F425648

General Info

Members Datasets Scaffolds Average Seq Length
371 179 742 219

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100168435|Ga0070671_1001684352
Length 256
Sequence LPELWNLVQNQNRDQNSELLSKVCNFVPIFFQHQINEATRLGIWKIEETEEFFLSNVPVQSEVTHPLKRLQHLAGRFLLQFLCPGFPYELIRIADTHKPYLPNEQYHFSISHCGDYAAAIVSSDQRVGVDIEITSEKAEKIKDKFLTQNEQLIFSFTPPSVADRVPPSALAVAQGLPEAQRDPIATGSHLTTLLWSAKESVYKWFGDGGVDFRKHIQLEGIHETDETILCHFTKTNRQLIIYYRNLDHLMLTWIVS

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 1.35
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 9.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100168435 3300005355 Bacteria 1852
2 rootL2_10044044 3300003322 Bacteria 3186
3 rootH1_10328074 3300003323 Bacteria 1760
4 Ga0065712_10000782 3300005290 Bacteria 8643
5 Ga0065715_10012640 3300005293 Bacteria 1959
6 Ga0065707_10124129 3300005295 Bacteria 2050
7 Ga0070658_10271721 3300005327 Bacteria 1442
8 Ga0070676_10003644 3300005328 Bacteria 8060
9 Ga0070676_10005766 3300005328 Bacteria 6602
10 Ga0070676_10183995 3300005328 Bacteria 1360
11 Ga0070683_100018681 3300005329 Bacteria 6144
12 Ga0070683_100024585 3300005329 Bacteria 5398
13 Ga0070690_100071169 3300005330 Bacteria 2259
14 Ga0070690_100120534 3300005330 Bacteria 1760
15 Ga0070670_100015018 3300005331 Bacteria 6645
16 Ga0070670_100044487 3300005331 Bacteria 3818
17 Ga0070670_100673530 3300005331 Unclassified 929
18 Ga0068869_100004743 3300005334 Bacteria 8483
19 Ga0068869_100024540 3300005334 Bacteria 4176
20 Ga0068869_100077176 3300005334 Bacteria 2477
21 Ga0068869_100080682 3300005334 Bacteria 2427
22 Ga0068869_100147219 3300005334 Bacteria 1824
23 Ga0070666_10003303 3300005335 Bacteria 9778
24 Ga0070666_10057159 3300005335 Bacteria 2636
25 Ga0070666_10096654 3300005335 Unclassified 2033
26 Ga0070666_10400629 3300005335 Bacteria 987
27 Ga0070680_100060069 3300005336 Bacteria 3111
28 Ga0068868_100001021 3300005338 Bacteria 19121
29 Ga0068868_100045180 3300005338 Bacteria 3446
30 Ga0068868_100057631 3300005338 Bacteria 3069
31 Ga0068868_100116109 3300005338 Bacteria 2179
32 Ga0070660_100511154 3300005339 Bacteria 1000
33 Ga0070689_100008355 3300005340 Bacteria 7291
34 Ga0070689_100050470 3300005340 Bacteria 3215
35 Ga0070689_100305363 3300005340 Unclassified 1325
36 Ga0070691_10054743 3300005341 Bacteria 1910
37 Ga0070687_100079237 3300005343 Bacteria 1787
38 Ga0070661_100076904 3300005344 Bacteria 2460
39 Ga0070668_100000202 3300005347 Bacteria 39154
40 Ga0070669_100070176 3300005353 Bacteria 2590
41 Ga0070675_100063757 3300005354 Bacteria 3047
42 Ga0070675_100135680 3300005354 Bacteria 2100
43 Ga0070675_100190353 3300005354 Bacteria 1777
44 Ga0070675_100357017 3300005354 Bacteria 1297
45 Ga0070675_100657685 3300005354 Unclassified 953
46 Ga0070671_100187010 3300005355 Bacteria 1755
47 Ga0070671_100742178 3300005355 Bacteria 853
48 Ga0070674_100399336 3300005356 Bacteria 1123
49 Ga0070673_100152942 3300005364 Bacteria 1955
50 Ga0070688_100147742 3300005365 Bacteria 1603
51 Ga0070688_100239297 3300005365 Unclassified 1287
52 Ga0070659_100340964 3300005366 Bacteria 1256
53 Ga0070667_100010801 3300005367 Bacteria 7545
54 Ga0070667_100401060 3300005367 Bacteria 1248
55 Ga0070667_100544279 3300005367 Bacteria 1067
56 Ga0070713_100789803 3300005436 Bacteria 910
57 Ga0070663_100049478 3300005455 Bacteria 2985
58 Ga0070663_100062880 3300005455 Bacteria 2678
59 Ga0070678_100017573 3300005456 Bacteria 4612
60 Ga0070678_100126647 3300005456 Unclassified 2023
61 Ga0070662_100005538 3300005457 Bacteria 8071
62 Ga0070662_100014833 3300005457 Bacteria 5210
63 Ga0070662_100088930 3300005457 Bacteria 2316
