869_100131947 Ga0068869_1001319471 521
294 3300005468 Ga0070707_100179638 Ga0070707_1001796382 521
295 3300014325 Ga0163163_10215030 Ga0163163_102150301 521
296 3300005354 Ga0070675_100038817 Ga0070675_1000388172 522
297 3300005471 Ga0070698_100010984 Ga0070698_1000109842 522
298 3300005518 Ga0070699_100013575 Ga0070699_1000135751 522
299 3300005617 Ga0068859_100012201 Ga0068859_1000122013 522
300 3300005843 Ga0068860_100003888 Ga0068860_1000038889 522
301 3300006931 Ga0097620_100012201 Ga0097620_1000122013 522
302 3300009094 Ga0111539_10000235 Ga0111539_1000023529 522
303 3300009147 Ga0114129_10196678 Ga0114129_101966783 522
304 3300025926 Ga0207659_10011751 Ga0207659_100117512 522
305 3300025936 Ga0207670_10026524 Ga0207670_100265241 522
306 3300026035 Ga0207703_10017338 Ga0207703_100173384 522
307 3300050507 nmdc:mga05p37_205151_c1 nmdc:mga05p37_205151_c1_524_2161 522
308 3300050511 nmdc:mga08y16_384_c1 nmdc:mga08y16_384_c1_38144_39787 522
309 3300005295 Ga0065707_10001611 Ga0065707_100016113 523
310 3300005295 Ga0065707_10085889 Ga0065707_100858892 523
311 3300005331 Ga0070670_100000466 Ga0070670_10000046612 523
312 3300005340 Ga0070689_100067582 Ga0070689_1000675823 523
313 3300005356 Ga0070674_100064536 Ga0070674_1000645361 523
314 3300005364 Ga0070673_100026715 Ga0070673_1000267153 523
315 3300005458 Ga0070681_10004273 Ga0070681_1000427311 523
316 3300005564 Ga0070664_100003392 Ga0070664_1000033929 523
317 3300005615 Ga0070702_100003703 Ga0070702_1000037032 523
318 3300005618 Ga0068864_100011340 Ga0068864_1000113403 523
319 3300005840 Ga0068870_10005995 Ga0068870_100059956 523
320 3300005842 Ga0068858_100125390 Ga0068858_1001253902 523
321 3300006358 Ga0068871_100003365 Ga0068871_1000033652 523
322 3300007076 Ga0075435_100053164 Ga0075435_1000531641 523
323 3300009147 Ga0114129_10046919 Ga0114129_100469194 523
324 3300025925 Ga0207650_10007728 Ga0207650_100077284 523
325 3300025937 Ga0207669_10098798 Ga0207669_100987981 523
326 3300025940 Ga0207691_10009150 Ga0207691_100091505 523
327 3300025945 Ga0207679_10048973 Ga0207679_100489733 523
328 3300026095 Ga0207676_10017924 Ga0207676_100179243 523
329 3300026121 Ga0207683_10030931 Ga0207683_100309312 523
330 3300046664 Ga0495659_0019135 Ga0495659_0019135_633_2276 523
331 3300050507 nmdc:mga05p37_196770_c1 nmdc:mga05p37_196770_c1_479_2119 523
332 3300050511 nmdc:mga08y16_3947_c1 nmdc:mga08y16_3947_c1_5024_6616 523
333 3300050513 nmdc:mga0rr50_48684_c1 nmdc:mga0rr50_48684_c1_1113_2759 523
334 3300005444 Ga0070694_100001174 Ga0070694_1000011744 524
335 3300005545 Ga0070695_100000015 Ga0070695_10000001526 524
336 3300005546 Ga0070696_100000033 Ga0070696_10000003327 524
337 3300005577 Ga0068857_100009188 Ga0068857_1000091881 524
338 3300005618 Ga0068864_100011080 Ga0068864_1000110804 524
339 3300006237 Ga0097621_100077195 Ga0097621_1000771952 524
340 3300025945 Ga0207679_10051246 Ga0207679_100512462 524
341 3300026088 Ga0207641_10073190 Ga0207641_100731902 524
342 3300026116 Ga0207674_10001956 Ga0207674_100019562 524
343 3300045051 Ga0451576_0008171 Ga0451576_0008171_3346_4992 524
344 3300005536 Ga0070697_100001081 Ga0070697_1000010819 525
345 3300005440 Ga0070705_100009978 Ga0070705_1000099782 526
346 3300005618 Ga0068864_100006048 Ga0068864_1000060483 527
347 3300009148 Ga0105243_10002119 Ga0105243_100021196 527
348 3300009176 Ga0105242_10041706 Ga0105242_100417062 527
349 3300025935 Ga0207709_10004362 Ga0207709_100043622 527
350 3300026089 Ga0207648_10027190 Ga0207648_100271902 527
351 3300026095 Ga0207676_10010817 Ga0207676_100108172 527
352 3300005545 Ga0070695_100052857 Ga0070695_1000528571 528
353 3300005843 Ga0068860_100043157 Ga0068860_1000431572 528
354 3300009551 Ga0105238_10020324 Ga0105238_100203243 528
355 3300014325 Ga0163163_10143867 Ga0163163_101438672 528
356 3300025924 Ga0207694_10016235 Ga0207694_100162352 528
357 3300005444 Ga0070694_100030296 Ga0070694_1000302962 529
358 3300005471 Ga0070698_100004539 Ga0070698_1000045399 529
359 3300005719 Ga0068861_100000740 Ga0068861_1000007403 529
360 3300006914 Ga0075436_100008473 Ga0075436_1000084732 529
361 3300050514 nmdc:mga08x19_3642_c2 nmdc:mga08x19_3642_c2_360_1964 529
362 2162886006 SwRhRL3b_contig_2139811 SwRhRL3b_0737.00001140 530
363 3300005295 Ga0065707_10008887 Ga0065707_100088872 530
364 3300005468 Ga0070707_100139664 Ga0070707_1001396641 530
365 3300005617 Ga0068859_100114240 Ga0068859_1001142402 530
366 3300005842 Ga0068858_100024706 Ga0068858_1000247062 530
367 3300006931 Ga0097620_100114246 Ga0097620_1001142462 530
368 3300009174 Ga0105241_10137282 Ga0105241_101372822 530
369 3300014325 Ga0163163_10003421 Ga0163163_100034214 530
370 3300025922 Ga0207646_10081751 Ga0207646_100817512 530
371 3300050515 nmdc:mga0a205_2043_c1 nmdc:mga0a205_2043_c1_12186_13796 530

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00909

Ammonium_transp

Ammonium Transporter Family

129

560

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eu6-assembly1.cif.gz_A sensor amt protein 0.941 54 488
6eu6-assembly1.cif.gz_A sensor amt protein 0.9297 54 488
2b2f-assembly1.cif.gz_A ammonium transporter amt-1 from a.fulgidus (native) 0.9154 58 494
2nmr-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9096 58 476
2npg-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9085 58 476
ID Description Score Start End Superfamily
af_Q9VFA9_21_443_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9294 59 481 1.10.3430.10
af_Q8MXY0_4_431_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9262 56 494 1.10.3430.10
2b2hA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9171 58 494 1.10.3430.10
af_Q60366_3_391_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9154 59 494 1.10.3430.10
2b2hA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.908 58 494 1.10.3430.10
ID Description Score Start End GO Terms
AF-A0A7V3FWK3-F1-model_v4 Ammonium transporter 0.9859 148 488 GO:0008519
GO:0016020
GO:0097272
AF-A0A1Q7JAZ8-F1-model_v4 Ammonium transporter 0.9827 56 495 GO:0005886
GO:0008519
GO:0097272
AF-A0A6N8JKY9-F1-model_v4 Ammonium transporter 0.9781 20 494 GO:0005886
GO:0008519
GO:0097272
AF-A0A1Q7JAZ8-F1-model_v4 Ammonium transporter 0.9739 56 495 GO:0005886
GO:0008519
GO:0097272
AF-A0A0C5WKW4-F1-model_v4 deleted 0.9692 178 490

Feature Viewer

pLDDT pTM Quality
85.66 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map