64 Ga0068867_100017054 3300005459 Bacteria 5160
65 Ga0068867_100071784 3300005459 Bacteria 2590
66 Ga0068867_100152725 3300005459 Bacteria 1815
67 Ga0068867_100435531 3300005459 Bacteria 1114
68 Ga0070685_10182724 3300005466 Bacteria 1351
69 Ga0070685_10256644 3300005466 Bacteria 1160
70 Ga0070698_100005891 3300005471 Bacteria 13381
71 Ga0070698_100024721 3300005471 Bacteria 6266
72 Ga0070679_100073440 3300005530 Bacteria 3412
73 Ga0070684_100008427 3300005535 Bacteria 8057
74 Ga0070684_100140851 3300005535 Bacteria 2181
75 Ga0068853_100003159 3300005539 Bacteria 12595
76 Ga0068853_100017665 3300005539 Bacteria 5888
77 Ga0068853_100048030 3300005539 Bacteria 3664
78 Ga0070672_100001006 3300005543 Bacteria 17084
79 Ga0070672_100046332 3300005543 Bacteria 3368
80 Ga0070672_100059331 3300005543 Bacteria 3010
81 Ga0070693_100112146 3300005547 Bacteria 1679
82 Ga0070665_100002078 3300005548 Bacteria 22468
83 Ga0070665_100104027 3300005548 Bacteria 2842
84 Ga0070704_100632626 3300005549 Bacteria 943
85 Ga0068855_100051272 3300005563 Bacteria 4861
86 Ga0068855_100125733 3300005563 Bacteria 2932
87 Ga0068855_100636352 3300005563 Bacteria 1147
88 Ga0070664_100008354 3300005564 Bacteria 8371
89 Ga0070664_100039136 3300005564 Bacteria 3994
90 Ga0070664_100209475 3300005564 Unclassified 1742
91 Ga0070664_100247081 3300005564 Unclassified 1603
92 Ga0070664_100399110 3300005564 Bacteria 1257
93 Ga0070664_100455630 3300005564 Bacteria 1175
94 Ga0068857_100108952 3300005577 Bacteria 2489
95 Ga0068854_100041248 3300005578 Bacteria 3261
96 Ga0068852_100048947 3300005616 Bacteria 3614
97 Ga0068852_100331949 3300005616 Bacteria 1480
98 Ga0068852_100364484 3300005616 Bacteria 1414
99 Ga0068852_100800315 3300005616 Bacteria 957
100 Ga0068864_100005896 3300005618 Bacteria 10042
101 Ga0068864_100012029 3300005618 Bacteria 7147
102 Ga0068864_100210791 3300005618 Bacteria 1789
103 Ga0068864_100214710 3300005618 Bacteria 1773
104 Ga0068861_100021606 3300005719 Bacteria 4627
105 Ga0068861_100286989 3300005719 Bacteria 1420
106 Ga0068861_100387383 3300005719 Bacteria 1237
107 Ga0068863_100006340 3300005841 Bacteria 11601
108 Ga0068863_100040740 3300005841 Bacteria 4416
109 Ga0068863_100235057 3300005841 Bacteria 1768
110 Ga0068863_100472224 3300005841 Bacteria 1233
111 Ga0068858_100002368 3300005842 Bacteria 19058
112 Ga0068858_100067213 3300005842 Bacteria 3320
113 Ga0068858_100161885 3300005842 Bacteria 2107
114 Ga0068858_100211618 3300005842 Unclassified 1835
115 Ga0068860_100004069 3300005843 Bacteria 15011
116 Ga0068860_100019759 3300005843 Bacteria 6532
117 Ga0068860_100220554 3300005843 Bacteria 1841
118 Ga0068860_100363768 3300005843 Bacteria 1426
119 Ga0068862_100095924 3300005844 Unclassified 2588
120 Ga0068862_100316895 3300005844 Bacteria 1438
121 Ga0097621_100002272 3300006237 Bacteria 13156
122 Ga0097621_100015542 3300006237 Bacteria 5730
123 Ga0097621_100544411 3300006237 Bacteria 1056
124 Ga0097621_101020122 3300006237 Unclassified 774
125 Ga0068871_100003857 3300006358 Bacteria 10335
126 Ga0068871_100032771 3300006358 Bacteria 4107
127 Ga0068871_100330909 3300006358 Bacteria 1343
128 Ga0068871_100569251 3300006358 Bacteria 1028
129 Ga0075428_100023738 3300006844 Bacteria 6787
130 Ga0075430_100018375 3300006846 Bacteria 5949
131 Ga0075430_100586212 3300006846 Bacteria 920
132 Ga0075431_100019516 3300006847 Bacteria 6914
133 Ga0075431_100038176 3300006847 Bacteria 4946
134 Ga0075429_100090121 3300006880 Bacteria 2674
135 Ga0068865_100281682 3300006881 Bacteria 1324
136 Ga0105240_10042749 3300009093 Bacteria 5772
137 Ga0111539_10047359 3300009094 Bacteria 5138
138 Ga0111539_10214163 3300009094 Bacteria 2244
139 Ga0105247_10026833 3300009101 Bacteria 3481
140 Ga0105247_10214860 3300009101 Unclassified 1299
141 Ga0105241_10031380 3300009174 Bacteria 3979
142 Ga0105241_10182430 3300009174 Bacteria 1742
143 Ga0105242_10072462 3300009176 Bacteria 2861
144 Ga0105242_10535523 3300009176 Bacteria 1120
145 Ga0105248_10270890 3300009177 Bacteria 1912
146 Ga0105249_10014121 3300009553 Bacteria 7060
147 Ga0105249_10043295 3300009553 Bacteria 4095
148 Ga0105249_10053373 3300009553 Bacteria 3695
149 Ga0105249_10077368 3300009553 Bacteria 3085
150 Ga0105249_10089064 3300009553 Bacteria 2883
151 Ga0105249_10122100 3300009553 Unclassified 2477
152 Ga0105249_10181518 3300009553 Bacteria 2048
153 Ga0105249_10205510 3300009553 Bacteria 1929
154 Ga0105249_10298749 3300009553 Unclassified 1614
155 Ga0105249_10502039 3300009553 Bacteria 1258
156 Ga0105239_10234987 3300010375 Bacteria 2057
157 Ga0105239_10452042 3300010375 Bacteria 1457
158 Ga0105239_11023295 3300010375 Unclassified 950
159 Ga0105246_11154743 3300011119 Bacteria 710
160 Ga0157373_10204838 3300013100 Bacteria 1391
161 Ga0157370_10041005 3300013104 Bacteria 4469
162 Ga0157370_10980144 3300013104 Bacteria 766
163 Ga0157369_10026498 3300013105 Bacteria 6429
164 Ga0157369_10196405 3300013105 Unclassified 2119
165 Ga0157369_10887491 3300013105 Bacteria 915
166 Ga0157374_10037449 3300013296 Bacteria 4452
167 Ga0157374_10043435 3300013296 Bacteria 4152
168 Ga0157374_10058550 3300013296 Bacteria 3600
169 Ga0157374_10094707 3300013296 Bacteria 2854
170 Ga0157374_10257460 3300013296 Bacteria 1718
171 Ga0157378_10013208 3300013297 Bacteria 7221
172 Ga0157378_10131711 3300013297 Bacteria 2315
173 Ga0157378_10195307 3300013297 Bacteria 1911
174 Ga0157378_10418694 3300013297 Bacteria 1324
175 Ga0163162_10000241 3300013306 Bacteria 49773
176 Ga0163162_10000744 3300013306 Bacteria 30265
177 Ga0163162_10017362 3300013306 Bacteria 7040
178 Ga0163162_10028118 3300013306 Bacteria 5562
179 Ga0163162_10045528 3300013306 Bacteria 4396
180 Ga0163162_10045994 3300013306 Bacteria 4374
181 Ga0163162_10054016 3300013306 Bacteria 4039
182 Ga0163162_10055847 3300013306 Bacteria 3977
183 Ga0163162_10477465 3300013306 Bacteria 1378
184 Ga0163162_10706883 3300013306 Bacteria 1129
185 Ga0157372_10162795 3300013307 Bacteria 2579
186 Ga0157372_10261755 3300013307 Bacteria 2008
187 Ga0157375_10006178 3300013308 Bacteria 10438
188 Ga0157375_10018776 3300013308 Bacteria 6275
189 Ga0157375_10209925 3300013308 Bacteria 2104
190 Ga0157375_10280345 3300013308 Bacteria 1830
191 Ga0157375_10339615 3300013308 Bacteria 1667
192 Ga0157375_10559133 3300013308 Bacteria 1305
193 Ga0163163_10000577 3300014325 Bacteria 32360
194 Ga0163163_10001098 3300014325 Bacteria 22988
195 Ga0157380_10033567 3300014326 Bacteria 3952
196 Ga0157380_10105499 3300014326 Bacteria 2356
197 Ga0157380_10872244 3300014326 Bacteria 924
198 Ga0157377_10023077 3300014745 Bacteria 3294
199 Ga0157377_10090979 3300014745 Bacteria 1802
200 Ga0157377_10113084 3300014745 Bacteria 1634
201 Ga0157379_10050035 3300014968 Bacteria 3730
202 Ga0157379_10186516 3300014968 Bacteria 1874
203 Ga0157379_10552824 3300014968 Bacteria 1071
204 Ga0157376_10010472 3300014969 Bacteria 6784
205 Ga0157376_10050304 3300014969 Bacteria 3457
206 Ga0157376_10167949 3300014969 Bacteria 1995
207 Ga0157376_10294885 3300014969 Unclassified 1533
208 Ga0157376_10357934 3300014969 Bacteria 1399
209 Ga0157376_10413996 3300014969 Unclassified 1306
210 Ga0157376_11284803 3300014969 Bacteria 762
211 Ga0163161_10010353 3300017792 Bacteria 6457
212 Ga0163161_10016382 3300017792 Bacteria 5172
213 Ga0163161_10023253 3300017792 Bacteria 4371
214 Ga0163161_10091690 3300017792 Bacteria 2249
215 Ga0207697_10138741 3300025315 Bacteria 1054
216 Ga0207710_10016540 3300025900 Bacteria 3122
217 Ga0207710_10208087 3300025900 Unclassified 968
218 Ga0207680_10155670 3300025903 Bacteria 1528
219 Ga0207685_10133708 3300025905 Bacteria 1104
220 Ga0207645_10000441 3300025907 Bacteria 34495
221 Ga0207645_10052327 3300025907 Unclassified 2609
222 Ga0207705_10001925 3300025909 Bacteria 16219
223 Ga0207654_10005298 3300025911 Bacteria 6509
224 Ga0207695_10230913 3300025913 Unclassified 1755
225 Ga0207660_10042360 3300025917 Bacteria 3195
226 Ga0207649_10022307 3300025920 Bacteria 3656
227 Ga0207649_10181988 3300025920 Bacteria 1472
228 Ga0207652_10007552 3300025921 Bacteria 8754
229 Ga0207681_10206483 3300025923 Bacteria 1511
230 Ga0207681_10516823 3300025923 Bacteria 979
231 Ga0207650_10045421 3300025925 Bacteria 3232
232 Ga0207659_10105542 3300025926 Bacteria 2132
233 Ga0207659_10305063 3300025926 Bacteria 1309
234 Ga0207659_10394439 3300025926 Bacteria 1156
235 Ga0207690_10156220 3300025932 Bacteria 1696
236 Ga0207706_10003024 3300025933 Bacteria 16208
237 Ga0207706_10095606 3300025933 Bacteria 2613
238 Ga0207686_10006409 3300025934 Bacteria 6334
239 Ga0207670_10052452 3300025936 Unclassified 2742
240 Ga0207670_10061416 3300025936 Bacteria 2564
241 Ga0207670_10077271 3300025936 Bacteria 2319
242 Ga0207669_10194361 3300025937 Bacteria 1467
243 Ga0207704_10295968 3300025938 Bacteria 1237
244 Ga0207691_10000010 3300025940 Bacteria 150194
245 Ga0207691_10008512 3300025940 Bacteria 9855
246 Ga0207691_10056464 3300025940 Bacteria 3576
247 Ga0207689_10020371 3300025942 Bacteria 5582
248 Ga0207689_10030324 3300025942 Bacteria 4506
249 Ga0207689_10034069 3300025942 Bacteria 4229
250 Ga0207689_10054281 3300025942 Bacteria 3301
251 Ga0207689_10215803 3300025942 Bacteria 1585
252 Ga0207661_10177512 3300025944 Bacteria 1858
253 Ga0207661_10215490 3300025944 Bacteria 1694
254 Ga0207679_10099396 3300025945 Bacteria 2272
255 Ga0207679_10213265 3300025945 Bacteria 1620
256 Ga0207667_10034969 3300025949 Bacteria 5393
257 Ga0207651_10068697 3300025960 Bacteria 2499
258 Ga0207651_10077193 3300025960 Bacteria 2384
259 Ga0207651_10084648 3300025960 Bacteria 2298
260 Ga0207712_10002968 3300025961 Bacteria 10833
261 Ga0207712_10006482 3300025961 Bacteria 7381
262 Ga0207712_10039025 3300025961 Bacteria 3251
263 Ga0207712_10089612 3300025961 Bacteria 2261
264 Ga0207712_10315376 3300025961 Bacteria 1288
265 Ga0207668_10000504 3300025972 Bacteria 24498
266 Ga0207640_10073946 3300025981 Bacteria 2305
267 Ga0207640_10321140 3300025981 Bacteria 1233
268 Ga0207658_10022173 3300025986 Bacteria 4419
269 Ga0207677_10023008 3300026023 Bacteria 3840
270 Ga0207677_10085849 3300026023 Bacteria 2273
271 Ga0207703_10010575 3300026035 Bacteria 7212
272 Ga0207639_10063235 3300026041 Bacteria 2865
273 Ga0207639_10067364 3300026041 Bacteria 2785
274 Ga0207639_10369314 3300026041 Bacteria 1286
275 Ga0207639_10920258 3300026041 Unclassified 818
276 Ga0207678_10054336 3300026067 Bacteria 3449
277 Ga0207678_10073923 3300026067 Bacteria 2921
278 Ga0207708_10115371 3300026075 Bacteria 2089
279 Ga0207708_10506968 3300026075 Unclassified 1012
280 Ga0207641_10000371 3300026088 Bacteria 53368
281 Ga0207641_10025299 3300026088 Bacteria 4894
282 Ga0207641_10103033 3300026088 Bacteria 2517
283 Ga0207641_10228420 3300026088 Bacteria 1729
284 Ga0207641_10388467 3300026088 Unclassified 1338
285 Ga0207648_10005547 3300026089 Bacteria 12707
286 Ga0207648_10033854 3300026089 Bacteria 4505
287 Ga0207648_10049482 3300026089 Bacteria 3677
288 Ga0207648_10603542 3300026089 Bacteria 1012
289 Ga0207676_10005051 3300026095 Bacteria 9335
290 Ga0207676_10009152 3300026095 Bacteria 7052
291 Ga0207676_10099640 3300026095 Bacteria 2405
292 Ga0207676_10107880 3300026095 Bacteria 2323
293 Ga0207676_10416214 3300026095 Bacteria 1259
294 Ga0207674_10118739 3300026116 Bacteria 2614
295 Ga0207674_10148412 3300026116 Bacteria 2302
296 Ga0207674_10234830 3300026116 Bacteria 1781
297 Ga0207675_100052388 3300026118 Bacteria 3808
298 Ga0207675_100082578 3300026118 Bacteria 3014
299 Ga0207675_100152144 3300026118 Bacteria 2203
300 Ga0207675_100274412 3300026118 Bacteria 1637
301 Ga0207675_100449333 3300026118 Unclassified 1277
302 Ga0207698_10023639 3300026142 Bacteria 4297
303 Ga0207698_10136998 3300026142 Bacteria 2102
304 Ga0207698_10769634 3300026142 Bacteria 963
305 Ga0207428_10059127 3300027907 Bacteria 3040
306 Ga0268266_10003351 3300028379 Bacteria 16038
307 Ga0268266_10136977 3300028379 Bacteria 2194
308 Ga0268265_10074892 3300028380 Unclassified 2650
309 Ga0268264_10011852 3300028381 Bacteria 7185
310 Ga0268264_10014251 3300028381 Bacteria 6536
311 Ga0373923_0138967 3300035111 Bacteria 1097
312 Ga0373957_0107045 3300035120 Bacteria 1124
313 Ga0373955_0070917 3300035172 Bacteria 1948
314 Ga0373955_0385789 3300035172 Unclassified 850
315 Ga0373947_0147777 3300035725 Bacteria 1512
316 Ga0373937_0234483 3300036401 Bacteria 1728
317 Ga0373937_0376016 3300036401 Bacteria 1347
318 Ga0451807_0419092 3300041486 Bacteria 737
319 Ga0453684_0236116 3300044712 Bacteria 2108
320 Ga0495592_0046186 3300046454 Bacteria 3247
321 Ga0495651_0438725 3300046462 Unclassified 846
322 Ga0495580_0192495 3300046472 Bacteria 1406
323 Ga0495582_0044499 3300046473 Bacteria 2445
324 Ga0495628_0142425 3300046516 Bacteria 1829
325 Ga0495630_0005840 3300046517 Bacteria 8698
326 Ga0495586_0066859 3300046535 Bacteria 1960
327 Ga0495587_0079728 3300046536 Bacteria 1898
328 Ga0495621_0016570 3300046539 Bacteria 2368
329 Ga0495621_0064139 3300046539 Bacteria 1340
330 Ga0495645_0193382 3300046543 Bacteria 1385
331 Ga0495668_0002951 3300046616 Bacteria 13382
332 Ga0495635_0198505 3300046663 Bacteria 1361
333 Ga0495647_0020590 3300046681 Bacteria 2370
334 Ga0495658_0019348 3300046683 Bacteria 3553
335 Ga0495600_0265447 3300046809 Unclassified 1090
336 Ga0495581_0205829 3300047315 Bacteria 1151
337 Ga0495680_0220554 3300047322 Bacteria 1354
338 Ga0495684_0094289 3300047471 Bacteria 2267
339 Ga0495684_0246121 3300047471 Bacteria 1302
340 Ga0496105_0334556 3300048908 Bacteria 1212
341 Ga0496114_0200690 3300048917 Bacteria 1747
342 Ga0496114_0532843 3300048917 Bacteria 1038
343 Ga0496115_0237729 3300048918 Bacteria 1502
344 Ga0501033_0188468 3300049570 Unclassified 1477
345 Ga0501033_0203678 3300049570 Bacteria 1413
346 Ga0501034_0282992 3300049571 Unclassified 1597
347 Ga0501036_0864524 3300049572 Unclassified 743
348 Ga0501043_0321001 3300049579 Bacteria 1181
349 Ga0501043_0742026 3300049579 Unclassified 714
350 Ga0501046_0097315 3300049580 Bacteria 2261
351 Ga0501048_0251304 3300049582 Bacteria 1255
352 Ga0501069_0032002 3300049585 Bacteria 2895
353 Ga0501070_0016667 3300049586 Bacteria 6171
354 Ga0501072_0601529 3300049588 Bacteria 867
355 Ga0501073_0035727 3300049589 Bacteria 3530
356 Ga0501074_0069723 3300049590 Bacteria 2528
357 Ga0501044_0435337 3300049823 Bacteria 1220
358 Ga0501044_0767792 3300049823 Unclassified 845
359 nmdc:mga09592_17892_c1 3300050508 Bacteria 5806
360 nmdc:mga0qj67_229465_c1 3300050509 Unclassified 1507
361 nmdc:mga0qj67_557441_c1 3300050509 Bacteria 919
362 nmdc:mga06r32_73826_c1 3300050510 Bacteria 3305
363 nmdc:mga08y16_589096_c1 3300050511 Bacteria 1122
364 nmdc:mga0n895_326830_c1 3300050512 Bacteria 1554
365 Ga0495595_0095702 3300053084 Bacteria 1429
366 Ga0495619_0071240 3300053085 Bacteria 2326
367 Ga0495619_0157302 3300053085 Unclassified 1569
368 Ga0500594_0052961 3300053118 Bacteria 1148
369 Ga0500568_0000988 3300053139 Bacteria 19533
370 Ga0500645_010692 3300053730 Bacteria 3022
371 Ga0501082_0049377 3300060353 Bacteria 3628
372 Ga0070671_100168435
373 rootL2_10044044
374 rootH1_10328074
375 Ga0065712_10000782
376 Ga0065715_10012640
377 Ga0065707_10124129
378 Ga0070658_10271721
379 Ga0070676_10003644
380 Ga0070676_10005766
381 Ga0070676_10183995
382 Ga0070683_100018681
383 Ga0070683_100024585
384 Ga0070690_100071169
385 Ga0070690_100120534
386 Ga0070670_100015018
387 Ga0070670_100044487
388 Ga0070670_100673530
389 Ga0068869_100004743
390 Ga0068869_100024540
391 Ga0068869_100077176
392 Ga0068869_100080682
393 Ga0068869_100147219
394 Ga0070666_10003303
395 Ga0070666_10057159
396 Ga0070666_10096654
397 Ga0070666_10400629
398 Ga0070680_100060069
399 Ga0068868_100001021
400 Ga0068868_100045180
401 Ga0068868_100057631
402 Ga0068868_100116109
403 Ga0070660_100511154
404 Ga0070689_100008355
405 Ga0070689_100050470
406 Ga0070689_100305363
407 Ga0070691_10054743
408 Ga0070687_100079237
409 Ga0070661_100076904
410 Ga0070668_100000202
411 Ga0070669_100070176
412 Ga0070675_100063757
413 Ga0070675_100135680
414 Ga0070675_100190353
415 Ga0070675_100357017
416 Ga0070675_100657685
417 Ga0070671_100187010
418 Ga0070671_100742178
419 Ga0070674_100399336
420 Ga0070673_100152942
421 Ga0070688_100147742
422 Ga0070688_100239297
423 Ga0070659_100340964
424 Ga0070667_100010801
425 Ga0070667_100401060
426 Ga0070667_100544279
427 Ga0070713_100789803
428 Ga0070663_100049478
429 Ga0070663_100062880
430 Ga0070678_100017573
431 Ga0070678_100126647
432 Ga0070662_100005538
433 Ga0070662_100014833
434 Ga0070662_100088930
435 Ga0068867_100017054
436 Ga0068867_100071784
437 Ga0068867_100152725
438 Ga0068867_100435531
439 Ga0070685_10182724
440 Ga0070685_10256644
441 Ga0070698_100005891
442 Ga0070698_100024721
443 Ga0070679_100073440
444 Ga0070684_100008427
445 Ga0070684_100140851
446 Ga0068853_100003159
447 Ga0068853_100017665
448 Ga0068853_100048030
449 Ga0070672_100001006
450 Ga0070672_100046332
451 Ga0070672_100059331
452 Ga0070693_100112146
453 Ga0070665_100002078
454 Ga0070665_100104027
455 Ga0070704_100632626
456 Ga0068855_100051272
457 Ga0068855_100125733
458 Ga0068855_100636352
459 Ga0070664_100008354
460 Ga0070664_100039136
461 Ga0070664_100209475
462 Ga0070664_100247081
463 Ga0070664_100399110
464 Ga0070664_100455630
465 Ga0068857_100108952
466 Ga0068854_100041248
467 Ga0068852_100048947
468 Ga0068852_100331949
469 Ga0068852_100364484
470 Ga0068852_100800315
471 Ga0068864_100005896
472 Ga0068864_100012029
473 Ga0068864_100210791
474 Ga0068864_100214710
475 Ga0068861_100021606
476 Ga0068861_100286989
477 Ga0068861_100387383
478 Ga0068863_100006340
479 Ga0068863_100040740
480 Ga0068863_100235057
481 Ga0068863_100472224
482 Ga0068858_100002368
483 Ga0068858_100067213
484 Ga0068858_100161885
485 Ga0068858_100211618
486 Ga0068860_100004069
487 Ga0068860_100019759
488 Ga0068860_100220554
489 Ga0068860_100363768
490 Ga0068862_100095924
491 Ga0068862_100316895
492 Ga0097621_100002272
493 Ga0097621_100015542
494 Ga0097621_100544411
495 Ga0097621_101020122
496 Ga0068871_100003857
497 Ga0068871_100032771
498 Ga0068871_100330909
499 Ga0068871_100569251
500 Ga0075428_100023738
501 Ga0075430_100018375
502 Ga0075430_100586212
503 Ga0075431_100019516
504 Ga0075431_100038176
505 Ga0075429_100090121
506 Ga0068865_100281682
507 Ga0105240_10042749
508 Ga0111539_10047359
509 Ga0111539_10214163
510 Ga0105247_10026833
511 Ga0105247_10214860
512 Ga0105241_10031380
513 Ga0105241_10182430
514 Ga0105242_10072462
515 Ga0105242_10535523
516 Ga0105248_10270890
517 Ga0105249_10014121
518 Ga0105249_10043295
519 Ga0105249_10053373
520 Ga0105249_10077368
521 Ga0105249_10089064
522 Ga0105249_10122100
523 Ga0105249_10181518
524 Ga0105249_10205510
525 Ga0105249_10298749
526 Ga0105249_10502039
527 Ga0105239_10234987
528 Ga0105239_10452042
529 Ga0105239_11023295
530 Ga0105246_11154743
531 Ga0157373_10204838
532 Ga0157370_10041005
533 Ga0157370_10980144
534 Ga0157369_10026498
535 Ga0157369_10196405
536 Ga0157369_10887491
537 Ga0157374_10037449
538 Ga0157374_10043435
539 Ga0157374_10058550
540 Ga0157374_10094707
541 Ga0157374_10257460
542 Ga0157378_10013208
543 Ga0157378_10131711
544 Ga0157378_10195307
545 Ga0157378_10418694
546 Ga0163162_10000241
547 Ga0163162_10000744
548 Ga0163162_10017362
549 Ga0163162_10028118
550 Ga0163162_10045528
551 Ga0163162_10045994
552 Ga0163162_10054016
553 Ga0163162_10055847
554 Ga0163162_10477465
555 Ga0163162_10706883
556 Ga0157372_10162795
557 Ga0157372_10261755
558 Ga0157375_10006178
559 Ga0157375_10018776
560 Ga0157375_10209925
561 Ga0157375_10280345
562 Ga0157375_10339615
563 Ga0157375_10559133
564 Ga0163163_10000577
565 Ga0163163_10001098
566 Ga0157380_10033567
567 Ga0157380_10105499
568 Ga0157380_10872244
569 Ga0157377_10023077
570 Ga0157377_10090979
571 Ga0157377_10113084
572 Ga0157379_10050035
573 Ga0157379_10186516
574 Ga0157379_10552824
575 Ga0157376_10010472
576 Ga0157376_10050304
577 Ga0157376_10167949
578 Ga0157376_10294885
579 Ga0157376_10357934
580 Ga0157376_10413996
581 Ga0157376_11284803
582 Ga0163161_10010353
583 Ga0163161_10016382
584 Ga0163161_10023253
585 Ga0163161_10091690
586 Ga0207697_10138741
587 Ga0207710_10016540
588 Ga0207710_10208087
589 Ga0207680_10155670
590 Ga0207685_10133708
591 Ga0207645_10000441
592 Ga0207645_10052327
593 Ga0207705_10001925
594 Ga0207654_10005298
595 Ga0207695_10230913
596 Ga0207660_10042360
597 Ga0207649_10022307
598 Ga0207649_10181988
599 Ga0207652_10007552
600 Ga0207681_10206483
601 Ga0207681_10516823
602 Ga0207650_10045421
603 Ga0207659_10105542
604 Ga0207659_10305063
605 Ga0207659_10394439
606 Ga0207690_10156220
607 Ga0207706_10003024
608 Ga0207706_10095606
609 Ga0207686_10006409
610 Ga0207670_10052452
611 Ga0207670_10061416
612 Ga0207670_10077271
613 Ga0207669_10194361
614 Ga0207704_10295968
615 Ga0207691_10000010
616 Ga0207691_10008512
617 Ga0207691_10056464
618 Ga0207689_10020371
619 Ga0207689_10030324
620 Ga0207689_10034069
621 Ga0207689_10054281
622 Ga0207689_10215803
623 Ga0207661_10177512
624 Ga0207661_10215490
625 Ga0207679_10099396
626 Ga0207679_10213265
627 Ga0207667_10034969
628 Ga0207651_10068697
629 Ga0207651_10077193
630 Ga0207651_10084648
631 Ga0207712_10002968
632 Ga0207712_10006482
633 Ga0207712_10039025
634 Ga0207712_10089612
635 Ga0207712_10315376
636 Ga0207668_10000504
637 Ga0207640_10073946
638 Ga0207640_10321140
639 Ga0207658_10022173
640 Ga0207677_10023008
641 Ga0207677_10085849
642 Ga0207703_10010575
643 Ga0207639_10063235
644 Ga0207639_10067364
645 Ga0207639_10369314
646 Ga0207639_10920258
647 Ga0207678_10054336
648 Ga0207678_10073923
649 Ga0207708_10115371
650 Ga0207708_10506968
651 Ga0207641_10000371
652 Ga0207641_10025299
653 Ga0207641_10103033
654 Ga0207641_10228420
655 Ga0207641_10388467
656 Ga0207648_10005547
657 Ga0207648_10033854
658 Ga0207648_10049482
659 Ga0207648_10603542
660 Ga0207676_10005051
661 Ga0207676_10009152
662 Ga0207676_10099640
663 Ga0207676_10107880
664 Ga0207676_10416214
665 Ga0207674_10118739
666 Ga0207674_10148412
667 Ga0207674_10234830
668 Ga0207675_100052388
669 Ga0207675_100082578
670 Ga0207675_100152144
671 Ga0207675_100274412
672 Ga0207675_100449333
673 Ga0207698_10023639
674 Ga0207698_10136998
675 Ga0207698_10769634
676 Ga0207428_10059127
677 Ga0268266_10003351
678 Ga0268266_10136977
679 Ga0268265_10074892
680 Ga0268264_10011852
681 Ga0268264_10014251
682 Ga0373923_0138967
683 Ga0373957_0107045
684 Ga0373955_0070917
685 Ga0373955_0385789
686 Ga0373947_0147777
687 Ga0373937_0234483
688 Ga0373937_0376016
689 Ga0451807_0419092
690 Ga0453684_0236116
691 Ga0495592_0046186
692 Ga0495651_0438725
693 Ga0495580_0192495
694 Ga0495582_0044499
695 Ga0495628_0142425
696 Ga0495630_0005840
697 Ga0495586_0066859
698 Ga0495587_0079728
699 Ga0495621_0016570
700 Ga0495621_0064139
701 Ga0495645_0193382
702 Ga0495668_0002951
703 Ga0495635_0198505
704 Ga0495647_0020590
705 Ga0495658_0019348
706 Ga0495600_0265447
707 Ga0495581_0205829
708 Ga0495680_0220554
709 Ga0495684_0094289
710 Ga0495684_0246121
711 Ga0496105_0334556
712 Ga0496114_0200690
713 Ga0496114_0532843
714 Ga0496115_0237729
715 Ga0501033_0188468
716 Ga0501033_0203678
717 Ga0501034_0282992
718 Ga0501036_0864524
719 Ga0501043_0321001
720 Ga0501043_0742026
721 Ga0501046_0097315
722 Ga0501048_0251304
723 Ga0501069_0032002
724 Ga0501070_0016667
725 Ga0501072_0601529
726 Ga0501073_0035727
727 Ga0501074_0069723
728 Ga0501044_0435337
729 Ga0501044_0767792
730 nmdc:mga09592_17892_c1
731 nmdc:mga0qj67_229465_c1
732 nmdc:mga0qj67_557441_c1
733 nmdc:mga06r32_73826_c1
734 nmdc:mga08y16_589096_c1
735 nmdc:mga0n895_326830_c1
736 Ga0495595_0095702
737 Ga0495619_0071240
738 Ga0495619_0157302
739 Ga0500594_0052961
740 Ga0500568_0000988
741 Ga0500645_010692
742 Ga0501082_0049377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

126

250

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bcz-assembly3.cif.gz_C structure of the 4'-phosphopantetheinyl transferase pcps from pseudomonas aeruginosa 0.7562 10 213
6hmj-assembly2.cif.gz_C structure of an rna-binding light-oxygen-voltage receptor 0.7466 178 213
4qjl-assembly1.cif.gz_A crystal structure of m. ulcerans phosphopantetheinyl transferase muppt 0.7333 2 214
4qdv-assembly2.cif.gz_D dcps in complex with covalent ligand 0.7272 167 200
4qjl-assembly1.cif.gz_A crystal structure of m. ulcerans phosphopantetheinyl transferase muppt 0.727 2 214
ID Description Score Start End Superfamily
af_O01508_466_622_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8149 167 196 3.90.190.10
af_Q9U2E4_9_527_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7999 169 200 2.130.10.10
af_Q9NRN7_124_248_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.7727 100 214 3.90.470.20
af_P19925_103_206_3.40.449.10 Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 0.7281 101 210 3.40.449.10
af_Q5BI42_1_825_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7246 177 213 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A162Q444-F1-model_v4 4-phosphopantetheinyl transferase 0.9657 1 212 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366
AF-A0A0C1LCC4-F1-model_v4 4-phosphopantetheinyl transferase 0.9654 1 212 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366
AF-A0A0C1KPF9-F1-model_v4 4-phosphopantetheinyl transferase 0.9643 1 212 GO:0000287
GO:0005829
GO:0008897
GO:0019878
AF-A0A832B3Q9-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.9639 1 213 GO:0000287
GO:0005829
GO:0008897
GO:0019878
AF-A0A4Q3SSN1-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.9632 1 212 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366

Map